NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F091322

Metagenome / Metatranscriptome Family F091322

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F091322
Family Type Metagenome / Metatranscriptome
Number of Sequences 107
Average Sequence Length 143 residues
Representative Sequence MATAAGSAFPRIVSNNLVTKSAFLSYSRYLAFGFGYFYAFGKLIYLQAYVESEDQKKIAQLREAEISMNTLRGVTFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQVSRGRQRDQKVKEELHSEAVAFLKEWKAAEGK
Number of Associated Samples 67
Number of Associated Scaffolds 107

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 80.37 %
% of genes from short scaffolds (< 2000 bps) 100.00 %
Associated GOLD sequencing projects 58
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (100.000 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(86.916 % of family members)
Environment Ontology (ENVO) Unclassified
(97.196 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(88.785 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 55.94%    β-sheet: 2.80%    Coil/Unstructured: 41.26%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300008013|Ga0099809_10019843All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa540Open in IMG/M
3300008043|Ga0099807_1456113All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa668Open in IMG/M
3300008832|Ga0103951_10582371All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa609Open in IMG/M
3300008998|Ga0103502_10367590All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa532Open in IMG/M
3300017224|Ga0186352_118682All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa859Open in IMG/M
3300017273|Ga0186465_118470All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa755Open in IMG/M
3300018680|Ga0193263_1049481All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa553Open in IMG/M
3300018683|Ga0192952_1025570All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa602Open in IMG/M
3300018707|Ga0192876_1062957All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa550Open in IMG/M
3300018720|Ga0192866_1075782All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa500Open in IMG/M
3300018737|Ga0193418_1048391All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa716Open in IMG/M
3300018737|Ga0193418_1057899All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa641Open in IMG/M
3300018737|Ga0193418_1083217All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa502Open in IMG/M
3300018748|Ga0193416_1052184All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa660Open in IMG/M
3300018748|Ga0193416_1056809All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa626Open in IMG/M
3300018762|Ga0192963_1050742All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa685Open in IMG/M
3300018777|Ga0192839_1067151All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa556Open in IMG/M
3300018793|Ga0192928_1083415All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa550Open in IMG/M
3300018803|Ga0193281_1095143All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa562Open in IMG/M
3300018807|Ga0193441_1068040All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa624Open in IMG/M
3300018834|Ga0192877_1103041All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa753Open in IMG/M
3300018863|Ga0192835_1071384All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa676Open in IMG/M
3300018863|Ga0192835_1081839All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa626Open in IMG/M
3300018867|Ga0192859_1076895All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa550Open in IMG/M
3300018872|Ga0193162_1101429All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa545Open in IMG/M
3300018872|Ga0193162_1106567All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa528Open in IMG/M
3300018873|Ga0193553_1134208All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa585Open in IMG/M
3300018883|Ga0193276_1102699All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa581Open in IMG/M
3300018887|Ga0193360_1121425All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa583Open in IMG/M
3300018923|Ga0193262_10078299All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa686Open in IMG/M
3300018930|Ga0192955_10164206All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa572Open in IMG/M
3300018937|Ga0193448_1092878All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa704Open in IMG/M
3300018941|Ga0193265_10264162All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa504Open in IMG/M
3300018950|Ga0192892_10213664All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa625Open in IMG/M
3300018950|Ga0192892_10236751All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa576Open in IMG/M
3300018950|Ga0192892_10238868All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa572Open in IMG/M
3300018960|Ga0192930_10311830All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa506Open in IMG/M
3300018961|Ga0193531_10338867All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa502Open in IMG/M
3300018963|Ga0193332_10214613All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa603Open in IMG/M
3300018963|Ga0193332_10234589All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa567Open in IMG/M
3300018963|Ga0193332_10256902All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa530Open in IMG/M
3300018964|Ga0193087_10193712All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa653Open in IMG/M
3300018964|Ga0193087_10222284All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa601Open in IMG/M
3300018970|Ga0193417_10151210All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa752Open in IMG/M
3300018970|Ga0193417_10163784All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa714Open in IMG/M
3300018970|Ga0193417_10169624All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa698Open in IMG/M
3300018970|Ga0193417_10200281All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa623Open in IMG/M
3300018970|Ga0193417_10213518All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa596Open in IMG/M
3300018971|Ga0193559_10267291All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa521Open in IMG/M
3300018972|Ga0193326_10075624All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa549Open in IMG/M
3300018979|Ga0193540_10203608All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa544Open in IMG/M
3300018992|Ga0193518_10255382All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa649Open in IMG/M
3300018994|Ga0193280_10260717All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa656Open in IMG/M
3300019000|Ga0192953_10114203All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa660Open in IMG/M
3300019000|Ga0192953_10157613All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa572Open in IMG/M
3300019000|Ga0192953_10186624All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa527Open in IMG/M
3300019002|Ga0193345_10144182All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa668Open in IMG/M
3300019002|Ga0193345_10208321All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa533Open in IMG/M
3300019005|Ga0193527_10359781All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa576Open in IMG/M
3300019008|Ga0193361_10206599All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa723Open in IMG/M
3300019008|Ga0193361_10332571All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa512Open in IMG/M
3300019012|Ga0193043_10270341All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa632Open in IMG/M
3300019012|Ga0193043_10303063All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa578Open in IMG/M
3300019012|Ga0193043_10348915All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa517Open in IMG/M
3300019013|Ga0193557_10151619All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa803Open in IMG/M
3300019013|Ga0193557_10183232All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa705Open in IMG/M
3300019013|Ga0193557_10187399All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa694Open in IMG/M
3300019013|Ga0193557_10230021All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa596Open in IMG/M
3300019014|Ga0193299_10243820All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa707Open in IMG/M
3300019014|Ga0193299_10311668All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa592Open in IMG/M
3300019015|Ga0193525_10331367All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa716Open in IMG/M
3300019015|Ga0193525_10392231All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa629Open in IMG/M
3300019015|Ga0193525_10399538All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa620Open in IMG/M
3300019015|Ga0193525_10406735All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa611Open in IMG/M
3300019017|Ga0193569_10416580All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa513Open in IMG/M
3300019023|Ga0193561_10254484All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa655Open in IMG/M
3300019023|Ga0193561_10283797All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa601Open in IMG/M
3300019023|Ga0193561_10341184All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa516Open in IMG/M
3300019028|Ga0193449_10256102All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa749Open in IMG/M
3300019028|Ga0193449_10298786All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa672Open in IMG/M
3300019028|Ga0193449_10339650All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa611Open in IMG/M
3300019028|Ga0193449_10376469All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa564Open in IMG/M
3300019030|Ga0192905_10197579All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa553Open in IMG/M
3300019038|Ga0193558_10263148All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa660Open in IMG/M
3300019040|Ga0192857_10233650All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa605Open in IMG/M
3300019040|Ga0192857_10237149All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa602Open in IMG/M
3300019040|Ga0192857_10284808All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa560Open in IMG/M
3300019040|Ga0192857_10311113All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa540Open in IMG/M
3300019041|Ga0193556_10188604All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa619Open in IMG/M
3300019049|Ga0193082_10831196All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa520Open in IMG/M
3300019052|Ga0193455_10440011All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa525Open in IMG/M
3300019131|Ga0193249_1137157All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa531Open in IMG/M
3300019143|Ga0192856_1055955All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa569Open in IMG/M
3300019143|Ga0192856_1073775All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa503Open in IMG/M
3300019144|Ga0193246_10224059All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa599Open in IMG/M
3300019147|Ga0193453_1151727All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa603Open in IMG/M
3300019148|Ga0193239_10274509All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa595Open in IMG/M
3300031056|Ga0138346_10161080All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa592Open in IMG/M
3300031056|Ga0138346_10826773All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa700Open in IMG/M
3300031113|Ga0138347_10014510All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa662Open in IMG/M
3300031121|Ga0138345_10024058All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa664Open in IMG/M
3300031121|Ga0138345_10068335All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa551Open in IMG/M
3300031121|Ga0138345_10738817All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa512Open in IMG/M
3300031121|Ga0138345_10876117All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa516Open in IMG/M
3300031231|Ga0170824_115466367All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa540Open in IMG/M
3300031710|Ga0307386_10637020All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa567Open in IMG/M
3300031737|Ga0307387_10725430All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa626Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine86.92%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine8.41%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated1.87%
CoralHost-Associated → Invertebrates → Cnidaria → Coral → Unclassified → Coral1.87%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300008013Coral microbial communities from Puerto Morelos, Mexico - Orbicella T R C metatranscriptome (Eukaryote Community Metatranscriptome)Host-AssociatedOpen in IMG/M
3300008043Coral microbial communities from Puerto Morelos, Mexico - Orbicella T R A metatranscriptome (Eukaryote Community Metatranscriptome)Host-AssociatedOpen in IMG/M
3300008832Eukaryotic communities of water collected during the Tara Oceans expedition - TARA_A200000150EnvironmentalOpen in IMG/M
3300008998Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_A100000548EnvironmentalOpen in IMG/M
3300017224Metatranscriptome of marine eukaryotic communities from North Sea grown at 20 C, 30 psu salinity and 440 ?mol photons light - Ammonia sp. (MMETSP1384)Host-AssociatedOpen in IMG/M
3300017273Metatranscriptome of marine eukaryotic communities from English Channel grown at 18 C, 40 psu salinity and 447 ?mol photons light - Elphidium margaritaceum (MMETSP1385)Host-AssociatedOpen in IMG/M
3300018680Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001123 (ERX1789497-ERR1719250)EnvironmentalOpen in IMG/M
3300018683Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001394 (ERX1782475-ERR1712204)EnvironmentalOpen in IMG/M
3300018707Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000746 (ERX1789613-ERR1719509)EnvironmentalOpen in IMG/M
3300018720Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000793 (ERX1789656-ERR1719302)EnvironmentalOpen in IMG/M
3300018737Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_125 - TARA_N000002025 (ERX1789417-ERR1719385)EnvironmentalOpen in IMG/M
3300018748Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_125 - TARA_N000002025 (ERX1789516-ERR1719249)EnvironmentalOpen in IMG/M
3300018762Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001006 (ERX1789586-ERR1719157)EnvironmentalOpen in IMG/M
3300018777Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_052 - TARA_N000000589 (ERX1789605-ERR1719349)EnvironmentalOpen in IMG/M
3300018793Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000876 (ERX1789367-ERR1719325)EnvironmentalOpen in IMG/M
3300018803Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001586 (ERX1789721-ERR1719184)EnvironmentalOpen in IMG/M
3300018807Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002356 (ERX1789611-ERR1719493)EnvironmentalOpen in IMG/M
3300018834Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000746 (ERX1789722-ERR1719319)EnvironmentalOpen in IMG/M
3300018863Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_052 - TARA_N000000581 (ERX1789689-ERR1719283)EnvironmentalOpen in IMG/M
3300018867Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000968 (ERX1789681-ERR1719251)EnvironmentalOpen in IMG/M
3300018872Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_E500000196 (ERX1789513-ERR1719216)EnvironmentalOpen in IMG/M
3300018873Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001098EnvironmentalOpen in IMG/M
3300018883Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001582 (ERX1789446-ERR1719492)EnvironmentalOpen in IMG/M
3300018887Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001826 (ERX1789534-ERR1719462)EnvironmentalOpen in IMG/M
3300018923Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001123 (ERX1789560-ERR1719496)EnvironmentalOpen in IMG/M
3300018930Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001396 (ERX1782254-ERR1712008)EnvironmentalOpen in IMG/M
3300018937Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002364 (ERX1789592-ERR1719202)EnvironmentalOpen in IMG/M
3300018941Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001288 (ERX1789482-ERR1719320)EnvironmentalOpen in IMG/M
3300018950Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000711 (ERX1789413-ERR1719427)EnvironmentalOpen in IMG/M
3300018960Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000879 (ERX1789423-ERR1719357)EnvironmentalOpen in IMG/M
3300018961Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002783 (ERX1789414-ERR1719458)EnvironmentalOpen in IMG/M
3300018963Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_109 - TARA_N000001796 (ERX1789664-ERR1719481)EnvironmentalOpen in IMG/M
3300018964Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000939 (ERX1782328-ERR1712130)EnvironmentalOpen in IMG/M
3300018970Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_125 - TARA_N000002025 (ERX1789437-ERR1719295)EnvironmentalOpen in IMG/M
3300018971Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_143 - TARA_N000003148EnvironmentalOpen in IMG/M
3300018972Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_109 - TARA_N000001734 (ERX1789632-ERR1719168)EnvironmentalOpen in IMG/M
3300018979Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002817 (ERX1782403-ERR1712037)EnvironmentalOpen in IMG/M
3300018992Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_146 - TARA_N000003240 (ERX1789485-ERR1719233)EnvironmentalOpen in IMG/M
3300018994Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001586 (ERX1789578-ERR1719368)EnvironmentalOpen in IMG/M
3300019000Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001394 (ERX1782320-ERR1712129)EnvironmentalOpen in IMG/M
3300019002Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001764 (ERX1789384-ERR1719347)EnvironmentalOpen in IMG/M
3300019005Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_148 - TARA_N000002119 (ERX1789730-ERR1719193)EnvironmentalOpen in IMG/M
3300019008Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001826 (ERX1789684-ERR1719447)EnvironmentalOpen in IMG/M
3300019012Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001426 (ERX1809764-ERR1740129)EnvironmentalOpen in IMG/M
3300019013Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003089EnvironmentalOpen in IMG/M
3300019014Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001620 (ERX1789400-ERR1719204)EnvironmentalOpen in IMG/M
3300019015Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_147 - TARA_N000002109 (ERX1789583-ERR1719280)EnvironmentalOpen in IMG/M
3300019017Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002781EnvironmentalOpen in IMG/M
3300019023Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_145 - TARA_N000003231EnvironmentalOpen in IMG/M
3300019028Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002364 (ERX1789432-ERR1719419)EnvironmentalOpen in IMG/M
3300019030Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000666 (ERX1789399-ERR1719153)EnvironmentalOpen in IMG/M
3300019038Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_143 - TARA_N000003141EnvironmentalOpen in IMG/M
3300019040Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000963 (ERX1782167-ERR1712154)EnvironmentalOpen in IMG/M
3300019041Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_138 - TARA_N000003007EnvironmentalOpen in IMG/M
3300019049Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000531 (ERX1782179-ERR1712232)EnvironmentalOpen in IMG/M
3300019052Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_132 - TARA_N000002402 (ERX1789503-ERR1719228)EnvironmentalOpen in IMG/M
3300019131Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001424 (ERX1809759-ERR1740116)EnvironmentalOpen in IMG/M
3300019143Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000963 (ERX1782306-ERR1712244)EnvironmentalOpen in IMG/M
3300019144Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001503 (ERX1789695-ERR1719376)EnvironmentalOpen in IMG/M
3300019147Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_132 - TARA_N000002400 (ERX1782434-ERR1711973)EnvironmentalOpen in IMG/M
3300019148Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001477 (ERX1789676-ERR1719431)EnvironmentalOpen in IMG/M
3300031056Marine microbial communities from the Southern Atlantic ocean transect - DeepDOM_S12_Trap_metaT (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031113Marine microbial communities from the Southern Atlantic ocean transect - DeepDOM_S7_Trap_metaT (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031121Marine microbial communities from the Southern Atlantic ocean transect - DeepDOM_S15_Trap_metaT (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031737Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0099809_1001984313300008013CoralMAAAATSSFPRIVSNNLVQRSAFLSYTRYLAFGFGYFYAFCKLIYLQAYVESEDQKKLAQLRDAELSKNTLRGVTFHAPQIWDPEYTDLQMRFRDCYPDFYLHPNDEFVYQLSRGRQREQKVKEELHAEAVAFLKEWKAAEKK*
Ga0099807_145611313300008043CoralMASAAGSAFPRIVSNNLVTKSAFLSYSRYIAFGFGYFYAFCKLIYLQAYVESEDQKKLAQLKDAEISKNTLRGVGFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQLSRGRQREQKVKEELHAEAVAFLKEWRASEGK*
Ga0103951_1058237113300008832MarineHGAFLSYSRYLAFRFGYFYAFGKLIYLQAYVESEDQKKMAQLREAEISMNTLRGVTFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQVSRGRMRDQKVKEELHSEAVAFLKEWKAAEGK*
Ga0103502_1036759013300008998MarineRSAFLSYSRYMAFGIGYFYAFGKLIYLQAYVESEDQKKLAQLRDAEISVNTLRGATFHAPQIWDPEYTELQMNFRDCYPDFYLHPNDEFVYQLSRGRQREQKVKEELHSEAVAFLKEWKASDSK*
Ga0186352_11868213300017224Host-AssociatedMAAAAAASKEFPRIISNNLLTKSAFLSYSRYLAFGFGYFYAFCKALYLQSYVETEDQKKFAQLREAEISVNTLRGVTFHGPQLWDPEYTELQMKFRDCYPDFYLHPNDEFVYQTTRGRQREQKVKEDMHSEAVAFLKEWKASEGKR
Ga0186465_11847023300017273Host-AssociatedMAAAATSTAFPRIISHNLLTGSAFLSYSRLVAFGFGYLYANAKLAYLSGYVESENEKKFAQIREAEISANTLRGVTFHAPQVWDPEYTELQMRFRDCYPDFYLHPNDEFVYQLTRGKQKDQKVKEELHAEAVAFLKEWKSSEGK
Ga0193263_104948113300018680MarineMSAAAAAKTFPRVVSNNLVTRSAFLSYSRYLAFGFGYFYAFWKLIYLQAYVDSEDQKKMAQLRDAEISMNTLRGVTFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQVSRGKQKEAQVKEALHSEAVAFLKEWRAAEGK
Ga0192952_102557013300018683MarineHGMAASAAAFAKGNRMVSNNLITKSAFLSYSRYMAFGIGYFYAFCKLIYLQAYVEGEDQKKMAQLRDAEISINTLRGATFHAPQLWDPEYTELQMNFRDCYPDFYLHPNDEFVYQLSRGRQRDQKVKEDLHGEAVAFLKEWKASDAK
Ga0192876_106295713300018707MarinePRVISNNLVTRSAFLSYSRYLAFGFGYFYAFWKLIYLQAYVDGEDQKKMAQLRDAEISLHTLRGVTFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQTSRGKQKEAEVKDALHSEAVAFLKEWKAADGK
Ga0192866_107578213300018720MarineMSAAAAATKAFPRVISNNLTTKSAFLSYSRYLAFGFGYFYAFWKLIYLQAYVDSEDQKKMAQLRDAEISINTLRGVTFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQVSRGRAKDAKVKEELHSEAVAFLKEWRAAEGK
Ga0193418_104839113300018737MarineMATAAGSAFPRIVSNNLVTKSAFLSYSRYLAFGFGYFYAFGKLIYLQAYVESEDQKKMAQLREAEISINTLRGVTFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQVSRGKMRDQKVKEELHSEAVAFLKEWKAAEGK
Ga0193418_105789913300018737MarineYIVWLFESSTMAAATGSAFPRIVSNNLVTKSAFLSYSRYLAFGFGYFYAFGKLIYLQAYVESEDQKKIAQLREAEISMNTLRGVTFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQVSRGRQRDQKVKEELHSEAVAFLKEWKAAEGK
Ga0193418_108321713300018737MarineMSAAAAAKTFPRVVSNNLVTRSAFLSYSRYLAFGFGYFYAFWKLIYLQAYVDSEDQKKLAQLRDAEVSMNTLRGVTFHAPQIWDPEYTELQMRFRDCYPDFYLHPNDEFVYQVSRGKQKEAQVKEALHSEAVAFLKEWRAAEGK
Ga0193416_105218413300018748MarineMATAAGSAFPRIVSNNLVTKSAFLSYSRYLAFGFGYFYAFGKLIYLQAYVESEDQKKIAQLREAEISMNTLRGVTFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQVSRGRQRDQKVKEELHSEAVAFLKEWKAAEGK
Ga0193416_105680913300018748MarineMATAAGSAFPRIVSNNLVTKSAFLSYSRYLAFGFGYFYAFGKLIYLQAYVESEDQKKMAQLREAEISMNTLRGVTFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQVSRGRMRDQKVKEELHSEAVAFLKEWKAAEGK
Ga0192963_105074223300018762MarineMSAAAAATKSFPRVISNNLTTRSAFLSYSRYLAFGFGYFYAFWKLIYLQAYVDGEDQKKMAHLRDAEISLHTLRGVTFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQVSRGKQKEAEVKDALHSEAVAFLKEWKAADGK
Ga0192839_106715123300018777MarineIHHLHTMATAAGSAFPRIVSNNLVTKSAFLSYSRYLAFGFGYFYAFGKLIYLQAYVESEDQKKMAQLREAEISMNTLRGVTFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQVSRGRMRDQKVKEELHSEAVAFLKEWKAAEGK
Ga0192928_108341513300018793MarineSAAGSAFPRIVSNNLVTKSAFLSYSRYMAFGFGYFYAFGKLIYLSAYVESEDQKKMAQLREAEISMNTLRGVTFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQISRGRQRDQKVKEELHSEAVAFLKEWKAASEGK
Ga0193281_109514313300018803MarineFISYSRYIAFGFGYFYAFGKLIYLKAYVEAEDQKKIAQLREAELSMNTLRGVTLHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQLTRGKQRDQKVKEELHSEAVAFLKEWKAAEG
Ga0193441_106804013300018807MarinePYSVTMAAATGSAFPRIVSNNLVTKSAFLSYSRYLAFGFGYFYAFGKLIYLQAYVESEDQKKIAQLREAEISMNTLRGVTFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQVSRGRQRDQKVKEELHSEAVAFLKEWKAAEGK
Ga0192877_110304113300018834MarineVSEHPFVCTMSAAAAATKSFPRVISNNLVTRSAFLSYSRYLAFGFGYFYAFWKLIYLQAYVDGEDQKKMAQLRDAEISLHTLRGVTFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQTSRGKQKEAEVKDALHSEAVAFLKEWKAADGK
Ga0192835_107138423300018863MarineMATAAGSAFPRIVSNNLVTKSAFLSYSRYLAFGFGYFYAFGKLIYLQAYVESEDQKKMAQLREAEISLYTLRGVTFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQVSRGRMRDQKVKEELHSEAVAFLKEWKAAEGK
Ga0192835_108183913300018863MarineFGSSTMAAATGSAFPRIVSNNLVTKSAFLSYSRYLAFGFGYFYAFGKLIYLQAYVESEDQKKIAQLREAEISMNTLRGVTFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQVSRGRQRDQKVKEELHSEAVAFLKEWKAAEGK
Ga0192859_107689513300018867MarineMATAAASAASKAFPRVVSNNLPTKSAFLSYSRYLAFGFGYFYAFCKLIYLQAYVESEDQKKLAQLHDAEISMNTLRGATFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQLSRGRQREQKVKEDLHSEAVEFLKEWKASEGK
Ga0193162_110142913300018872MarineKRRLLKSIMSAAASKAFPRTVSNNLMTRSAFLSYSRYMAFGIGYFYAFGKLIYLQAYVESEDQKKLAQLRDAEISVNTLRGATFHAPQIWDPEYTELQMNFRDCYPDFYLHPNDEFVYQLSRGRQREQKVKEELHSEAVAFLKEWKASDAK
Ga0193162_110656713300018872MarineVHHLHTMATAAGSAFPRIVSNNLVTKSAFLSYSRYLAFGFGYFYAFGKLIYLQAYVESEDQKKMAQLREAEISMNTLRGVTFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQVSRGRMRDQKVKEELHSEAVAFLKEWKAAEGK
Ga0193553_113420813300018873MarineAATKAFPRVISNNLVTRSAFLSYSRYLAFGFGYFYAFWKLIYLQAYVDSEDQKKLAHLRDAEISMNTLRGVTFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQVSRGKQKEAQVKEALHSEAVAFLKEWRAAEGK
Ga0193276_110269913300018883MarineVVRNSRIMASAAGSAFPRIVSNNLVTKSAFLSYSRYLAFGFGYFYAFGKLIYLQAYVESEDQKKMAQLREAEISMNTLRGVTFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQVSRGRMRDQKVKEELHSEAVAFLKEWKAAEGK
Ga0193360_112142513300018887MarineRIHFRDIMAAAAGSAFPRIVSNNLVTRSAFISYSRYIAFGFGYFYAFGKLIYLKAYVEAEDQKKIAQLREAELSMNTLRGVTLHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQLTRGKQRDQKVKEELHSEAVAFLKEWKAAEGK
Ga0193262_1007829913300018923MarineARSQYIMAAAAGSAFPRVVSNNLMTKSAFLSYSRYLAFGVGYFYAFGKLIYLQAYVESEDQKKMAQLREAEISMNTLRGVTFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQVSRGRMRDNKVKEEMHSEAVAFLKEWKAAEGK
Ga0192955_1016420623300018930MarineMVASAAAFAKGNRMVSNNLITKSAFLSYSRYMAFGIGYFYAFCKLIYLQAYVEGEDQKKMAQLRDAEISINTLRGATFHAPQLWDPEYTELQMNFRDCYPDFYLHPNDEFVYQLSRGRQRDQKVKEDLHGEAVAFLKEWKASDAK
Ga0193448_109287813300018937MarineVHFGDIMAAAAGSAFPRIVSNNLVTRSAFISYSRYIAFGFGYFYAFGKLIYLKAYVEAEDQKKIAQLREAELSMNTLRGVTLHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQLTRGKQRDQKVKEELHSEAVAFLKEWKAAEGK
Ga0193265_1026416223300018941MarineNNLMTKSAFLSYSRYLAFGVGYFYAFGKLIYLQAYVESEDQKKMAQLREAEISMNTLRGVTFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQVSRGRMRDNKVKEEMHSEAVAFLKEWKAAEGK
Ga0192892_1021366413300018950MarinePQITMAAAAGSAFPRVVSNNLMTKSAFLSYSRYLAFGVGYFYAFGKLIYLQAYVESEDQKKMAQLREAEISMNTLRGVTFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQVSRGRMRDNKVKEEMHSEAVAFLKEWKAAEGK
Ga0192892_1023675113300018950MarineRIVSNNLVTRSAFISYSRYIAFGFGYFYAFGKLIYLKAYVEAEDQKKIAQLREAELSMNTLRGVTLHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQLTRGKQRDQKVKEELHSEAVAFLKEWKAAEGK
Ga0192892_1023886813300018950MarineHNLMTKSAFLSYSRYLAFGFGYFYAFGKLIYLQAYVESEDQKKMAQLREAEISMNTLRGVTFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQVSRGRMRDNKVKEEMHSEAVAFLKEWKAAEGK
Ga0192930_1031183013300018960MarineLHTMATAAGSAFPRIVSNNLVTKSAFLSYSRYLAFGFGYFYAFGKLIYLQAYVESEDQKKMAQLREAEISMNTLRGVTFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQVSRGRMRDQKVKEELHSEAVAFLKEWKAAEGK
Ga0193531_1033886713300018961MarineMAAAAASASKTFPRIISNNLVTRSAFLSYSRYLAFGFGYFYAFGKLIYLQAYVESEDQKKLAQLHEAEISVNTLRGVTFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQLSRGRQKEQKIKENLHTEAVAFLKEWKASEGK
Ga0193332_1021461313300018963MarineHLHTMATAAGSAFPRIVSNNLVTKSAFLSYSRYLAFGFGYFYAFGKLIYLQAYVESEDQKKMAQLREAEISMNTLRGVTFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQVSRGRMRDQKVKEELHSEAVAFLKEWKAAEGK
Ga0193332_1023458913300018963MarineFLSYSRYLAFGVGYFYAFGKLIYLQAYVESEDQKKMAQLREAEISMNTLRGVTFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQVSRGRMRDNKVKEEMHSEAVAFLKEWKAAEG
Ga0193332_1025690213300018963MarineAAAAAKTFPRVVSNNLVTRSAFLSYSRYLAFGFGYFYAFWKLIYLQAYVDSEDQKKMAQLRDAEISMNTLRGVTFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQVSRGKQKEAQVKEALHSEAVAFLKEWRAAEGK
Ga0193087_1019371213300018964MarineTWAKYIMSAAAASKGYQRVISHNLITRSAFLSYSRYMAFGIGYFYAFCKLIYLQAYVESEDQKKLAQLRDAEISVNTLRGATFHAPQLWDPEYTEMQMNFRDCYPDFYLHPNDEFVYQLSRGRQREQKVKEDLHTEAVAFLKEWKAAESK
Ga0193087_1022228413300018964MarineTWAKYIMSAAAASKGYQRVISHNLITRSAFLSYSRYMAFGIGYFYAFCKLIYLQAYVEGEDQKKMAQLRDAEISLNTLRGATFHAPQLWDPEYTELQMNFRDCYPDFYLHPNDEFVYQLSRGRQREQKVKEELHGEAVAFLKEWKASDSK
Ga0193417_1015121013300018970MarineMATAAGSAFPRIVSNNLVTKSAFLSYSRYLAFGFGYFYAFGKLIYLQAYVESEDQKKMAQLREAEISMNTLRGVTFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQVSRGKMRDQKVKEELHSEAVAFLKEWKAAEGK
Ga0193417_1016378413300018970MarineMAAATGSAFPRIVSNNLVTKSAFLSYSRYLAFGFGYFYAFGKLIYLQAYVESEDQKKIAQLREAEISMNTLRGVTFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQVSRGRQRDQKVKEELHSEAVAFLKEWKAAEGK
Ga0193417_1016962413300018970MarineQKQLVVSSRIHFRDIMAAAAGSAFPRIVSNNLVTRSAFISYSRYIAFGFGYFYAFGKLIYLKAYVEAEDQKKIAQLREAELSMNTLRGVTLHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQLTRGKQRDQKVKEELHSEAVAFLKEWKAAEGK
Ga0193417_1020028113300018970MarineAAAAGSAFPRVVSNNLMTKSAFLSYSRYLAFGVGYFYAFGKLIYLQAYVESEDQKKMAQLREAEISMNTLRGVTFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQVSRGRMRDNKVKEEMHSEAVAFLKEWKAAEGK
Ga0193417_1021351813300018970MarineMAAAAGSAFPRIVSNNLVTKSAFLSYSRYLAFGFGYFYAFGKLIYLQAYVESEDQKKMAQLREAEISLYTLRGVTFHAPQLWDPEYTEMQMRFRDCYPDFYLHPNDEFVYQVSRGRKRDQKVKEELHSEAVAFLKEWKAAEGK
Ga0193559_1026729113300018971MarineMAAAAGTAFPRVVSNNLMTKSAFLSYSRYLAFGFGYFYAFGKLIYLQAYVESEDQKKIAQLREAEISMNTLRGVTFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQVSRGRQRDQKVKEELHSEAVAFLKEWKAAEGK
Ga0193326_1007562413300018972MarineLSYSRYLAFGFGYFYAFGKLIYLQAYVESEDQKKMAQLREAEISLYTLRGVTFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQVSRGRMRDQKVKEELHSEAVAFLKEWKAAEGK
Ga0193540_1020360813300018979MarineSYSRYLAFGFGYFYAFWKLIYLQAYVDSEDQKKMAQLRDAEISINTLRGVTFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQVSRGRAKDAKVKEELHSEAVAFLKEWRAAEGK
Ga0193518_1025538213300018992MarineNFHPFVESQFTMAAAAGSAFPRVVSHNLMTKSAFLSYSRYLAFGFGYFYAFGKLIYLQAYVESEDQKKIAQLREAEISMNTLRGVTFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQVSRGRMRDNKVKEEMHSEAVAFLKEWKAAEGK
Ga0193280_1026071713300018994MarineRVHFGDIMAAAAGSAFPRIVSNNLVTRSAFISYSRYIAFGFGYFYAFGKLIYLKAYVEAEDQKKIAQLREAELSMNTLRGVTLHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQLTRGKQRDQKVKEELHSEAVAFLKEWKAAEGK
Ga0192953_1011420313300019000MarineMAASAAAFAKGNRMVSNNLITKSAFLSYSRYMAFGIGYFYAFCKLIYLQAYVEGEDQKKMAQLRDAEISINTLRGATFHAPQLWDPEYTELQMNFRDCYPDFYLHPNDEFVYQLSRGRQRDQKVKEDLHGEAVAFLKEWKASDAK
Ga0192953_1015761313300019000MarineMGYSRYLAFGFGYFYAFWKLIYLQAYVDGEDQKKMAQLRDAEISLHTLRGVTFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQTSRGKQKEAEVKDALHSEAVAFLKEWKAADGK
Ga0192953_1018662413300019000MarineHGKAFPRVISNNLVTRSAFLSYSRYLAFGFGYFYAFWKLIYLQAYVDSEDQKKLAHLRDAEISMNTLRGVTFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQVSRGKQKEAQVKEALHSEAVAFLKEWRAAEGK
Ga0193345_1014418213300019002MarineLFARHQLTMAAAAGSAFPRVVSNNLMTKSAFLSYSRYLAFGVGYFYAFGKLIYLQAYVESEDQKKMAQLREAEISMNTLRGVTFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQVSRGRMRDNKVKEEMHSEAVAFLKEWKAAEGK
Ga0193345_1020832113300019002MarineAFLSYSRYLAFGFGYFYAFGKLIYLQAYVESEDQKKMAQLREAEISMNTLRGVTFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQVSRGRMRDQKVKEELHSEAVAFLKEWKAAEGK
Ga0193527_1035978123300019005MarineVRHQYIMAAAAGSAFPRVVSNNLMTKSAFLSYSRYLAFGVGYFYAFGKLIYLQAYVESEDQKKMAQLREAEISMNTLRGVTFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQVSRGRMRDNKVKEEMHSEAVAFLKEWKAAEGK
Ga0193361_1020659913300019008MarineNNLWSHRVHFRDIMAAAAGSAFPRIVSNNLVTRSAFISYSRYIAFGFGYFYAFGKLIYLKAYVEAEDQKKIAQLREAELSMNTLRGVTLHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQLTRGKQRDQKVKEELHSEAVAFLKEWKAAEGK
Ga0193361_1033257113300019008MarineMAAAAGSAFPRVVSNNLMTKSAFLSYSRYLAFGVGYFYAFGKLIYLQAYVESEDQKKMAQLREAEISMNTLRGVTFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQVSRGRMRDNKVKEEMHSEAVAFLKEWKAAEGK
Ga0193043_1027034113300019012MarineMSAAAAATKAFPRVISNNLTTKSAFLSYSRYLAFGFGYFYAFWKLIYLQAYVDSEDQKKMAQLRDAEISINTLRGVTFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQVSRGKAKEAKVKEELHSEAVAFLKEWRAAEGK
Ga0193043_1030306313300019012MarineFLSTVTMAAAAGAAFPRVVSHNLLTKSAFLSYSRYMAFGFGYFYAFGKLIYLQAYVESEDQKKMAQLREAEISMNTLRGATFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQVSRGRARDQKVKEEMHSEAVAFLKEWKAAEGK
Ga0193043_1034891513300019012MarineTMAASAAAFAKGNRMVSNNLITKSAFLSYSRYMAFGIGYFYAFCKLIYLQAYVEGEDQKKMAQLRDAEISINTLRGATFHAPQIWDPEYTELQMNFRDCYPDFYLHPNDEFVYQLSRGRQRDQKVKEDLHNEAVAFLKEWKAADGK
Ga0193557_1015161913300019013MarineFNTFVLFAELHFTMAAAAGTAFPRVVSNNLMTKSAFLSYSRYLAFGFGYFYAFGKLIYLQAYVESEDQKKIAQLREAEISMNTLRGVTFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQVSRGRQRDQKVKEELHSEAVAFLKEWKAAEGK
Ga0193557_1018323223300019013MarineSSSNFHPFVESQFTMAAAAGSAFPRVVSHNLMTKSAFLSYSRYLAFGFGYFYAFGKLIYLQAYVESEDQKKIAQLREAEISMNTLRGVTFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQVSRGRMRDNKVKEEMHSEAVAFLKEWKAAEGK
Ga0193557_1018739923300019013MarineFHLFSRPQITMAAAAGSAFPRVVSNNLMTKSAFLSYSRYLAFGVGYFYAFGKLIYLQAYVESEDQKKMAQLREAEISMNTLRGVTFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQVSRGRMRDNKVKEEMHSEAVAFLKEWKAAEGK
Ga0193557_1023002123300019013MarineSSTMAAATGSAFPRIVSNNLVTKSAFLSYSRYLAFGFGYFYAFGKLIYLQAYVESEDQKKIAQLREAEISMNTLRGVTFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQVSRGRQRDQKVKEELHSEAVAFLKEWKAAEGK
Ga0193299_1024382013300019014MarineQKQLVVSSRIHFRDVMAAAAGSAFPRIVSNNLVTRSAFISYSRYIAFGFGYFYAFGKLIYLKAYVEAEDQKKIAQLREAELSMNTLRGVTLHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQLTRGKQRDQKVKEELHSEAVAFLKEWKAAEGK
Ga0193299_1031166813300019014MarineHIMATAAGSAFPRIVSNNLVTKSAFLSYSRYLAFGFGYFYAFGKLIYLQAYVESEDQKKMAQLREAEISLYTLRGVTFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQVSRGKMRDQKVKEDLHSEAVAFLKEWKAAEGK
Ga0193525_1033136713300019015MarineKQLVVSSRIHFGDIMAAAAGSAFPRIVSNNLVTRSAFISYSRYIAFGFGYFYAFGKLIYLKAYVEAEDQKKIAQLREAELSMNTLRGVTLHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQLTRGKQRDQKVKEELHSEAVAFLKEWKAAEGK
Ga0193525_1039223123300019015MarinePQFIMAAAAGSAFPRVVSNNLMTKSAFLSYSRYLAFGVGYFYAFGKLIYLQAYVESEDQKKMAQLREAEISMNTLRGVTFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQVSRGRMRDNKVKEEMHSEAVAFLKEWKAAEGK
Ga0193525_1039953813300019015MarinePQYIMAAAAGSAFPRVVSHNLMTKSAFLSYSRYLAFGFGYFYAFGKLIYLQAYVESEDQKKIAQLREAEISMNTLRGVTFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQVSRGRMRDNKVKEEMHSEAVAFLKEWKAAEGK
Ga0193525_1040673513300019015MarinePQYIMAAAAGSAFPRVVSNNLMTKSAFLSYSRYLAFGVGYFYAFGKLIYLQAYVESEDQKKIAQLREAEISMNTLRGVTFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQVSRGRMRDNKVKEEMHSEAVAFLKEWKAAEGK
Ga0193569_1041658013300019017MarineMAAAAASASKTFPRIISNNLVTRSAFLSYSRYLAFGFGYFYAFGKLIYLQAYVESEDQKKLAQLHEAEISVNTLRGVTFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQLSRGRQKEQKIRENLHTEAVAFLKEWKASEGK
Ga0193561_1025448413300019023MarineMAAAAGTAFPRVVSNNLLTKSAFLSYSRYLAFGFGYFYAFGKLIYLQAYVESEDQKKIVQLREAEISMNTLRGATFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQTSRGRQRDQKVKEEMHSEAVAFLKEWKAAEGK
Ga0193561_1028379713300019023MarineTMAAAAGSAFPRIVSNNLVTKSAFLSYSRYLAFGFGYFYAFGKLIYLQAYVESEDQKKMAQLREAEISLYTLRGVTFHAPQLWDPEYTEMQMRFRDCYPDFYLHPNDEFVYQVSRGRKRDQKVKEELHSEAVAFLKEWKAAEGK
Ga0193561_1034118413300019023MarineLMTKSAFLSYSRYLAFGFGYFYAFGKLIYLQAYVESEDQKKIAQLREAEISMNTLRGVTFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQVSRGRQRDQKVKEEMHSEAVAFLKEWKAAEGK
Ga0193449_1025610213300019028MarineQLVVSSRIHFRDIMAAAAGSAFPRIVSNNLVTRSAFISYSRYIAFGFGYFYAFGKLIYLKAYVEAEDQKKIAQLREAELSMNTLRGVTLHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQLTRGKQRDQKVKEELHSEAVAFLKEWKAAEGK
Ga0193449_1029878613300019028MarineFGSSTMAAATGSAFPRIVSNNLVTKSAFVSYSRYLAFGFGYFYAFGKLIYLQAYVESEDQKKIAQLREAEISMNTLRGVTFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQVSRGRQRDQKVKEELHSEAVAFLKEWKAAEGK
Ga0193449_1033965013300019028MarineGSAFPRIVSNNLVTKSAFLSYSRYLAFGFGYFYAFGKLIYLQAYVESEDQKKLAQLREAEISLYTLRGVTFHAPQLWDPEYTEMQMRFRDCYPDFYLHPNDEFVYQVSRGRKRDQKVKEELHSEAVAFLKEWKAAEGK
Ga0193449_1037646913300019028MarineFAELHFIMAAAAGTAFPRVVSNNLMTKSAFLSYSRYLAFGFGYFYAFGKLIYLQAYVESEDQKKIAQLREAEISMNTLRGVTFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQVSRGRQRDQKVKEELHSEAVAFLKEWKAAEGK
Ga0192905_1019757913300019030MarineLFESSTMAAATGSAFPRIVSNNLVTKSAFLSYSRYLAFGFGYFYAFGKLIYLQAYVESEDQKKIAQLREAEISMNTLRGVTFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQVSRGRQRDQKVKEELHSEAVAFLKEWKAAEGK
Ga0193558_1026314813300019038MarineFFLFAELHLTMAAAAGTAFPRVVSNNLMTKSAFLSYSRYLAFGFGYFYAFGKLIYLQAYVESEDQKKIAQLREAEISMNTLRGVTFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQVSRGRQRDQKVKEELHSEAVAFLKEWKAAEGK
Ga0192857_1023365013300019040MarineIVWLFGSSTMAAATGSAFPRIVSNNLVTKSAFLSYSRYLAFGFGYFYAFGKLIYLQAYVESEDQKKIAQLREAEISMNTLRGVTFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQVSRGRQRDQKVKEELHSEAVAFLKEWKAAEGK
Ga0192857_1023714913300019040MarineNKIQSAFLSYSRYMAFGIGYFYAFCKLIYLQAYVESEDQKKMAQLKDAEISINTLRGATFHAPQLWDPEYTELQMNFRDCYPDFYLHPNDEFVYQLSRGRQREQKVKEELHSEAVAFLKEWKASESK
Ga0192857_1028480823300019040MarineHGMSAAAAATKSFPRVVSNNLVTRSAFLSYSRYLAFGFGYFYAFWKLIYLQAYVDAEDQKKMAQLRDAEISMHTLRGVTFHAPQIWDPEYTELQMRFRDCYPDFYLHPNDEFVFQTTRGRQKEAEVKEALHSEAVAFLKEWKAAEGK
Ga0192857_1031111313300019040MarineMAFGFGYFYAFGKLIYLQAYVESEDQKKIDQLKEAEISMNTLRGVTFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQVSRGRMRDQKVKEEMHSEAVAFLKEWKAAEGK
Ga0193556_1018860413300019041MarineVTMAAATGSAFPRIVSNNLVTKSAFLSYSRYLAFGFGYFYAFGKLIYLQAYVESEDQKKIAQLREAEISMNTLRGVTFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQVSRGRQRDQKVKEELHSEAVAFLKEWKAAEGK
Ga0193082_1083119613300019049MarineTKSAFLSYSRYMAFGIGYFYAFCKLIYLQAYVESEDQKKMAQLKDAEISMNTLRGATFHAPQLWDPEYTELQMNFRDCYPDFYLHPNDEFVYQLSRGRQREQKVKEELHSEAVEFLKEWKASESK
Ga0193455_1044001113300019052MarineTMAAAAGSAFPRVVSNNLMTKSAFLSYSRYLAFGVGYFYAFGKLIYLQAYVESEDQKKMAQLREAEISMNTLRGVTFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQVSRGRMRDNKVKEEMHSEAVAFLKEWKAAEGK
Ga0193249_113715713300019131MarineRKSSETMAASAAAFAKGNRMVSNNLITKSAFLSYSRYMAFGIGYFYAFCKLIYLQAYVEGEDQKKMAQLRDAEISINTLRGATFHAPQIWDPEYTELQMNFRDCYPDFYLHPNDEFVYQLSRGRQRDQKVKEDLHNEAVAFLKEWKAADGK
Ga0192856_105595513300019143MarineSNNLVTRSAFLSYSRWLAFGFGYFYAFGKLIYLQAYVESEDQKKFAQLREAEVSVNTLRGVTFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQLSRGRQKEQKIKEDLHTEAVAFLKEWKASEGK
Ga0192856_107377513300019143MarineAASAASKAFPRVVSNNLPTKSAFLSYSRYLAFGFGYFYAFCKLIYLQAYVESEDQKKLAQLHDAEISMNTLRGATFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQLSRGRQREQKVKEDLHSEAVEFLKEWKASEGK
Ga0193246_1022405913300019144MarineAAAAGSAFPRIVSNNLMTKSAFLSYSRYMAFGFGYFYAFGKLIYLQAYVESEDQKKMAQLREAEISMNTLRGVTFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQVSRGRQRDQKVKEELHSEAVAFLKEWKAAEGK
Ga0193453_115172713300019147MarineRYLAFGFGYFYAFGKLIYLQAYVESEDQKKIAQLREAEISMNTLRGVTFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQVSRGRQRDQKVKEELHSEAVAFLKEWKAAEGK
Ga0193239_1027450913300019148MarineFPRIVSNNLMTKSAFLSYSRYMAFGFGYFYAFGKLIYLQAYVESEDQKKMAQLREAEISMNTLRGVTFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQVSRGRQRDQKVKEELHSEAVAFLKEWKAAEGK
Ga0138346_1016108013300031056MarineSNFHPFVESPFTMAAAAGSAFPRVVSHNLMTKSAFLSYSRYLAFGFGYFYAFGKLIYLQAYVESEDQKKIAQLREAEISMNTLRGVTFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQVSRGRQRDQKVKEEMHSEAVAFLKEWKAAEGK
Ga0138346_1082677313300031056MarineNVVKSKNAVWSFVSSTMAAATGSAFPRIVSNNLVTKSAFLSYSRYLAFGFGYFYAFGKLIYLQAYVESEDQKKIAQLREAEISMNTLRGVTFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQVSRGRQRDQKVKEELHSEAVAFLKEWKAAEGK
Ga0138347_1001451013300031113MarineSSNFHPFVESQFTMAAAAGSAFPRVVSHNLMTKSAFLSYSRYLAFGFGYFYAFGKLIYLQAYVESEDQKKIAQLREAEISMNTLRGVTFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQVSRGRQRDQKVKEEMHSEAVAFLKEWKAAEGK
Ga0138345_1002405813300031121MarineTITMAAAAGSAFPRIVSNNLMTKSAFLSYSRYMAFGFGYFYAFGKLIYLQAYVESEDQKKMAQLREAEISMNTLRGVTFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQVSRGRQRDQKVKEELHSEAVAFLKEWKAAEGK
Ga0138345_1006833513300031121MarineSILVACIYSYTMAAAAGSAFPRIVSHNLMTKSAFLSYSRYLAFGFGYFYAFGKLIYLQAYVESEDQKKIVQLREADISMNTLRGVTFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQVSRGRQRDQKVKEEMHSEAVAFLKEWKAAEGK
Ga0138345_1073881713300031121MarineMASAAAFNRTVSNNLITKSAFLSYSRYMAFGIGYFYAFCKLIYLQAYVEGEDQKKMAQLRDAEISINTLRGATFHAPQLWDPEYTELQMNFRDCYPDFYLHPNDEFVYQLSRGRQRDQKVKEELHGEAVAFLKEWKASDSK
Ga0138345_1087611713300031121MarineLVAQTILSSTMSAAAAATKAFPRVVSNNLVTRSAFLSYSRYLAFGFGYFYAFWKLIYLQAYVDSEDQKKMAQLRDAEISINTLRGVSFHAPQLWDPDYTELQMRFRDCYPDFFLHPNDEFVYQVTRGKEKDAKVKEALHSEAVAFLKEWRAAEGK
Ga0170824_11546636713300031231Forest SoilSHNLVNKSAFVSYSRGMACLFGYFYATWKLMYLSSYVHSEDIKKMQHLKEAEIDVHTLRGQSFHHAQVYDPLFTEKQMAFRDNYPDFYLHPNDEFVYQLVRGREREQKVKSELHAEAVQFLKEWKTAEDK
Ga0307386_1063702013300031710MarineQIAFDPHGSQRALADVLLHHVRIRATLDATKSFPRVISNNLTTRSAFLSYSRYLAFGFGYFYAFWKLIYLQAYVDGEDQKKMAQLRDAEISLHTLRGVTFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQTSRGKQKEAEVKDALHSEAVAFLKEWKAADGK
Ga0307387_1072543023300031737MarinePILIMASAAGAAFPRVVSHNLLTKSAFLSYSRYMAFGFGYFYAFGKLIYLQAYVESEDQKKIDQLKEAEISMNTLRGVTFHAPQLWDPEYTELQMRFRDCYPDFYLHPNDEFVYQVSRGRMRDQKVKEEMHSEAVAFLKEWKAADGK

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.