 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F089797 |
| Family Type | Metagenome |
| Number of Sequences | 108 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MVPNAPKHYETHQNMSLGSDGVDRVDLLQKILTQLCGLNFCINLNS |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 108 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 5.56 % |
| % of genes from short scaffolds (< 2000 bps) | 5.56 % |
| Associated GOLD sequencing projects | 88 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (99.074 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (38.889 % of family members) |
| Environment Ontology (ENVO) | Unclassified (79.630 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (78.704 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 39.19% β-sheet: 0.00% Coil/Unstructured: 60.81% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 99.07 % |
| All Organisms | root | All Organisms | 0.93 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005843|Ga0068860_100609713 | Not Available | 1097 | Open in IMG/M |
| 3300009993|Ga0105028_125784 | Not Available | 650 | Open in IMG/M |
| 3300013306|Ga0163162_12078704 | Not Available | 651 | Open in IMG/M |
| 3300025931|Ga0207644_10914984 | Not Available | 735 | Open in IMG/M |
| 3300028150|Ga0268343_1001076 | All Organisms → Viruses → Predicted Viral | 1358 | Open in IMG/M |
| 3300028463|Ga0268325_102484 | Not Available | 626 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 38.89% |
| Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere | 36.11% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 4.63% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.70% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 3.70% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.70% |
| Switchgrass Associated | Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated | 3.70% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Ionic Liquid And High Solid Enriched | Engineered → Lab Enrichment → Defined Media → Unclassified → Unclassified → Ionic Liquid And High Solid Enriched | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009972 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_224 metaG | Host-Associated | Open in IMG/M |
| 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Host-Associated | Open in IMG/M |
| 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Host-Associated | Open in IMG/M |
| 3300009994 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_171 metaG | Host-Associated | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015280 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015297 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015301 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015311 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015312 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015315 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015317 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015320 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015324 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015329 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015331 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015332 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015333 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015335 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015336 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015337 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015338 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015339 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015348 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015353 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015354 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017412 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017422 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017432 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017439 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017445 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017446 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017447 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017691 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017693 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300020023 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_22AUG2016_LD2 MG | Host-Associated | Open in IMG/M |
| 3300020223 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_31MAY2016_LD2 MG | Host-Associated | Open in IMG/M |
| 3300025530 | Ionic liquid and high solid enriched microbial communities from the Joint BioEnergy Institute, USA - AR20-3-D (SPAdes) | Engineered | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028049 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028051 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028052 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028054 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028056 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028058 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028061 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028063 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028139 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028141 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028142 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028149 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028150 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028151 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028153 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028246 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028251 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028253 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028256 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028262 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028463 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028465 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028466 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028468 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028469 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028472 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028473 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028475 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028476 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028477 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028525 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028526 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028527 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0070689_1004840962 | 3300005340 | Switchgrass Rhizosphere | MLPNAPKHYETHHNMSLGSDAVDWADLLQRILLQLCGLNFCFNCNSS |
| Ga0070689_1015050641 | 3300005340 | Switchgrass Rhizosphere | MVPNVSKHYETHQNISLGSDGVDRLDLLQKILTQLCGLNFCIN |
| Ga0070671_1014467911 | 3300005355 | Switchgrass Rhizosphere | PKHYETHHNMSLGSDAVDWADLLQRILLQLCSLNFCINRNSSA* |
| Ga0070706_1021544931 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MLPNAPKHFEMHHNMSLGSDGVDWADLLQRILLQLCGLNFCINC |
| Ga0070686_1005247791 | 3300005544 | Switchgrass Rhizosphere | APKHYETHHNMSLGSDAVDWADLLQRILLQLCGLNFCINCNSSA* |
| Ga0068861_1007505511 | 3300005719 | Switchgrass Rhizosphere | MV*DAPKPYETHQNMSLGLDGMDSMDLLQKILTQLCGLNFCINYNSSA |
| Ga0068858_1023273212 | 3300005842 | Switchgrass Rhizosphere | MVPNAPKHYETHQNMSLGSDGVDRVDLLQKILTQFCGLN |
| Ga0068860_1006097132 | 3300005843 | Switchgrass Rhizosphere | MLPNAPKHYETHHNMSLGSDAVDWADLLQRILLQLCGLN |
| Ga0105251_101381421 | 3300009011 | Switchgrass Rhizosphere | EMVPNAPKLYETHQTMSLGPDGVDRVDLLQKILTQLCGLNF* |
| Ga0105137_1075701 | 3300009972 | Switchgrass Associated | MVPNAPKHYETHQNKSLGSDGVDRVDLLQKILTQLCGLNFYINYNSLARFELSI |
| Ga0105148_1174091 | 3300009978 | Switchgrass Associated | MDQNAPKHYETHQNMSLGPDGVDRVHLLQKILTQICGLNFCIN |
| Ga0105028_1257841 | 3300009993 | Switchgrass Associated | MVPNAPKHYETHQNKSLGSDGVDRVDLLQKILTQLCGLNFYI |
| Ga0105126_10050341 | 3300009994 | Switchgrass Associated | MVQNAPKHYETHQNMSLRSDGVDREDLLQKILTQLCGLNFCINYNSS |
| Ga0134128_111259261 | 3300010373 | Terrestrial Soil | MVPIAPKHYEMHQNMSLGSDGVDRVDLLQKILTQFCGLNF |
| Ga0134126_106228541 | 3300010396 | Terrestrial Soil | MVTNAPKHYETHQNMSLGPDGVDRVDLLQKILTQLCGLNF |
| Ga0134122_108342311 | 3300010400 | Terrestrial Soil | MV*NAPKPYETHQNMSLGSDGIDSVDSLQKILTQLCGLNFCINYNSS |
| Ga0134122_125160751 | 3300010400 | Terrestrial Soil | MIPNPPRHYETHQNMSLGSDGVDRVDLLQKILMRLCVTNFCIN*NSLACFQP |
| Ga0163162_120787041 | 3300013306 | Switchgrass Rhizosphere | MVTNAPKHYETHQNMSLGLDGVDRVDLLQEILTQLCGLNFCINSNSSSR |
| Ga0163163_125272461 | 3300014325 | Switchgrass Rhizosphere | MLPNAPKHYETHHTMSLGSDAVDLADLLQRILLQLCGLNFCF |
| Ga0157379_119351361 | 3300014968 | Switchgrass Rhizosphere | MVRNALKPYETHQNMSLGSDGMDSVDLLQKILTQLCG |
| Ga0182100_10621461 | 3300015280 | Switchgrass Phyllosphere | MVPNAPKHYETHQNISLGSDGVDRVDLLQKILTQLCGLNFCINF |
| Ga0182104_10957641 | 3300015297 | Switchgrass Phyllosphere | MVPNAPKPDETHQNMSLGSDGMDSVDLLQKFQTQLCGLNFCINYNSS |
| Ga0182184_10779311 | 3300015301 | Switchgrass Phyllosphere | MVPNAPKPYETLQNMSLGSDGMDSVDLLQKILTQLCGLNFCINY |
| Ga0182182_10364091 | 3300015311 | Switchgrass Phyllosphere | MVPNAPKHYETHQNISLGSDGVDRVDLLQKILTQLCGLNFFINFNSS |
| Ga0182182_11169841 | 3300015311 | Switchgrass Phyllosphere | MLPNAPKHYETHHNMSLGSDAVDWADLLQRILLQLCGLNFCFNC |
| Ga0182168_10073902 | 3300015312 | Switchgrass Phyllosphere | MVQNAPKHYETHQNMSLGSDGVDWADLLQKILTQLCGL |
| Ga0182168_11146451 | 3300015312 | Switchgrass Phyllosphere | MVPNAPKPDETHQNMSLGSDGMDSVDLLQKFQTQLCGLNFCINYNSSARFEASIV |
| Ga0182120_11304271 | 3300015315 | Switchgrass Phyllosphere | MVRNAPKPYETHQNMSLGSDGMDILDLLQKILTQLCG |
| Ga0182136_10743061 | 3300015317 | Switchgrass Phyllosphere | MVPNEPKPYETHQNLSLLSDGMDSVDLLQKILTQLCGLN |
| Ga0182165_11359531 | 3300015320 | Switchgrass Phyllosphere | MVTNAPKHYETHQNMSLGPDGVDRVDLLQKILTQLCGLNFCIN |
| Ga0182134_10630542 | 3300015324 | Switchgrass Phyllosphere | MV*NAPKPYETHQNMSLGSDGMDSVDLLQKILTQLCGLN |
| Ga0182135_10917901 | 3300015329 | Switchgrass Phyllosphere | MV*NAPKPYETHQNMSLGSDGMDSVDLLQKILTQLCGLNFCINYN |
| Ga0182131_10195751 | 3300015331 | Switchgrass Phyllosphere | MVPNAPKHYETHQNISLGSDGVDRVDLLQKILTQLCGLNFCINFNSSAR |
| Ga0182131_11290841 | 3300015331 | Switchgrass Phyllosphere | MVPNATKPNEMHKNMSLGSDGMDSEDLLQKILTQLCGLNFCINYNS |
| Ga0182117_10515132 | 3300015332 | Switchgrass Phyllosphere | MVPNAPKHYETHQNMSLGSDGVDRVDLLQKILTQFCGLNFCI |
| Ga0182117_10951401 | 3300015332 | Switchgrass Phyllosphere | MV*NAPKPYETHQNMSLGSDGMDSVDSLQKILTQLCGLNF |
| Ga0182147_11464561 | 3300015333 | Switchgrass Phyllosphere | MLPNAPKHYETYHNMSLGSDGVDWADLLQRILLQLCGLIFCT |
| Ga0182116_11118641 | 3300015335 | Switchgrass Phyllosphere | MVPNAPKHYETHQNISLGSDGVDRVDLLQKILTQLC |
| Ga0182150_11416461 | 3300015336 | Switchgrass Phyllosphere | MIPNPPKYYETHQNMSLGSDGVDRVDLLQKILMRLCVTNFCINCN |
| Ga0182151_10869731 | 3300015337 | Switchgrass Phyllosphere | MVSNAPKHYETHQNMSLGPDGVDRVDLLQKILTQLCGLNFCIN |
| Ga0182137_11302381 | 3300015338 | Switchgrass Phyllosphere | MVPNAPKPYEMLQNMSLGSDGMDSVDLLQKILTQLCGLNFCINYNSSA |
| Ga0182149_10376482 | 3300015339 | Switchgrass Phyllosphere | MVPNAPKPYETHQNRSLGSDGMNIMDLLQKFLMQLCGLNFCINYNS |
| Ga0182149_11752871 | 3300015339 | Switchgrass Phyllosphere | MVPNVPKHYETHQNISLGSYEVDRVDLLQKILTQLCGLNF |
| Ga0182115_12576581 | 3300015348 | Switchgrass Phyllosphere | MV*NAPKPYETHQNMSLGSDGMDSVDSLQKILTQLCGLNFCI |
| Ga0182179_12371501 | 3300015353 | Switchgrass Phyllosphere | MVQNAPKHYETHQNMSLRSDGVDREDLLQKILTQLCGLNF |
| Ga0182167_11742421 | 3300015354 | Switchgrass Phyllosphere | MVPNAPKHYETHQNISLGSDGVDRVDLLQKILTQLCGLNFCINFNS |
| Ga0182167_12982931 | 3300015354 | Switchgrass Phyllosphere | MVPNVPKHYETHQNISLGSYEVDRVDLLQKILTQLCGLNFYINYNSSA |
| Ga0182167_13632462 | 3300015354 | Switchgrass Phyllosphere | MVPNAPKPDETHQNMSLGSDGMDSVDLLQKFQTQLCGLNFCINYNSSAR |
| Ga0182199_10588631 | 3300017412 | Switchgrass Phyllosphere | MVRNALKPYETHQNMSLGSDGMDSVDLLQKILTQLCGLNFCINYNSSA |
| Ga0182199_12030071 | 3300017412 | Switchgrass Phyllosphere | MLPNAPKHYETHHNMSLGSDAVDWADLLQRILLQLCGLNF |
| Ga0182201_10605851 | 3300017422 | Switchgrass Phyllosphere | HYETHHNMSLGSDAVDWADLLQRILLQLCGLNFCINCNSSA |
| Ga0182201_10754221 | 3300017422 | Switchgrass Phyllosphere | MVRNALKPYETHQDMSLGSDGMDSVDLLQKILTQLCGLN |
| Ga0182196_10375781 | 3300017432 | Switchgrass Phyllosphere | VSCSNEMVPNAPKPDETHQNMSLGSEGMYSVDLLQKLLTQLCGLNF |
| Ga0182196_10794091 | 3300017432 | Switchgrass Phyllosphere | MVXNAPKPYETHQNMSLGSDGMDSVDLLQKFQTQLCGLNFCINYN |
| Ga0182200_11640351 | 3300017439 | Switchgrass Phyllosphere | MVQNAPKHYETHQNMSLRSDGVDRVDLLQKIVTQLCGL |
| Ga0182198_10750232 | 3300017445 | Switchgrass Phyllosphere | MVPNVPKHYETHQNISLGSYEVDRVDLLQKILTQLCGLNFCIN |
| Ga0182217_11237491 | 3300017446 | Switchgrass Phyllosphere | MVPNAPKHYETHQTMSLGPDGMDRVDLLQKILTQLCGLNFCINFNSS |
| Ga0182215_11282701 | 3300017447 | Switchgrass Phyllosphere | MVPNVPKHYETHQNISLGSDGLDRVDLLQKLLTQLCGFYFCINYNSSTRF |
| Ga0182212_10955661 | 3300017691 | Switchgrass Phyllosphere | KMLPNAPKHYETHHNMSLGSDAVDWADLLQRILLQLCGLNFCFNCNSPA |
| Ga0182216_11028361 | 3300017693 | Switchgrass Phyllosphere | MVRNVPKPYETHQNMSLGSDGMDSVDSLQKILTQLCGLN |
| Ga0182178_10168981 | 3300020023 | Switchgrass Phyllosphere | MVPIAPKHYETHQNMSLGSDGVDRVDLLQKNLTQLCGFNFCINY |
| Ga0182118_1007882 | 3300020223 | Switchgrass Phyllosphere | MVQNAPKHYETHQNMSLRSDGVDREDLLQKILTQLCGLNFC |
| Ga0207866_10484771 | 3300025530 | Ionic Liquid And High Solid Enriched | MVPNAPKHYETHQNKSLGSDGVDRVDLLQKILTQLCGLNFYINYNSL |
| Ga0207662_111882521 | 3300025918 | Switchgrass Rhizosphere | MVPNAPKHYETHQNMSLGSDGVDRVDLLQKILTQF |
| Ga0207644_107535811 | 3300025931 | Switchgrass Rhizosphere | MVQNAPKHYETHQNMSLRSDGLDREDLLQKILTQLCGLNFCI |
| Ga0207644_109149842 | 3300025931 | Switchgrass Rhizosphere | MVQNAPKHYETHQNMSLRSDGVDRVDLLQKILTQLCGLNFCINYNSSARVE |
| Ga0207668_114999511 | 3300025972 | Switchgrass Rhizosphere | MVXNAPKPYETHQNMSLGSDGMDSVDLLQKIPTHLCGL |
| Ga0207658_107736771 | 3300025986 | Switchgrass Rhizosphere | MIPNPPRHYETHQNMSLGSDGVDRVDLLQKILMRLCVTN |
| Ga0207676_122468911 | 3300026095 | Switchgrass Rhizosphere | MVQNAPKHYETHQNMSLRSDGVDREDLLQKILTQLCGLN |
| Ga0268322_10138801 | 3300028049 | Phyllosphere | MVPIAPKHYETHQNMSLGSDGVDRVDLLQKNLTQLCGF |
| Ga0268344_10109971 | 3300028051 | Phyllosphere | MVPNAPKHYETHQNMSLGSDGVDRVDLLQKILTQLCGLNFCINLNS |
| Ga0268300_10046682 | 3300028052 | Phyllosphere | MVPNAPKHYETHQTMSLGPDGVDRVDLLQKILTQLCGLSFCINFNS |
| Ga0268300_10061391 | 3300028052 | Phyllosphere | VSCSNEIVPNAPKNYETHQNMSLGPGGVDRVDLLQKILTQLCGLNF |
| Ga0268306_10013441 | 3300028054 | Phyllosphere | MLPNAPKHYETHHNLSLGSDGVDWADLLQRILLQLCGLIFCTNCNSS |
| Ga0268330_10059152 | 3300028056 | Phyllosphere | MVRNALKPYETHQNMSLGSDGMDSVDLLQKILTQLCGLNFCINYN |
| Ga0268332_10012432 | 3300028058 | Phyllosphere | MVQNAPKHYETHQNMSLRSDGVDREDLLQKILTQLCGLNFCINYNNSARF |
| Ga0268332_10066321 | 3300028058 | Phyllosphere | MVPNAPKPYETHQNMSLGSLGMDSMDLLQKFLTQLCGLN |
| Ga0268314_10217981 | 3300028061 | Phyllosphere | MLPNAPKHYEMHHNMSLGSDGVDWADLLQRILLQLCGLN |
| Ga0268350_10665461 | 3300028063 | Phyllosphere | MVPNAPKHYETQQNMSLGSDGVDRVDLLQKILTQFCGLNFC |
| Ga0268355_10177291 | 3300028139 | Phyllosphere | MVRNAPKPYETHQNMSLGSDGMDSVDSLQKILTQLFGLNFC |
| Ga0268326_10044251 | 3300028141 | Phyllosphere | MLPNAPKHYETHHNLSLGSDGVDWADLLQRILLQLCGLIFC |
| Ga0268326_10113661 | 3300028141 | Phyllosphere | MVQNAPKHYETHQNMSLRSDGMDRVDLLQKIVTQLCGLN |
| Ga0268347_10018752 | 3300028142 | Phyllosphere | MVPNAPKHYETHQNISLGSDGVDRVDLLQKILTQLCGLNFCINFNSSARFEPSI |
| Ga0268347_10349411 | 3300028142 | Phyllosphere | MVPNVPKHYETHQYISLGSYGVDRVDLLQKILTQLCGL |
| Ga0268353_1126651 | 3300028149 | Phyllosphere | MVQNAPKHYETHQNMSLRSDGVNRLDLLEKILTQLCGLNFCINYNSS |
| Ga0268343_10010761 | 3300028150 | Phyllosphere | MVPNAPKPYETHQNRSLGSDGMNSMDLLQKFLMQLCGLN |
| Ga0268308_10147301 | 3300028151 | Phyllosphere | MLPNAPKHYETHHNLSLGSDGVDWADLLQRILLQLCG |
| Ga0268320_10168291 | 3300028153 | Phyllosphere | MVPNVPKHYETHQNISLGSDGVDRVGLLQKILTQLCGLNFCINYNCSTRF |
| Ga0268351_10330931 | 3300028246 | Phyllosphere | MVPNAPKPYETHQNRSLGSDGMNSMDLLQKFLMQL |
| Ga0268324_10241361 | 3300028251 | Phyllosphere | MVPSAPKPYEMHQNMSLGSDGMDSVDLLQIFQTQLC |
| Ga0268316_10009671 | 3300028253 | Phyllosphere | MVPIAPKHYETHQNMSLGSDGVDRVDLLQKNLTQLCGLNFC |
| Ga0268304_10040581 | 3300028256 | Phyllosphere | MVRNAPKPYETHQNMSLGSDGMDILDLLQKIVTQLWGLN |
| Ga0268310_10010391 | 3300028262 | Phyllosphere | MVPNAPKPYETHQNRSLGSDGMNIMDLLQKFLMQLCGL |
| Ga0268310_10022291 | 3300028262 | Phyllosphere | MVPNAPKHYETHQNISLGSDGVDRVDLLQKILTQLCGLNFCINFNSSARF |
| Ga0268325_1024841 | 3300028463 | Phyllosphere | MVQNAPKHYETHQNMSLRSDGVDRVDLLQKIVTQLCGLN |
| Ga0268301_1011042 | 3300028465 | Phyllosphere | MVQNAPKHYETHQNMSLGSDGMDRVDLLQKILTQLCGLNFCINYNSS |
| Ga0268321_1013042 | 3300028466 | Phyllosphere | MVPNAPKHYETHQNLSLGSDGVDRVDLLQKILTQFCGLNFCIKFNSS |
| Ga0268317_10040311 | 3300028468 | Phyllosphere | MVQNAPKHYETHQNMSLRSDGVDREDLLQKILTQLCGLNFCINYNNSARFEP |
| Ga0268337_10153641 | 3300028469 | Phyllosphere | MVPNAPKHYETHQNMSLGPDGADRVDLFQKILTQLCFL |
| Ga0268315_10163711 | 3300028472 | Phyllosphere | MVQSASTHYETHQNMCLGSDGVDRVDLLDKILMRLYGLNFCINY |
| Ga0268315_10227231 | 3300028472 | Phyllosphere | MVPNAPKPYETHQNRSLGSDGMNSMDLLQKFLMQLCGLNFYINYNSS |
| Ga0268319_10010291 | 3300028473 | Phyllosphere | MLPNAPKHYETHHNLSLGSDGVDWADLLQRILLQLCGLNFC |
| Ga0268327_10219601 | 3300028475 | Phyllosphere | MVPNTPKHYETHQTMSLGPDGMDRVDLLQKILTQLCGLNFC |
| Ga0268329_10024841 | 3300028476 | Phyllosphere | MVPNVSKHYETHQNISLGSDGVDRLDLLQKILTQLCGLNFCINCNSSAXF |
| Ga0268309_10090761 | 3300028477 | Phyllosphere | MVPNVPKHYETHQNISSXSVGVDRVDLLQKILTQLCDLIFFINYNSSTRFEPS |
| Ga0268305_1117401 | 3300028525 | Phyllosphere | MVPNAPKPYETHQNRSLGSDGMNSMDLLQKFLMQLCGLNFCIN |
| Ga0268339_10171521 | 3300028526 | Phyllosphere | MVPNAPKHYETHQNISLGSDGVDRVDLLQKILTQLCGLNFCINFNSSARFE |
| Ga0268335_10020661 | 3300028527 | Phyllosphere | MLPNAPKHYETHHNMSLGSDGVDWADLLQRILLQLCGLNFCTNCNN |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |