| Basic Information | |
|---|---|
| Family ID | F088860 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 109 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MGPPLRSFAADAYDCIMVRVLGPTEYKVVARLIRARKRAPL |
| Number of Associated Samples | 100 |
| Number of Associated Scaffolds | 109 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 63.46 % |
| % of genes near scaffold ends (potentially truncated) | 82.57 % |
| % of genes from short scaffolds (< 2000 bps) | 86.24 % |
| Associated GOLD sequencing projects | 98 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.25 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.413 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (10.092 % of family members) |
| Environment Ontology (ENVO) | Unclassified (18.349 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.128 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 8.70% β-sheet: 20.29% Coil/Unstructured: 71.01% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.25 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 109 Family Scaffolds |
|---|---|---|
| PF02371 | Transposase_20 | 57.80 |
| PF01548 | DEDD_Tnp_IS110 | 0.92 |
| PF05711 | TylF | 0.92 |
| PF04392 | ABC_sub_bind | 0.92 |
| PF00665 | rve | 0.92 |
| PF06078 | DUF937 | 0.92 |
| PF13751 | DDE_Tnp_1_6 | 0.92 |
| PF13683 | rve_3 | 0.92 |
| PF13495 | Phage_int_SAM_4 | 0.92 |
| COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
|---|---|---|---|
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 58.72 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.92 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.92 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.92 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.92 |
| COG3753 | Uncharacterized conserved protein YidB, DUF937 family | Function unknown [S] | 0.92 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.92 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.41 % |
| Unclassified | root | N/A | 4.59 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2189573000|GPBTN7E02IVQL4 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 507 | Open in IMG/M |
| 2189573002|GZIGXIF01EUAZM | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 2209111022|2221201135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 833 | Open in IMG/M |
| 3300000680|JGI12452J11691_100005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2859 | Open in IMG/M |
| 3300000697|JGI12493J11910_100025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2543 | Open in IMG/M |
| 3300001160|JGI12654J13325_1002466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1122 | Open in IMG/M |
| 3300001661|JGI12053J15887_10184503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium delmotii | 1071 | Open in IMG/M |
| 3300001661|JGI12053J15887_10254882 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
| 3300002910|JGI25615J43890_1052214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 676 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10116220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1071 | Open in IMG/M |
| 3300004633|Ga0066395_10337073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 834 | Open in IMG/M |
| 3300005166|Ga0066674_10272957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 798 | Open in IMG/M |
| 3300005172|Ga0066683_10127457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1555 | Open in IMG/M |
| 3300005330|Ga0070690_101358885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 571 | Open in IMG/M |
| 3300005334|Ga0068869_101708453 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300005434|Ga0070709_10019458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3925 | Open in IMG/M |
| 3300005435|Ga0070714_101217456 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300005436|Ga0070713_100058051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3225 | Open in IMG/M |
| 3300005444|Ga0070694_100095299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2095 | Open in IMG/M |
| 3300005447|Ga0066689_10909813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 544 | Open in IMG/M |
| 3300005556|Ga0066707_10355564 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
| 3300005556|Ga0066707_10920071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 536 | Open in IMG/M |
| 3300005559|Ga0066700_10152549 | All Organisms → cellular organisms → Bacteria | 1566 | Open in IMG/M |
| 3300005618|Ga0068864_100452805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1228 | Open in IMG/M |
| 3300005764|Ga0066903_102112211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1084 | Open in IMG/M |
| 3300005764|Ga0066903_106513426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 608 | Open in IMG/M |
| 3300005841|Ga0068863_102068124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 579 | Open in IMG/M |
| 3300005937|Ga0081455_10052173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3503 | Open in IMG/M |
| 3300005993|Ga0080027_10069786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1290 | Open in IMG/M |
| 3300005993|Ga0080027_10134248 | All Organisms → cellular organisms → Bacteria | 943 | Open in IMG/M |
| 3300005993|Ga0080027_10447670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 523 | Open in IMG/M |
| 3300005994|Ga0066789_10071296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1506 | Open in IMG/M |
| 3300005995|Ga0066790_10180919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 902 | Open in IMG/M |
| 3300006057|Ga0075026_100192628 | All Organisms → cellular organisms → Bacteria | 1068 | Open in IMG/M |
| 3300006576|Ga0074047_12068910 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
| 3300006642|Ga0075521_10444307 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300006796|Ga0066665_10473803 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1030 | Open in IMG/M |
| 3300006949|Ga0075528_10200124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 542 | Open in IMG/M |
| 3300009012|Ga0066710_101483797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1047 | Open in IMG/M |
| 3300009089|Ga0099828_11200685 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300009148|Ga0105243_11143043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 789 | Open in IMG/M |
| 3300009820|Ga0105085_1102237 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300010159|Ga0099796_10218401 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300010379|Ga0136449_103448376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 604 | Open in IMG/M |
| 3300011269|Ga0137392_10783775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 141 | 788 | Open in IMG/M |
| 3300011404|Ga0153951_1030733 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 922 | Open in IMG/M |
| 3300011442|Ga0137437_1318755 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300012010|Ga0120118_1095121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 725 | Open in IMG/M |
| 3300012202|Ga0137363_10334229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1250 | Open in IMG/M |
| 3300012351|Ga0137386_11269622 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300012363|Ga0137390_10828404 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 882 | Open in IMG/M |
| 3300012924|Ga0137413_11755704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 511 | Open in IMG/M |
| 3300012930|Ga0137407_11097219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 754 | Open in IMG/M |
| 3300012988|Ga0164306_11577920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 565 | Open in IMG/M |
| 3300014489|Ga0182018_10590348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 583 | Open in IMG/M |
| 3300014658|Ga0181519_10422006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 823 | Open in IMG/M |
| 3300015373|Ga0132257_101365942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 901 | Open in IMG/M |
| 3300015374|Ga0132255_103578350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 661 | Open in IMG/M |
| 3300016341|Ga0182035_11587907 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300016404|Ga0182037_11281283 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 646 | Open in IMG/M |
| 3300016422|Ga0182039_10199518 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1595 | Open in IMG/M |
| 3300016750|Ga0181505_10573462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 528 | Open in IMG/M |
| 3300018042|Ga0187871_10068257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2095 | Open in IMG/M |
| 3300018076|Ga0184609_10484945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 565 | Open in IMG/M |
| 3300019888|Ga0193751_1022263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3100 | Open in IMG/M |
| 3300019999|Ga0193718_1049625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 914 | Open in IMG/M |
| 3300021078|Ga0210381_10308712 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300021405|Ga0210387_10725173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 880 | Open in IMG/M |
| 3300021560|Ga0126371_10265341 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1835 | Open in IMG/M |
| 3300022557|Ga0212123_10019742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 7805 | Open in IMG/M |
| 3300025920|Ga0207649_11116642 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300026307|Ga0209469_1082567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 954 | Open in IMG/M |
| 3300026343|Ga0209159_1289032 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300026358|Ga0257166_1064182 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300026860|Ga0207823_106059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 917 | Open in IMG/M |
| 3300026890|Ga0207781_1021745 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300027099|Ga0208726_100262 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1468 | Open in IMG/M |
| 3300027099|Ga0208726_101917 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300027523|Ga0208890_1018529 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 986 | Open in IMG/M |
| 3300027562|Ga0209735_1014599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1558 | Open in IMG/M |
| 3300027703|Ga0207862_1161846 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300027952|Ga0209889_1016280 | All Organisms → cellular organisms → Bacteria | 1737 | Open in IMG/M |
| 3300028536|Ga0137415_10487114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1040 | Open in IMG/M |
| 3300029910|Ga0311369_10437316 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1126 | Open in IMG/M |
| 3300031057|Ga0170834_107380961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 818 | Open in IMG/M |
| 3300031547|Ga0310887_10703026 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300031573|Ga0310915_10229095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1305 | Open in IMG/M |
| 3300031679|Ga0318561_10104682 | All Organisms → cellular organisms → Bacteria | 1490 | Open in IMG/M |
| 3300031744|Ga0306918_10578363 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
| 3300031744|Ga0306918_10713671 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300031764|Ga0318535_10226727 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300031796|Ga0318576_10509655 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300031837|Ga0302315_10509834 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300031894|Ga0318522_10160908 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300031902|Ga0302322_102483318 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300031910|Ga0306923_10099804 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3275 | Open in IMG/M |
| 3300031910|Ga0306923_10439683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1480 | Open in IMG/M |
| 3300031945|Ga0310913_10425517 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300031981|Ga0318531_10433058 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300032044|Ga0318558_10124698 | All Organisms → cellular organisms → Bacteria | 1224 | Open in IMG/M |
| 3300032054|Ga0318570_10099022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1270 | Open in IMG/M |
| 3300032076|Ga0306924_10922399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 964 | Open in IMG/M |
| 3300033475|Ga0310811_10356173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1637 | Open in IMG/M |
| 3300034192|Ga0373896_003294 | All Organisms → cellular organisms → Bacteria | 1078 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.17% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.26% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 8.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.34% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.75% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 2.75% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.75% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.83% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 1.83% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.83% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.83% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.83% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.83% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.83% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.83% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.92% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.92% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.92% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.92% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.92% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.92% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.92% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.92% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.92% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.92% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.92% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.92% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.92% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.92% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.92% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.92% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.92% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.92% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.92% |
| Sediment Slurry | Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry | 0.92% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573000 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis 0-21cm (T0 for microcosms) | Environmental | Open in IMG/M |
| 2189573002 | Grass soil microbial communities from Rothamsted Park, UK - FE1 (NaCl 30g/L 5ml) | Environmental | Open in IMG/M |
| 2209111022 | Grass soil microbial communities from Rothamsted Park, UK - Chitin enrichment | Environmental | Open in IMG/M |
| 3300000680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 32 | Environmental | Open in IMG/M |
| 3300000697 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 71 | Environmental | Open in IMG/M |
| 3300001160 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002910 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006576 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006949 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost159B-16B | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009820 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011404 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ035 MetaG | Host-Associated | Open in IMG/M |
| 3300011442 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2 | Environmental | Open in IMG/M |
| 3300012010 | Permafrost microbial communities from Nunavut, Canada - A7_35cm_12M | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300019999 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a1 | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026358 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-14-B | Environmental | Open in IMG/M |
| 3300026860 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 70 (SPAdes) | Environmental | Open in IMG/M |
| 3300026890 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 51 (SPAdes) | Environmental | Open in IMG/M |
| 3300027099 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF026 (SPAdes) | Environmental | Open in IMG/M |
| 3300027523 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA (SPAdes) | Environmental | Open in IMG/M |
| 3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
| 3300027952 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031837 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300034192 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A4A4.3 | Engineered | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| N55_08256170 | 2189573000 | Grass Soil | SFAADAHGCIMVRVLGPTEYKVVARLIRARKRARL |
| FE1_03998200 | 2189573002 | Grass Soil | MGPPLRSFAADAYDCIMVRVLGPTEYKVVARLIRARKRAPL |
| 2222028443 | 2209111022 | Grass Soil | MGPPLRSFAADAHDCIMVRVLGPTEYKVVARLNRARKRAPPLIVIPIAPS |
| JGI12452J11691_1000051 | 3300000680 | Tropical Forest Soil | MGPPLRSFAADAHDCIMVRVLGPTEYKVAARLNRARAGSPLIVI |
| JGI12493J11910_1000254 | 3300000697 | Tropical Forest Soil | MGPPLRSFAADAHDCIMVRVLGPTEYKVAARLNRARKRAP |
| JGI12654J13325_10024661 | 3300001160 | Forest Soil | MGPPLRSFAADAYDCIMVRVLGPTEYKAVARLIRARKRAPL* |
| JGI12053J15887_101845033 | 3300001661 | Forest Soil | MGPPPRSFAADAHDCIMVRVLGPTEYKAVARLIRARKR |
| JGI12053J15887_102548821 | 3300001661 | Forest Soil | MAVMPRGRMGPPXRSFAADAHDCIMVXVLGPTEYKVVARLIRARKRAPL* |
| JGI25615J43890_10522141 | 3300002910 | Grasslands Soil | PPLRSFAADAHDCIMVRVLGPTEYKVAARLNRARKRAPL* |
| JGIcombinedJ51221_101162201 | 3300003505 | Forest Soil | RMGPPLRSFAADAHDCIMVRVLGPTEYKVEARLNRARKRAPL* |
| Ga0066395_103370731 | 3300004633 | Tropical Forest Soil | MAVMPRGRMGPPLRSFAADAYDCIMVRVFGPTGYKVVARLIRARKRARL* |
| Ga0066674_102729572 | 3300005166 | Soil | MGPPLRSFAADAYDCIMVRVLGPTEYKVVARLIRARKRAPL* |
| Ga0066683_101274571 | 3300005172 | Soil | MGPPLRSFAADAYDCIMVRVLGPTEYKVVARLIRARAGSPLIVI |
| Ga0066678_109875112 | 3300005181 | Soil | MGPPPRSFAADAHDCIMVWVLGPTEYKVVARLIRAPQAGSPLIVITRPH* |
| Ga0070690_1013588851 | 3300005330 | Switchgrass Rhizosphere | PNGRMGPPLRSFAADAHDCIMVRVLGPTEYKVAARLNRARKRAPL* |
| Ga0068869_1017084532 | 3300005334 | Miscanthus Rhizosphere | MGPPLRSFASDAYDCIMVRVLGPTEYKVVARLIRARKRAPL* |
| Ga0070709_100194588 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MPKGRMGPPLRSFAADAYDCIMVRVLGPTEYKVVARLIRAR* |
| Ga0070714_1012174562 | 3300005435 | Agricultural Soil | MAVMPKGRMGPPPRSFAADAHGCIMVRVLGPTEYKVVARLI |
| Ga0070713_1000580512 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MPKGRMGPPLRSFAADAYDCIMVRVFGPTEYKVVARLIRARKRAPL* |
| Ga0070694_1000952992 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MGPPLRSFAADAHDCIVVPVLGPTAYKVVARFNRARKRAPL* |
| Ga0066689_109098131 | 3300005447 | Soil | RMGPPLRSFAADAHDCIMVRVLGPTEYKVVARLIRARKRAPL* |
| Ga0070741_106478212 | 3300005529 | Surface Soil | MGPPPRSFAADAHDCIMVWVLGPTEYKVVARLIRALQAGSPLIVVSRPD* |
| Ga0066707_103555642 | 3300005556 | Soil | MGPPLRSFAADAHDCIMVRVLGPTGYKVVARLNRA |
| Ga0066707_109200711 | 3300005556 | Soil | VLPWVSMPKGRMGPPLRSFAADAYDCIMVRVLGPTEYKVVARLIRARKRAPL* |
| Ga0066700_101525492 | 3300005559 | Soil | MGPPLRSFAADAHGCIMVRVLGPTGYKVVARLIRARKR |
| Ga0068864_1004528053 | 3300005618 | Switchgrass Rhizosphere | LRSFAADAHDCIMVRVLGPTGYKVVARLNRARKRAPL* |
| Ga0066903_1021122113 | 3300005764 | Tropical Forest Soil | FAADAHDCIVVPVLGPTAYKVVARFNRARKRAPL* |
| Ga0066903_1036060182 | 3300005764 | Tropical Forest Soil | MGPPSRSFAADAHDCIMVWVLGPAEYKLVARLNCAPQAGSPLIVITRPY* |
| Ga0066903_1065134261 | 3300005764 | Tropical Forest Soil | GPPLRSFAADAHDCIVVPVLGPTAYKVAARFNRARKRAPL* |
| Ga0068863_1020681241 | 3300005841 | Switchgrass Rhizosphere | PRSFAADAHGCIMVRVLGPTEYKVVARLIRARKRARL* |
| Ga0081455_100521731 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MGPPLRSFAADAHDCIMVRVLGPTEYKVVARLIRARKR |
| Ga0080027_100697861 | 3300005993 | Prmafrost Soil | LRSFAADAYDCIMVRVLGPTEYKVVARLIRARKRAPL* |
| Ga0080027_101342482 | 3300005993 | Prmafrost Soil | MGPPLRSFAADAYDCIMVRVLGPTEYKVVARLIRARAGSPLI |
| Ga0080027_104476701 | 3300005993 | Prmafrost Soil | RMGPPLRSFAADAYDCIMVRVLGSTEYKVVARLSRARKRAPL* |
| Ga0066789_100712965 | 3300005994 | Soil | PKGRMGPPLRSFAADAYDCIMVRVLGPTEYKVVARLIRARKRAPL* |
| Ga0066790_101809192 | 3300005995 | Soil | MGPPLRSFAADAHGCIMVRVLGPTGYKVVARLIAP |
| Ga0075026_1001926282 | 3300006057 | Watersheds | MGPPLRSFAADAHDCIVVRVLGPTGYKVVARLNRA |
| Ga0074055_117449252 | 3300006573 | Soil | MGPPPRSFAADAQDCIMVWVFEAPEYKVAARNNRA* |
| Ga0074047_120689102 | 3300006576 | Soil | VFPWLSMPKGRMGPPLRSFAADAYDCIMVRVFGPTEYKVVARLIRARKRAPL* |
| Ga0075521_104443071 | 3300006642 | Arctic Peat Soil | MGPPPRSFAADAHECIMVRVLDTGYKVVARLIRARKAGSPLIVIP |
| Ga0066665_104738032 | 3300006796 | Soil | SMPKGRMGPPLRSFAADAHDCIMVRVLGPTEYKVVARLIRARKRAPL* |
| Ga0075528_102001241 | 3300006949 | Arctic Peat Soil | RMGPPLRSFAADAHDCIMVRVLGPTEYKVAARLNRARKRAPL* |
| Ga0066710_1014837971 | 3300009012 | Grasslands Soil | MGPPPRSLAADAHGCIMVRMFEDLLETSHTEYKVVARLIATAGRLA |
| Ga0099828_112006852 | 3300009089 | Vadose Zone Soil | MGPPLRSFAADAYDCIMVRVLGPTEYKVVARLSRARKQ |
| Ga0105243_111430432 | 3300009148 | Miscanthus Rhizosphere | PFSRMGAAPRSFAADAHDCIMVRARPGPTEYKVVER* |
| Ga0105085_11022372 | 3300009820 | Groundwater Sand | MGPSLRSFATDAHDCIMVRVLGPTEYKDVARLLRAP |
| Ga0099796_102184012 | 3300010159 | Vadose Zone Soil | MGPPPRSFAADAHGCIMVRVLGPTEYKVVARLIRARKRA |
| Ga0134063_102070822 | 3300010335 | Grasslands Soil | MGPPLRSFAADAHDCIMVWVLAPTEYKVVTRLIRAPQAGSPLI |
| Ga0136449_1034483761 | 3300010379 | Peatlands Soil | SFAADAHDCIMVQVLGPTGYKVVARLNRARRRAPL* |
| Ga0137392_107837752 | 3300011269 | Vadose Zone Soil | RMGPPLRSFAADAYDCIMVRVLGPTEYKVVARLIRARKRAPL* |
| Ga0153951_10307331 | 3300011404 | Attine Ant Fungus Gardens | MPKRRMGPQLRSFAADAYDCIMVLVLGPTEYKAVARLIRARKRAPL* |
| Ga0137437_13187552 | 3300011442 | Soil | MAVMPRGRMGPPLRSFAADAHGCIMVRVLEPTGYKVVARLIR |
| Ga0120118_10951213 | 3300012010 | Permafrost | RSFAADAHDCIMVRVLGPTEYKVVARLIRARKRAPL* |
| Ga0137363_103342291 | 3300012202 | Vadose Zone Soil | MGPPLRSFAADAHGCIMVRSFDLTGYRVVARLIRARKRAPL |
| Ga0137386_112696222 | 3300012351 | Vadose Zone Soil | MGPPLRSFAADAHDCIMVRVLGPTEYKVVARLIAPA |
| Ga0137390_108284043 | 3300012363 | Vadose Zone Soil | MAVMPRGRMGPPPRSFAADAHGCIMVRVLGPTEYKVVARLIRARKR |
| Ga0137413_117557041 | 3300012924 | Vadose Zone Soil | LSMPKGRMGPPLRSFAADAYDCIMVRVLGPTEYKVVARLIRVRKRAPL* |
| Ga0137407_110972192 | 3300012930 | Vadose Zone Soil | GPPLRSFAADAYDCIMVRVLGPTEYKVVARLIRARKRAPL* |
| Ga0164306_115779202 | 3300012988 | Soil | RSFAADAYDCIMVRVLGPTEYKVVARLSRARKRAPL* |
| Ga0182018_105903481 | 3300014489 | Palsa | PRSFAADAHDCIMVRVLGPTEYKVVARLSRARKRAPL* |
| Ga0181519_104220061 | 3300014658 | Bog | SFAADAHDCIMVRVLGPTEYKVVARLIRARKRAPL* |
| Ga0132257_1013659422 | 3300015373 | Arabidopsis Rhizosphere | MGPPLRSFAADAHDCIMVRVLGPTEYKVAARLNRARK |
| Ga0132255_1035783502 | 3300015374 | Arabidopsis Rhizosphere | SFAADAHDCIMVRVLGPTEYKVAARLNRARKRAPL* |
| Ga0182035_115879071 | 3300016341 | Soil | MGPPPWSFAADAHDCIMVWVLGPTEYKVVARLVRALKRGL |
| Ga0182037_112812833 | 3300016404 | Soil | MGLLLRSFATDAHDCIMVRVVGPTEYKVAARLIRARQRA |
| Ga0182039_101995181 | 3300016422 | Soil | MAVMPKGRMGPPLRSFAVDAYDCIMVRVLGPTEYKVVARLIRA |
| Ga0181505_105734621 | 3300016750 | Peatland | ASELRTDAHDCIMVRVLGPTEYKVVARLSRAQKRAPL |
| Ga0187871_100682573 | 3300018042 | Peatland | MGPPPRSFAADAHDCIMVRVLGPTEYKVVARLIRATES |
| Ga0184609_104849451 | 3300018076 | Groundwater Sediment | MAFYAAFENGPAARSFAADAYDCIMVRVLGPTEYKVVARLIRARKRAPL |
| Ga0193751_10222638 | 3300019888 | Soil | MPNGRMGPPLRSFAADAHDCIMVRVLGPTEYKVVARLIRARKRAPL |
| Ga0193718_10496252 | 3300019999 | Soil | MPIGRMGPPLRSFAADAYDCIMVLVPGPTGYKVVARLNRVR |
| Ga0210381_103087121 | 3300021078 | Groundwater Sediment | MAFMPRGRMGPPLRSFAADAHDCIMVRVLGPTGYKVVARLIRAR |
| Ga0210387_107251731 | 3300021405 | Soil | PLRSFAADAHDCIMVRVLGPTEYKVEARLNRARKRAPL |
| Ga0126371_102653413 | 3300021560 | Tropical Forest Soil | MGPPPRSFAADAHDCIMVWVFGPTEYKVVARLVRAL |
| Ga0212123_100197426 | 3300022557 | Iron-Sulfur Acid Spring | MGPPLRSFAADAHGCIMVRVPGPAGYKVVARLIRARKRAPL |
| Ga0207649_111166421 | 3300025920 | Corn Rhizosphere | MGPPLRSFAADAYDCIMVRVLGPTGYKVVARLIRA |
| Ga0209469_10825672 | 3300026307 | Soil | MGPPLRSFAADAYDCIMVRVLGPTEYKVVARLIRARK |
| Ga0209159_12890322 | 3300026343 | Soil | MGPPLRSFAADAYDCIMVRVLGPTEYKVVARLIRA |
| Ga0257166_10641822 | 3300026358 | Soil | MGPPLRSFAADAHGCIMVRVPGPAGYKVVARLIRAAR |
| Ga0207823_1060591 | 3300026860 | Tropical Forest Soil | MGPPLRSFAADAHGCIMVRVLGPTGYKVVARLIRARKRAPPLIA |
| Ga0207781_10217451 | 3300026890 | Tropical Forest Soil | MGPPLRGFAADAHDCIMVRVLGPTEYKVAARLNRARKRAP |
| Ga0208726_1002621 | 3300027099 | Forest Soil | MGPPLRSFAADAHGCIMVRVPGPAGYKVVARLIRARK |
| Ga0208726_1019171 | 3300027099 | Forest Soil | MAVMPRGRMGPPSRSFAADAHGCIMVRVPGPAGYKVVARLIRARK |
| Ga0208890_10185292 | 3300027523 | Soil | LRSFAADAYDCIMVLVLGPTGYKVVARLNRARKRAPL |
| Ga0209735_10145991 | 3300027562 | Forest Soil | MGPPLRSFAADAHDCIMVRVLGPTEYKVVARLIRAR |
| Ga0207862_11618462 | 3300027703 | Tropical Forest Soil | MGPPLRSFAADAHGCIMVRVLGPTGYKVVARLIRARKRAP |
| Ga0209889_10162803 | 3300027952 | Groundwater Sand | MGPSLRSFATDAHDCIMVRVLGPTEYKDVARLLRAPQAGSPQI |
| Ga0137415_104871142 | 3300028536 | Vadose Zone Soil | MGPPPRSFAADAHDCIMVRVLGPTEYKAVARLIRARKRAPLELS |
| Ga0311369_104373162 | 3300029910 | Palsa | MGPPLRSFAADAYDCIMVRVLGPTEYKVVARLIRARRRAPPLIVIPIA |
| Ga0170834_1073809612 | 3300031057 | Forest Soil | CFAADAYDCIMVRVFGPTEYKVVARLIRARKRAPL |
| Ga0310887_107030262 | 3300031547 | Soil | MGPPLRSFAADAYDCIMVRVLGPTEYKVVARLSRARK |
| Ga0310915_102290951 | 3300031573 | Soil | MGPPPRSFAADAHDCIMVRVPGPTEYKVVARWIRARTR |
| Ga0318561_101046821 | 3300031679 | Soil | MAVMPKGRMGPPLRSFAVDAYDCIMVRVLGPTEYKVVARLIRARKRAPL |
| Ga0306918_105783632 | 3300031744 | Soil | MGPPLRSFAADAYDCIMVRVFGPTGYKVVARLFRVRKA |
| Ga0306918_107136712 | 3300031744 | Soil | MPVLRMGPPPRSFAADAYHCIMVRVFAPTEYKDVARS |
| Ga0318535_102267271 | 3300031764 | Soil | MGPPPWSFAADAHDCIMVWVLGPTEYKVVARLVRALKRGLPS |
| Ga0318576_105096551 | 3300031796 | Soil | MGPPPRSFAADAHDCIMVWVLEPTEYKVVARLIRAPERGLP |
| Ga0302315_105098341 | 3300031837 | Palsa | MGPPLRSFAADAYDCIMVRVLGPTEYKVVARLIRARRRAP |
| Ga0318522_101609081 | 3300031894 | Soil | MGLLLRSFATDAHNCIMVWVVGPTEYKVAARLIRA |
| Ga0302322_1024833182 | 3300031902 | Fen | MGPPLRSFAADAYDCIMVRVLGPTEYKVVARPIRARK |
| Ga0306923_100998041 | 3300031910 | Soil | RSFAADAHDCIVVPVLGPTAYKVVARFNRARKRAPL |
| Ga0306923_104396832 | 3300031910 | Soil | MGPPLRSFAADAHDCIVVPVLGPTAYKVVARFNRARKRAPL |
| Ga0310913_104255172 | 3300031945 | Soil | MGPPLRSFAADAYDCIMVRVLGPTGYKVVARLIRAR |
| Ga0318531_104330581 | 3300031981 | Soil | MGPPLRSFATDAHDCIMVRVVGPTEYKVAARLIRARQ |
| Ga0318558_101246981 | 3300032044 | Soil | MGPLLRSFAADAHDCIMVRVSGPTAYKVVARFNRA |
| Ga0318570_100990222 | 3300032054 | Soil | MGPPPRSFAADAHDCIMVWVLGPTEYKVVARLVRALKRGLP |
| Ga0306924_109223993 | 3300032076 | Soil | MGPPLRSFAADAYDCIMVRVLGPTGYKVVARLMRARK |
| Ga0310811_103561732 | 3300033475 | Soil | MGPPLRSFAADAYDCIMVRVLGPTGYKVVARLIRAPDKRAPLDRHPD |
| Ga0373896_003294_3_119 | 3300034192 | Sediment Slurry | MGPPLRSFAADAHDCIMVRVLGPTGYKVVARLNRARKRA |
| ⦗Top⦘ |