| Basic Information | |
|---|---|
| Family ID | F094346 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 106 |
| Average Sequence Length | 38 residues |
| Representative Sequence | VSLATDTFIGPQVLTLAIPLGTLFVVLLWGFFQRRTDR |
| Number of Associated Samples | 67 |
| Number of Associated Scaffolds | 106 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 93.40 % |
| % of genes near scaffold ends (potentially truncated) | 9.43 % |
| % of genes from short scaffolds (< 2000 bps) | 56.60 % |
| Associated GOLD sequencing projects | 58 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (79.245 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds (31.132 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.019 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (41.509 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.52% β-sheet: 0.00% Coil/Unstructured: 48.48% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 106 Family Scaffolds |
|---|---|---|
| PF09678 | Caa3_CtaG | 47.17 |
| PF00115 | COX1 | 8.49 |
| PF08241 | Methyltransf_11 | 0.94 |
| PF00486 | Trans_reg_C | 0.94 |
| PF00291 | PALP | 0.94 |
| PF13561 | adh_short_C2 | 0.94 |
| PF00361 | Proton_antipo_M | 0.94 |
| PF00116 | COX2 | 0.94 |
| PF01047 | MarR | 0.94 |
| PF05235 | CHAD | 0.94 |
| PF01425 | Amidase | 0.94 |
| PF02630 | SCO1-SenC | 0.94 |
| PF13459 | Fer4_15 | 0.94 |
| PF00067 | p450 | 0.94 |
| PF02518 | HATPase_c | 0.94 |
| PF00156 | Pribosyltran | 0.94 |
| COG ID | Name | Functional Category | % Frequency in 106 Family Scaffolds |
|---|---|---|---|
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.94 |
| COG1225 | Peroxiredoxin | Posttranslational modification, protein turnover, chaperones [O] | 0.94 |
| COG1622 | Heme/copper-type cytochrome/quinol oxidase, subunit 2 | Energy production and conversion [C] | 0.94 |
| COG1999 | Cytochrome oxidase Cu insertion factor, SCO1/SenC/PrrC family | Posttranslational modification, protein turnover, chaperones [O] | 0.94 |
| COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.94 |
| COG3025 | Inorganic triphosphatase YgiF, contains CYTH and CHAD domains | Inorganic ion transport and metabolism [P] | 0.94 |
| COG4263 | Nitrous oxide reductase | Inorganic ion transport and metabolism [P] | 0.94 |
| COG5607 | CHAD domain, binds inorganic polyphosphates | Function unknown [S] | 0.94 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 79.25 % |
| Unclassified | root | N/A | 20.75 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908035|B3_GZOS_CLC_ConsensusfromContig125579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 765 | Open in IMG/M |
| 2124908040|B4_c_ConsensusfromContig37198 | Not Available | 773 | Open in IMG/M |
| 2189573002|GZIGXIF01DP7NO | Not Available | 519 | Open in IMG/M |
| 3300001398|JGI20207J14881_1045788 | Not Available | 817 | Open in IMG/M |
| 3300001398|JGI20207J14881_1080757 | Not Available | 523 | Open in IMG/M |
| 3300001412|JGI20173J14856_1008531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 21-73-9 | 2053 | Open in IMG/M |
| 3300003976|Ga0064219_11086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1144 | Open in IMG/M |
| 3300005861|Ga0080006_1135447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4217 | Open in IMG/M |
| 3300005861|Ga0080006_1140534 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 54466 | Open in IMG/M |
| 3300005861|Ga0080006_1146286 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 118174 | Open in IMG/M |
| 3300005861|Ga0080006_1186494 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 1809 | Open in IMG/M |
| 3300005861|Ga0080006_1197148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 58818 | Open in IMG/M |
| 3300005947|Ga0066794_10007173 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 3074 | Open in IMG/M |
| 3300005994|Ga0066789_10205442 | Not Available | 830 | Open in IMG/M |
| 3300006047|Ga0075024_100357060 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 732 | Open in IMG/M |
| 3300006050|Ga0075028_100069433 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 1738 | Open in IMG/M |
| 3300006052|Ga0075029_100017225 | All Organisms → cellular organisms → Bacteria | 4019 | Open in IMG/M |
| 3300006052|Ga0075029_100044371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2560 | Open in IMG/M |
| 3300006052|Ga0075029_100188432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 1283 | Open in IMG/M |
| 3300006052|Ga0075029_100859349 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 620 | Open in IMG/M |
| 3300006052|Ga0075029_101118978 | Not Available | 547 | Open in IMG/M |
| 3300006055|Ga0097691_1072061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1097 | Open in IMG/M |
| 3300006057|Ga0075026_100013760 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3531 | Open in IMG/M |
| 3300006059|Ga0075017_100001950 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 12784 | Open in IMG/M |
| 3300006059|Ga0075017_100010011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidithrix → Acidithrix ferrooxidans | 6025 | Open in IMG/M |
| 3300006059|Ga0075017_100262726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 1265 | Open in IMG/M |
| 3300006059|Ga0075017_100317367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1154 | Open in IMG/M |
| 3300006059|Ga0075017_100356404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1090 | Open in IMG/M |
| 3300006059|Ga0075017_100501134 | Not Available | 921 | Open in IMG/M |
| 3300006059|Ga0075017_100587350 | Not Available | 851 | Open in IMG/M |
| 3300006086|Ga0075019_10703985 | Not Available | 639 | Open in IMG/M |
| 3300006102|Ga0075015_100039384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2192 | Open in IMG/M |
| 3300006162|Ga0075030_101499218 | Not Available | 528 | Open in IMG/M |
| 3300006172|Ga0075018_10117002 | All Organisms → cellular organisms → Bacteria | 1199 | Open in IMG/M |
| 3300006174|Ga0075014_100357509 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 785 | Open in IMG/M |
| 3300006354|Ga0075021_10023194 | All Organisms → cellular organisms → Bacteria | 3489 | Open in IMG/M |
| 3300006354|Ga0075021_10060937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2195 | Open in IMG/M |
| 3300006354|Ga0075021_10450296 | Not Available | 811 | Open in IMG/M |
| 3300006638|Ga0075522_10423644 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 626 | Open in IMG/M |
| 3300006795|Ga0075520_1003841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidithrix → Acidithrix ferrooxidans | 7603 | Open in IMG/M |
| 3300006795|Ga0075520_1031767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 2609 | Open in IMG/M |
| 3300009029|Ga0066793_10167599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 1280 | Open in IMG/M |
| 3300009623|Ga0116133_1152878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae | 606 | Open in IMG/M |
| 3300010379|Ga0136449_101088172 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1274 | Open in IMG/M |
| 3300010387|Ga0136821_1020904 | All Organisms → cellular organisms → Bacteria | 4283 | Open in IMG/M |
| 3300010876|Ga0126361_11108781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 894 | Open in IMG/M |
| 3300011265|Ga0151613_1374764 | Not Available | 759 | Open in IMG/M |
| 3300014164|Ga0181532_10011447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6872 | Open in IMG/M |
| 3300014168|Ga0181534_10005168 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7415 | Open in IMG/M |
| 3300014490|Ga0182010_10007318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae | 5079 | Open in IMG/M |
| 3300014491|Ga0182014_10003986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 17338 | Open in IMG/M |
| 3300014492|Ga0182013_10249097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1029 | Open in IMG/M |
| 3300014493|Ga0182016_10030864 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae | 4515 | Open in IMG/M |
| 3300014493|Ga0182016_10051839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3191 | Open in IMG/M |
| 3300014493|Ga0182016_10140915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1636 | Open in IMG/M |
| 3300014495|Ga0182015_10161990 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1515 | Open in IMG/M |
| 3300014501|Ga0182024_10606943 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1369 | Open in IMG/M |
| 3300014501|Ga0182024_10895958 | Not Available | 1069 | Open in IMG/M |
| 3300014501|Ga0182024_12594004 | Not Available | 544 | Open in IMG/M |
| 3300014838|Ga0182030_10021111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 12222 | Open in IMG/M |
| 3300014838|Ga0182030_10210567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2302 | Open in IMG/M |
| 3300016750|Ga0181505_10487484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 21-73-9 | 1531 | Open in IMG/M |
| 3300017946|Ga0187879_10120227 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1498 | Open in IMG/M |
| 3300017948|Ga0187847_10616174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidiferrimicrobium → unclassified Acidiferrimicrobium → Acidiferrimicrobium sp. IK | 607 | Open in IMG/M |
| 3300018034|Ga0187863_10167107 | All Organisms → cellular organisms → Bacteria | 1227 | Open in IMG/M |
| 3300021401|Ga0210393_10801027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 767 | Open in IMG/M |
| 3300023090|Ga0224558_1053359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidithrix → Acidithrix ferrooxidans | 1632 | Open in IMG/M |
| 3300023090|Ga0224558_1124014 | Not Available | 864 | Open in IMG/M |
| 3300025474|Ga0208479_1000093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 10937 | Open in IMG/M |
| 3300025482|Ga0208715_1002929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 3862 | Open in IMG/M |
| 3300025484|Ga0208587_1018618 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2231 | Open in IMG/M |
| 3300025495|Ga0207932_1002662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales | 6049 | Open in IMG/M |
| 3300025503|Ga0209012_1000167 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 107009 | Open in IMG/M |
| 3300025503|Ga0209012_1000448 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 58824 | Open in IMG/M |
| 3300025503|Ga0209012_1000503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 54478 | Open in IMG/M |
| 3300025503|Ga0209012_1002048 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 18690 | Open in IMG/M |
| 3300025503|Ga0209012_1066419 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 828 | Open in IMG/M |
| 3300025588|Ga0208586_1012130 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2183 | Open in IMG/M |
| 3300025650|Ga0209385_1001625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 9644 | Open in IMG/M |
| 3300025650|Ga0209385_1068538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1234 | Open in IMG/M |
| 3300025862|Ga0209483_1027346 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 2859 | Open in IMG/M |
| 3300027894|Ga0209068_10017327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3481 | Open in IMG/M |
| 3300027894|Ga0209068_10030896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2651 | Open in IMG/M |
| 3300027894|Ga0209068_10587938 | Not Available | 647 | Open in IMG/M |
| 3300027898|Ga0209067_10003450 | All Organisms → cellular organisms → Bacteria | 9045 | Open in IMG/M |
| 3300027898|Ga0209067_10004285 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae | 8049 | Open in IMG/M |
| 3300027898|Ga0209067_10054197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2047 | Open in IMG/M |
| 3300027898|Ga0209067_10675680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 597 | Open in IMG/M |
| 3300027902|Ga0209048_10491496 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 830 | Open in IMG/M |
| 3300027911|Ga0209698_10253721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 1404 | Open in IMG/M |
| 3300027911|Ga0209698_10883261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 671 | Open in IMG/M |
| 3300027911|Ga0209698_10926432 | Not Available | 652 | Open in IMG/M |
| 3300028562|Ga0302151_10073441 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Ferrithrix → Ferrithrix thermotolerans | 1215 | Open in IMG/M |
| 3300028565|Ga0302145_10213185 | Not Available | 644 | Open in IMG/M |
| 3300028745|Ga0302267_10128766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 1197 | Open in IMG/M |
| 3300029894|Ga0247028_1017578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2560 | Open in IMG/M |
| 3300029914|Ga0311359_11114212 | Not Available | 523 | Open in IMG/M |
| 3300030020|Ga0311344_10111209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3075 | Open in IMG/M |
| 3300030020|Ga0311344_10924350 | Not Available | 691 | Open in IMG/M |
| 3300030020|Ga0311344_10953763 | Not Available | 675 | Open in IMG/M |
| 3300031261|Ga0302140_10880492 | Not Available | 629 | Open in IMG/M |
| 3300031670|Ga0307374_10130454 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2032 | Open in IMG/M |
| 3300032160|Ga0311301_10731998 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1380 | Open in IMG/M |
| 3300034163|Ga0370515_0022100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 21-73-9 | 2918 | Open in IMG/M |
| 3300034282|Ga0370492_0032804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 2135 | Open in IMG/M |
| 3300034282|Ga0370492_0055246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 1628 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 31.13% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 14.15% |
| Hypersaline Mat | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Hypersaline Mat | 9.43% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 7.55% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 6.60% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.77% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 2.83% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 2.83% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.89% |
| Sediment | Environmental → Aquatic → Freshwater → Groundwater → Mine Drainage → Sediment | 1.89% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 1.89% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.89% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.89% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.94% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.94% |
| Cryconite | Environmental → Aquatic → Freshwater → Ice → Unclassified → Cryconite | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.94% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.94% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.94% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.94% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.94% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908035 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog Site B3 | Environmental | Open in IMG/M |
| 2124908040 | Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Bog Site B4 | Environmental | Open in IMG/M |
| 2189573002 | Grass soil microbial communities from Rothamsted Park, UK - FE1 (NaCl 30g/L 5ml) | Environmental | Open in IMG/M |
| 3300001398 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-3 deep-092012 | Environmental | Open in IMG/M |
| 3300001412 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 | Environmental | Open in IMG/M |
| 3300003976 | Soil microbial communities from Barrow, Alaska NGEE-2011 | Environmental | Open in IMG/M |
| 3300005861 | Ferric oxide microbial mat and aquatic microbial communities from Rainbow Spring, Yellowstone National Park, USA - RS3B (SPADES assembly) | Environmental | Open in IMG/M |
| 3300005947 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 | Environmental | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006055 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006638 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A | Environmental | Open in IMG/M |
| 3300006795 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B | Environmental | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010387 | Acid mine drainage microbial communities from Malanjkhand copper mine, India - M8 k-mer 51 | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011265 | Acid mine drainage microbial communities from Malanjkhand copper mine, India - M8 K-mer 55 | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300014490 | Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaG | Environmental | Open in IMG/M |
| 3300014491 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG | Environmental | Open in IMG/M |
| 3300014492 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaG | Environmental | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300023090 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24 | Environmental | Open in IMG/M |
| 3300025474 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-3 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025482 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025484 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025495 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025503 | Ferric oxide microbial mat and aquatic microbial communities from Rainbow Spring, Yellowstone National Park, USA - RS3B (SPAdes) | Environmental | Open in IMG/M |
| 3300025588 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-3 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025650 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B (SPAdes) | Environmental | Open in IMG/M |
| 3300025862 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028562 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_3 | Environmental | Open in IMG/M |
| 3300028565 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_3 | Environmental | Open in IMG/M |
| 3300028745 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_3 | Environmental | Open in IMG/M |
| 3300029894 | Cryconite microbial communities from ice sheet in Tasiilaq, Greenland - TAS_L-A1b | Environmental | Open in IMG/M |
| 3300029914 | III_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300030020 | II_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300031261 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1 | Environmental | Open in IMG/M |
| 3300031670 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-3 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| 3300034282 | Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B3_GZOS_CLC_01293890 | 2124908035 | Soil | MSNATDSFIGPEVLTVAIPLGTFVVVLLWGFFQRRTNRP |
| B4_c_00653800 | 2124908040 | Soil | MSXATDSXIGPEVLTVXIPXGXXVVVXLWGFFQRRXXXP |
| FE1_00996960 | 2189573002 | Grass Soil | VSLATDTFIGPQVLTLAIPLGTLFVVLLWGFFQRRTDR |
| JGI20207J14881_10457882 | 3300001398 | Arctic Peat Soil | VSLATDMFIGPEVLTVAIPLGTLFAVMLWGFFQRRTNR* |
| JGI20207J14881_10807572 | 3300001398 | Arctic Peat Soil | MGIATDIFIGGQVLTTVIPLGTLFLVCLWGFFQRRSHR* |
| JGI20173J14856_10085313 | 3300001412 | Arctic Peat Soil | MTVAADNFIGPEVLTLVVPLGTLFAVLLWGFFQRRSPK* |
| Ga0064219_110862 | 3300003976 | Soil | MSIATDSYIGPEVLTVAIPLGSLLLVILWGFFQRRTNRQ* |
| Ga0080006_11354475 | 3300005861 | Hypersaline Mat | MNIANDTWIGPEVLTLVIPLGTLFAIILWGFFQRRNSQ* |
| Ga0080006_114053439 | 3300005861 | Hypersaline Mat | VQVLSATDSFIGAQALTIAIPLGTLFVVLLWGFFQRRSHR* |
| Ga0080006_1146286116 | 3300005861 | Hypersaline Mat | MNLAADTWIGPQVLTLVVPLGTLFAILLWGFFQRRSSR* |
| Ga0080006_11864943 | 3300005861 | Hypersaline Mat | MNIATDSYIGAQVLTLVVPLGTLFALLLWGFFQRRSPR* |
| Ga0080006_119714834 | 3300005861 | Hypersaline Mat | VSIGTDEFIGPQVLTLVIPLGTLFAVLLWGFFQRRTDR* |
| Ga0066794_100071734 | 3300005947 | Soil | VSVATDSFIGAQVLTLAIPLGTLFVVCLWGFFQRRSHR* |
| Ga0066789_102054421 | 3300005994 | Soil | MNLATDGYIGPQVLTLAIPLGTLFLVLLWGFFQRRSSQ* |
| Ga0075024_1003570602 | 3300006047 | Watersheds | LDTDTFIGAQALTIAIPLGTLFVVCIWGFFQRRSHR* |
| Ga0075028_1000694332 | 3300006050 | Watersheds | VTLDTDTFIGGQILTIAIPLGTLFVVCIWGFFQRRSHR* |
| Ga0075029_1000172255 | 3300006052 | Watersheds | MNLAADPWIGPQVLTLVVPLGTLFAVLLWGFFQRRSSR* |
| Ga0075029_1000443714 | 3300006052 | Watersheds | MNLAADTWIGPQVQTLVVPLGTLFVVLLWGFFQRRSSR* |
| Ga0075029_1001884322 | 3300006052 | Watersheds | MNLAVDTWIGPQVLTLVVPLGTLFAVLLWGFFQRRSSR* |
| Ga0075029_1008593492 | 3300006052 | Watersheds | MTTAVDPYIGAQVLTLVLPLGTLFAVLLWGFFQRRAPK* |
| Ga0075029_1011189782 | 3300006052 | Watersheds | MSLATDTWIGPEVLTLAIPLGTLFVVLLWGFFQRRSSQ* |
| Ga0097691_10720611 | 3300006055 | Arctic Peat Soil | MNVAVDSYIGPQVLTLVIPLGTLFAVLLWGFFQRRSSR* |
| Ga0075026_1000137603 | 3300006057 | Watersheds | VTLDTDTFIGAQALTIAIPLGTLFVVCIWGFFQRRSHR* |
| Ga0075017_1000019509 | 3300006059 | Watersheds | MNVATDSYIGAQVMTLALPLGVFIAGCLWGFFQRRSSP* |
| Ga0075017_1000100112 | 3300006059 | Watersheds | MSLATDGYIGPEVLTLAIPLGTLFLVLLWGFFQRRSSQ* |
| Ga0075017_1002627262 | 3300006059 | Watersheds | LDTDTFIGGQVLTIAIPLGTLFVVCIWGFFQRRSHR* |
| Ga0075017_1003173673 | 3300006059 | Watersheds | VSPVSIATDHYVGSQVLTLAIPLGTLFVVLLWGFFQRHTDR* |
| Ga0075017_1003564042 | 3300006059 | Watersheds | MDFSTDTFIGPEVLTLVVPLGTLFALLLWGFFQRHSSR* |
| Ga0075017_1005011342 | 3300006059 | Watersheds | VSLATDTFIGPQVLTLAIPLGTLFVVLLWGFFQRRTDR* |
| Ga0075017_1005873502 | 3300006059 | Watersheds | PNARVVSHMNLAADTWIGPQVLTLVVPLGTLFAVLLWGFFQRRSSR* |
| Ga0075019_107039851 | 3300006086 | Watersheds | MNVAVDTYIGPEVLTLVIPLGTLFVVVLWGFFQRRSPR* |
| Ga0075015_1000393843 | 3300006102 | Watersheds | MTVAGDNFIGPEVLTLVVPLGTLFAVLLWGFFQRRSPQ* |
| Ga0075030_1014992182 | 3300006162 | Watersheds | VGIAADHYVGSQVLTIAIPLGTLFVVLLWGFFQRKSHR* |
| Ga0075018_101170021 | 3300006172 | Watersheds | LDTDTFIGGQILTIAIPLGTLFVVCIWGFFQRRSHR* |
| Ga0075014_1003575092 | 3300006174 | Watersheds | MNLAADTWIGPQVQTLVVPLGTLFVVLLWGFFQRRSS |
| Ga0075021_100231945 | 3300006354 | Watersheds | MNISTDTWIGPEVLTLVIPLGTLFAILLWGFFQRRSPQ* |
| Ga0075021_100609372 | 3300006354 | Watersheds | VDRPVTLDTDTFIGGQILTIAIPLGTLFVVCIWGFFQRRSHR* |
| Ga0075021_104502962 | 3300006354 | Watersheds | VTLGTDTFIGAQALTIAIPLGTLFVVCIWGFFQRRSHR* |
| Ga0075522_104236442 | 3300006638 | Arctic Peat Soil | LSVATDTFIGGQILTIAIPLGTLFAICLWGFFQRRSHR* |
| Ga0075520_10038413 | 3300006795 | Arctic Peat Soil | MTVAADNFIGPEVLTLVVPLGTLFAVLLWGFFQRRSPQ* |
| Ga0075520_10317674 | 3300006795 | Arctic Peat Soil | VSIATDEFIGPQVLTLAIPLGTLFVVLLWGFFQRRTHR* |
| Ga0066793_101675992 | 3300009029 | Prmafrost Soil | MSPATDSFIGGQVLTLAIPLGTFFVVCLWGFFQRRTHR* |
| Ga0116133_11528782 | 3300009623 | Peatland | MSIATDSFIGPEVLTVAIPLGTLFLVILWGFFQRRTNRR* |
| Ga0136449_1010881723 | 3300010379 | Peatlands Soil | VSLATDSFIGPQVLTLAIPLGTLFLVLLWGFFQRRTDR* |
| Ga0136821_10209046 | 3300010387 | Sediment | TDEFIGPQVLTLAIPLGTLFVVLLWGFFQRRTHR* |
| Ga0126361_111087812 | 3300010876 | Boreal Forest Soil | VSLATDSFIGPQVLTLAIPLGTLFVVMLWGFFQRRTDR* |
| Ga0151613_13747641 | 3300011265 | Sediment | ATDEFIGPQVLTLAIPLGTLFVVLLWGFFQRRTHR* |
| Ga0181532_100114478 | 3300014164 | Bog | MSNATDSFIGPEVLTVAIPLGSFVVVLLWGFFQRRTNRQ* |
| Ga0181534_100051686 | 3300014168 | Bog | MIASDSFIGPEVLTVAIPLGTLFLVLLWGFFQRRSDRW* |
| Ga0182010_100073185 | 3300014490 | Fen | MSIATDSFIGPEVLTVAIPLGSFIVVLLWGFFQRRTNRQ* |
| Ga0182014_1000398612 | 3300014491 | Bog | MSIATDSYIGPEVLTVAIPLGSLLLVMLWGFFQRRTNRQ* |
| Ga0182013_102490973 | 3300014492 | Bog | MSIATDEFIGPQILTLVIPLGTLVVVLLWGFFQRRTNR* |
| Ga0182016_100308642 | 3300014493 | Bog | VSVAADTWIGPQALTIAIPLGTLFVVLLWGFFQRRSSR* |
| Ga0182016_100518393 | 3300014493 | Bog | MSIASDIFIGPEILTVAIPLGTLFLVILWGFFQRRTNRR* |
| Ga0182016_101409153 | 3300014493 | Bog | MSTATDMFIGPEVLTVAIPLGTLFLVILWGFFQRRTNRR* |
| Ga0182015_101619903 | 3300014495 | Palsa | MSIAADSFLGGQVLTTAIPLGTLFLVCLWGFFQRRSHQ* |
| Ga0182024_106069432 | 3300014501 | Permafrost | MSIATDTFIGPEVLTVAIPLGALFLVMLWGFFQRRTNGR* |
| Ga0182024_108959582 | 3300014501 | Permafrost | MSIASDIYIGPEVLTVAIPLGTLFLVMLWGFFQRRTNRR* |
| Ga0182024_125940042 | 3300014501 | Permafrost | VSFATDMSIGPQVLTVAIPLGTFFAVMIWLFFQRRTARR* |
| Ga0182030_1002111111 | 3300014838 | Bog | VSIATDSFIGPEVLTVAIPLGTFFLVLLWGFFQRGANKR* |
| Ga0182030_102105673 | 3300014838 | Bog | MSFATDIYIGPQVLTVAIPLGTLFAVILWGFFQRRTNRR* |
| Ga0181505_104874842 | 3300016750 | Peatland | MSNATDSFIGPEVLTVAIPLGSFVVVLLWGFFQRRTNRQ |
| Ga0187879_101202273 | 3300017946 | Peatland | MSIATDSFIGPEVLTVAIPLGTLFVVLLWGFFQRRTNRR |
| Ga0187847_106161742 | 3300017948 | Peatland | MSIATDSFIGPEVLTVAIPLGTLFVVLLWGFFQRRTNR |
| Ga0187863_101671073 | 3300018034 | Peatland | VSIATDSFIGPEVLTVAIPLGTFFLVLLWGFFQRGANKR |
| Ga0210393_108010272 | 3300021401 | Soil | VSLATDSFIGPQVLTLAIPLGTFFAVMLWAFFQRRTDR |
| Ga0224558_10533593 | 3300023090 | Soil | VIIATDTFIGGQVLTLAIPLGTLFLVLLWGFFQRRSPR |
| Ga0224558_11240142 | 3300023090 | Soil | MSIATDSFIGPEVLTVAIPLGSFIVVLLWGFFQRRTNRQ |
| Ga0208479_10000932 | 3300025474 | Arctic Peat Soil | MSIATDSYIGPEVLTVAIPLGSLLLVILWGFFQRRTNRQ |
| Ga0208715_10029292 | 3300025482 | Arctic Peat Soil | MNVAVDSYIGPQVLTLVIPLGTLFAVLLWGFFQRRSSR |
| Ga0208587_10186182 | 3300025484 | Arctic Peat Soil | MTVAADNFIGPQVLTLVVPLGTLFAVILWGFFQRRSPR |
| Ga0207932_10026625 | 3300025495 | Arctic Peat Soil | MTVASDNFIGPEVLTLVVPLGTLFAVLLWGFFQRRSPQ |
| Ga0209012_100016789 | 3300025503 | Hypersaline Mat | MNLAADTWIGPQVLTLVVPLGTLFAILLWGFFQRRSSR |
| Ga0209012_100044830 | 3300025503 | Hypersaline Mat | VSIGTDEFIGPQVLTLVIPLGTLFAVLLWGFFQRRTDR |
| Ga0209012_100050339 | 3300025503 | Hypersaline Mat | VQVLSATDSFIGAQALTIAIPLGTLFVVLLWGFFQRRSHR |
| Ga0209012_10020482 | 3300025503 | Hypersaline Mat | MNIANDTWIGPEVLTLVIPLGTLFAIILWGFFQRRNSQ |
| Ga0209012_10664192 | 3300025503 | Hypersaline Mat | MNIATDSYIGAQVLTLVVPLGTLFALLLWGFFQRRSPR |
| Ga0208586_10121302 | 3300025588 | Arctic Peat Soil | VSLATDSFIGPQVLTIAIPLGTFFVVVLWGFFQRRTDR |
| Ga0209385_10016256 | 3300025650 | Arctic Peat Soil | MTVAADNFIGPEVLTLVVPLGTLFAVLLWGFFQRRSPQ |
| Ga0209385_10685382 | 3300025650 | Arctic Peat Soil | VSIATDEFIGPQVLTLAIPLGTLFVVLLWGFFQRRTHR |
| Ga0209483_10273463 | 3300025862 | Arctic Peat Soil | VSVATDSFIGAQVLTLAIPLGTLFVVCLWGFFQRRSHR |
| Ga0209068_100173272 | 3300027894 | Watersheds | VDRPVTLDTDTFIGGQILTIAIPLGTLFVVCIWGFFQRRSHR |
| Ga0209068_100308963 | 3300027894 | Watersheds | VTLDTDTFIGAQALTIAIPLGTLFVVCIWGFFQRRSHR |
| Ga0209068_105879382 | 3300027894 | Watersheds | MSLATDGYIGPEVLTLAIPLGTLFLVLLWGFFQRRSSQ |
| Ga0209067_100034507 | 3300027898 | Watersheds | MNLAADPWIGPQVLTLVVPLGTLFAVLLWGFFQRRSSR |
| Ga0209067_100042853 | 3300027898 | Watersheds | MNLAVDTWIGPQVLTLVVPLGTLFAVLLWGFFQRRSSR |
| Ga0209067_100541972 | 3300027898 | Watersheds | MNLAADTWIGPQVQTLVVPLGTLFVVLLWGFFQRRSSR |
| Ga0209067_106756802 | 3300027898 | Watersheds | MNLAADTWIGPQVLTLVVPLGTLFAVLLWGFFQRRSSR |
| Ga0209048_104914961 | 3300027902 | Freshwater Lake Sediment | MNLAVDTWIGPQVLTLVVPLGTLFAVLLWGFFQRRSS |
| Ga0209698_102537212 | 3300027911 | Watersheds | LDTDTFIGGQVLTIAIPLGTLFVVCIWGFFQRRSHR |
| Ga0209698_108832611 | 3300027911 | Watersheds | MNLAVDTWIGPQVLTLVVPLGTLFAVLLWGFFQRRSP |
| Ga0209698_109264322 | 3300027911 | Watersheds | VGIAADHYVGSQVLTIAIPLGTLFAVLLWGFFQRKSHR |
| Ga0302151_100734411 | 3300028562 | Bog | VTLATDTFIGPQVLTIAVPLGTFFAVLLWGFFQRRSHR |
| Ga0302145_102131852 | 3300028565 | Bog | MSTATDMFIGPEVLTVAIPLGTLFLVILWGFFQRRTNRR |
| Ga0302267_101287662 | 3300028745 | Bog | VSVAADTWIGPQALTIAIPLGTLFVVLLWGFFQRRSSR |
| Ga0247028_10175782 | 3300029894 | Cryconite | MNLSTDTWIGPQVLTLVIPLGTLFAILLWGFFQRRSQQ |
| Ga0311359_111142122 | 3300029914 | Bog | AADTWIGPQALTIAIPLGTLFVVLLWGFFQRRSSR |
| Ga0311344_101112093 | 3300030020 | Bog | VSIAADTWIGPQALTLAIPLGTLFLVLLWGFFQRRSSR |
| Ga0311344_109243502 | 3300030020 | Bog | MNLAADTWIGPQVLTLVVPLGTLFVVLLWGFFQRRSSR |
| Ga0311344_109537631 | 3300030020 | Bog | MSVAMDSYIGPETLTLVVPLGTLLVVLLWGFFQRRSSR |
| Ga0302140_108804922 | 3300031261 | Bog | GAPVSVAADTWIGPQALTIAIPLGTLFVVLLWGFFQRRSSR |
| Ga0307374_101304544 | 3300031670 | Soil | MSVATDTFIGGQVLTIAIPLGTLFVVCLWGFFQRRSHR |
| Ga0311301_107319982 | 3300032160 | Peatlands Soil | VSLATDSFIGPQVLTLAIPLGTLFLVLLWGFFQRRTDR |
| Ga0370515_0022100_377_493 | 3300034163 | Untreated Peat Soil | MSSATDTFIGPQVLTLAIPLGTLFVVMLWGFFQRRTHR |
| Ga0370492_0032804_91_207 | 3300034282 | Untreated Peat Soil | MNVAVDSYIGPEVLTLVIPLGTLFAVLLWGFFQRRSSR |
| Ga0370492_0055246_885_1001 | 3300034282 | Untreated Peat Soil | MSIATDDFIGPQVLTLAIPLGTLFVVLLWGFFQRRTNR |
| ⦗Top⦘ |