| Basic Information | |
|---|---|
| Family ID | F088556 |
| Family Type | Metagenome |
| Number of Sequences | 109 |
| Average Sequence Length | 49 residues |
| Representative Sequence | MSKEIRHDIYTQAEYAKKIGVSRARVNQMVKNGELKTLTINGATLIKV |
| Number of Associated Samples | 83 |
| Number of Associated Scaffolds | 109 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 0.00 % |
| % of genes from short scaffolds (< 2000 bps) | 0.00 % |
| Associated GOLD sequencing projects | 69 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.62 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (100.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge (21.101 % of family members) |
| Environment Ontology (ENVO) | Unclassified (53.211 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (39.450 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 22.37% β-sheet: 15.79% Coil/Unstructured: 61.84% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.62 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 109 Family Scaffolds |
|---|---|---|
| PF03796 | DnaB_C | 6.42 |
| PF08299 | Bac_DnaA_C | 6.42 |
| PF01555 | N6_N4_Mtase | 5.50 |
| PF14297 | DUF4373 | 5.50 |
| PF04383 | KilA-N | 2.75 |
| PF05766 | NinG | 2.75 |
| PF01844 | HNH | 1.83 |
| PF09588 | YqaJ | 1.83 |
| PF14359 | DUF4406 | 1.83 |
| PF05772 | NinB | 1.83 |
| PF07690 | MFS_1 | 1.83 |
| PF04404 | ERF | 1.83 |
| PF08800 | VirE_N | 1.83 |
| PF00145 | DNA_methylase | 1.83 |
| PF07105 | DUF1367 | 1.83 |
| PF09643 | YopX | 1.83 |
| PF00772 | DnaB | 1.83 |
| PF13392 | HNH_3 | 1.83 |
| PF00436 | SSB | 1.83 |
| PF13148 | DUF3987 | 0.92 |
| PF09250 | Prim-Pol | 0.92 |
| PF08241 | Methyltransf_11 | 0.92 |
| PF00574 | CLP_protease | 0.92 |
| PF12728 | HTH_17 | 0.92 |
| PF03237 | Terminase_6N | 0.92 |
| PF00271 | Helicase_C | 0.92 |
| PF13155 | Toprim_2 | 0.92 |
| PF08309 | LVIVD | 0.92 |
| PF04542 | Sigma70_r2 | 0.92 |
| PF12323 | HTH_OrfB_IS605 | 0.92 |
| PF00847 | AP2 | 0.92 |
| PF13651 | EcoRI_methylase | 0.92 |
| PF00929 | RNase_T | 0.92 |
| PF11325 | DUF3127 | 0.92 |
| PF12843 | QSregVF_b | 0.92 |
| PF13481 | AAA_25 | 0.92 |
| COG ID | Name | Functional Category | % Frequency in 109 Family Scaffolds |
|---|---|---|---|
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 8.26 |
| COG0593 | Chromosomal replication initiation ATPase DnaA | Replication, recombination and repair [L] | 6.42 |
| COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 6.42 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 5.50 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 5.50 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 5.50 |
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 1.83 |
| COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 1.83 |
| COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 1.83 |
| COG0740 | ATP-dependent protease ClpP, protease subunit | Posttranslational modification, protein turnover, chaperones [O] | 1.83 |
| COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 1.83 |
| COG5276 | Uncharacterized secreted protein, contains LVIVD repeats, choice-of-anchor domain | Function unknown [S] | 0.92 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.92 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.92 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.92 |
| COG1030 | Membrane-bound serine protease NfeD, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 0.92 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.92 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 100.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 21.10% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 11.93% |
| Landfill Leachate | Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate | 9.17% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Agricultural Soil | 8.26% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 7.34% |
| Wastewater | Engineered → Built Environment → Water Treatment Plant → Unclassified → Unclassified → Wastewater | 7.34% |
| Biogas Fermentantion | Engineered → Biotransformation → Mixed Alcohol Bioreactor → Unclassified → Unclassified → Biogas Fermentantion | 3.67% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 2.75% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.75% |
| Pond Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Pond Soil | 2.75% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.83% |
| Aquatic | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Aquatic | 1.83% |
| Sinkhole Freshwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Sinkhole Freshwater | 1.83% |
| Watersheds | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Watersheds | 1.83% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 1.83% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 1.83% |
| Anaerobic Biogas Reactor | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Biogas Reactor | 1.83% |
| Freshwater Lake Hypolimnion | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion | 0.92% |
| Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment | 0.92% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.92% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.92% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.92% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.92% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.92% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.92% |
| Biogas Fermenter | Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Biogas Fermenter | 0.92% |
| Biogas Fermenter | Engineered → Unclassified → Unclassified → Unclassified → Unclassified → Biogas Fermenter | 0.92% |
| Anaerobic Digester | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Digester | 0.92% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000510 | Anaerobic digester microbial communities from Northern Denmark, sample from Foulum manure | Engineered | Open in IMG/M |
| 3300001868 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 11-31A | Environmental | Open in IMG/M |
| 3300001975 | Biogas fermenter microbial communities from the University of Hamburg, Germany | Engineered | Open in IMG/M |
| 3300002027 | Sinkhole freshwater microbial communities from Lake Huron, USA - Flux 1.5k-5k | Environmental | Open in IMG/M |
| 3300002168 | Biogas fermentation microbial communities from Germany - Plant 3 DNA2 | Engineered | Open in IMG/M |
| 3300002170 | Biogas fermentation microbial communities from Germany - Plant 3 DNA1 | Engineered | Open in IMG/M |
| 3300002173 | Biogas fermentation microbial communities from Germany - Plant 2 DNA1 | Engineered | Open in IMG/M |
| 3300002550 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-211 | Environmental | Open in IMG/M |
| 3300002839 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 11-31A and 11-33A (Combined assembly, ASSEMBLY_DATE=20140611) | Environmental | Open in IMG/M |
| 3300002898 | Metagenome Biopara biogasfermenter May 2013 pooled | Engineered | Open in IMG/M |
| 3300003369 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 002-22A | Environmental | Open in IMG/M |
| 3300003852 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB | Environmental | Open in IMG/M |
| 3300005588 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.1 | Environmental | Open in IMG/M |
| 3300005664 | Freshwater viral communities from Emiquon reservoir, Havana, Illinois, USA | Environmental | Open in IMG/M |
| 3300005827 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.188_CBA | Environmental | Open in IMG/M |
| 3300006801 | Agricultural soil microbial communities from Utah to study Nitrogen management - Steer compost 2011 | Environmental | Open in IMG/M |
| 3300006950 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one | Environmental | Open in IMG/M |
| 3300006972 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB136-A | Environmental | Open in IMG/M |
| 3300007535 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R1_A_D2_MG | Environmental | Open in IMG/M |
| 3300008470 | Sediment core microbial communities from Adelie Basin, Antarctica. Combined Assembly of Gp0136540, Gp0136562, Gp0136563 | Environmental | Open in IMG/M |
| 3300009039 | Lake sediment microbial communities from Lake Baikal, Russia to study Microbial Dark Matter (Phase II) - Lake Baikal sediment 0-5 cm | Environmental | Open in IMG/M |
| 3300009095 | Agricultural soil microbial communities from Utah to study Nitrogen management - Steer compost 2015 | Environmental | Open in IMG/M |
| 3300009194 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT | Environmental | Open in IMG/M |
| 3300009655 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR4_MetaG | Engineered | Open in IMG/M |
| 3300009666 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC077_MetaG | Engineered | Open in IMG/M |
| 3300009667 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG3_MetaG | Engineered | Open in IMG/M |
| 3300009670 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC078_MetaG | Engineered | Open in IMG/M |
| 3300009674 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC085_MetaG | Engineered | Open in IMG/M |
| 3300009704 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG1_MetaG | Engineered | Open in IMG/M |
| 3300009715 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS2_MetaG | Engineered | Open in IMG/M |
| 3300009720 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS1_MetaG | Engineered | Open in IMG/M |
| 3300009767 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS3_MetaG | Engineered | Open in IMG/M |
| 3300009780 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC045_MetaG | Engineered | Open in IMG/M |
| 3300009783 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC052_MetaG | Engineered | Open in IMG/M |
| 3300010344 | AD_JPASca | Engineered | Open in IMG/M |
| 3300010346 | AD_USMOca | Engineered | Open in IMG/M |
| 3300010347 | AD_JPHGca | Engineered | Open in IMG/M |
| 3300013129 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 10cm | Environmental | Open in IMG/M |
| 3300013137 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_11.1m | Environmental | Open in IMG/M |
| 3300013138 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_12m | Environmental | Open in IMG/M |
| 3300014203 | Groundwater microbial communities from an aquifer near a municipal landfill in Southern Ontario, Canada - Pumphouse #3_1 metaG | Environmental | Open in IMG/M |
| 3300014204 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 64-88 metaG | Engineered | Open in IMG/M |
| 3300014205 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 162 metaG | Engineered | Open in IMG/M |
| 3300015214 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 138R metaG | Engineered | Open in IMG/M |
| 3300018405 | Freshwater microbial communities from Pennsylvania, USA, analyzing microbe dynamics in response to fracking - TARM_MetaG_T2_14 | Environmental | Open in IMG/M |
| 3300018412 | Freshwater microbial communities from Pennsylvania, USA, analyzing microbe dynamics in response to fracking - TARM_MetaG_T3A_14 | Environmental | Open in IMG/M |
| 3300022555 | Alinen_combined assembly | Environmental | Open in IMG/M |
| 3300025524 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB136-A (SPAdes) | Environmental | Open in IMG/M |
| 3300025575 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 11-33A (SPAdes) | Environmental | Open in IMG/M |
| 3300025613 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR4_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025677 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS2_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025686 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG2_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025737 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC078_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025846 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-211 (SPAdes) | Environmental | Open in IMG/M |
| 3300025871 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC045_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025891 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one (SPAdes) | Environmental | Open in IMG/M |
| 3300026156 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R1_A_D1_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026157 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R1_A_D2_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026290 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1 time_0 SIP DNA (SPAdes) | Engineered | Open in IMG/M |
| 3300026311 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2 time_0 SIP DNA (SPAdes) | Engineered | Open in IMG/M |
| 3300027711 | Agricultural soil microbial communities from Utah to study Nitrogen management - Steer compost 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027819 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW37 contaminated, 5.8 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300027980 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028178 | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_36m | Environmental | Open in IMG/M |
| 3300028561 (restricted) | Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant16 | Engineered | Open in IMG/M |
| 3300028567 (restricted) | Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant14 | Engineered | Open in IMG/M |
| 3300028568 (restricted) | Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant20 | Engineered | Open in IMG/M |
| 3300028593 (restricted) | Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant24 | Engineered | Open in IMG/M |
| 3300028603 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 138R | Engineered | Open in IMG/M |
| 3300028677 (restricted) | Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant22 | Engineered | Open in IMG/M |
| 3300028734 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E2_1 | Environmental | Open in IMG/M |
| 3300028738 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N2_1 | Environmental | Open in IMG/M |
| 3300028862 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_1 | Environmental | Open in IMG/M |
| 3300029911 | III_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300031227 | Saline water microbial communities from Ace Lake, Antarctica - #232 | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Foulum_101729910 | 3300000510 | Anaerobic Digester | MKKEVRQDVYTQAAYAKKVGKTRAWVNQQIKAGNLKILRINGATLIKE* |
| JGI24146J20443_1000082116 | 3300001868 | Arctic Peat Soil | MPKKEIRHDVATQTEYAKMVGKTPQWVNQQIKAGNLNTLQIKGAVLIKLK* |
| Draft_111817482 | 3300001975 | Biogas Fermenter | MAVEIYRPLLTKNLTMYDEQRNKTRHLLTQANMTKKIGVSRARVNQMVKNGELKTLTINGATLIKV* |
| MIS_100678995 | 3300002027 | Sinkhole Freshwater | MKKEIRHDVATQSEYAKMIGVSRARVNQMVKAGEVNVLYVKGAILIKL* |
| MIS_101495324 | 3300002027 | Sinkhole Freshwater | MKKEIRHDVATQSEYAKMIGVSRARVNQMVKAGEVNTLSVKGAVLIKLN* |
| JGI24712J26585_100229675 | 3300002168 | Biogas Fermentantion | MMSKEIRHDVYTQAEYAKKIGVSRARVNQMVKNGELKTLTVNGATLIKV* |
| JGI24711J26586_100430163 | 3300002170 | Biogas Fermentantion | MSKEIRHDVYTQAEYAKKIGVSRARVNQMVKNGELKTLTVNGATLIKV* |
| JGI24709J26583_101226171 | 3300002173 | Biogas Fermentantion | MKKEVRQDVYTQAAYAKKVGKTRAWVNQQIKAGNLKTLRVNGATLVKE* |
| JGI24709J26583_101670922 | 3300002173 | Biogas Fermentantion | MKKEIRQDVYTQAAYAKKVGKSRAWVNQQIKAGNLKILRINGATLIKE* |
| JGI24131J36419_100157178 | 3300002550 | Arctic Peat Soil | MPKKEIRHDVATQTEYAKMVGKTPQWVNQQIKAGNLNTLQIKGAVLVKLK* |
| JGIcombinedJ43158_1000010250 | 3300002839 | Arctic Peat Soil | MSIQPKEIRKDLYTQAEYAKKVGKTRSWVNLQIKSGSLKTLTVMGTTLVKV* |
| JGIcombinedJ43158_100021626 | 3300002839 | Arctic Peat Soil | MLKEIRQDIYTQAEYAKLMGKTRSWVNQKIKAGELKTLTIKGATLVKA* |
| draft_101061433 | 3300002898 | Biogas Fermenter | MKKEIRQDVYTQAAYAKKIGKSRAWVNQQIKAGNIKTLRVNGATLIKE* |
| JGI24140J50213_100881152 | 3300003369 | Arctic Peat Soil | MLNSVKEIRQDLFTQSEYAKKVGKTRAWVNQQIKAGNLKVLHVKGAVLIKL* |
| Ga0031655_100342492 | 3300003852 | Freshwater Lake Sediment | MIKEIRHDLYTQVEYAKLVGKTPAWVNQQIKAGNLKTLTVKGGILIKV* |
| Ga0070728_101264142 | 3300005588 | Marine Sediment | MVKEIRKDLFTQAEWAKKICKSRAWVNQQIKAGNIKTVTINGAVLVKQ* |
| Ga0073685_10645074 | 3300005664 | Aquatic | MSKEIRKDVYTQAEYGKLVGKTRAWVNQQIKAGNLKTLSVNGAILVKM* |
| Ga0073685_11179591 | 3300005664 | Aquatic | MSKEIRHDVYTQAEYAKKIGVSRARVNQMTKNGELKTLTINGATLIKV* |
| Ga0074478_11473794 | 3300005827 | Sediment (Intertidal) | MIKKEIRQDVYTQKKYAELVGKTPAWVNQQIKAGNLKTLIVQGAVLVKL* |
| Ga0079223_103763812 | 3300006801 | Agricultural Soil | MKKEIRQDVYTQAAYAKKIGKSRAWVNQQIKAGNIKTLRINGATLIKE* |
| Ga0079223_107043421 | 3300006801 | Agricultural Soil | MKKEIRQDVYTQAAYAKKIGKSRAWVNQQIKAGNIKTLLVNGATLIKE* |
| Ga0075524_1000000476 | 3300006950 | Arctic Peat Soil | MPVKEIRQDVATQTEYAKMVGKTPQWVNQQIKAGNLSTLHIKGAILVKLK* |
| Ga0075518_10170424 | 3300006972 | Arctic Peat Soil | MPVKEIRQDVATQTEYAKMVGKTPQWVNQQIKAGNLSTLHIKGAILVKIK* |
| Ga0102926_11130362 | 3300007535 | Pond Soil | MYKKEIRKDLYTQAEYAKKIGKHRSWVNQQIKLGNIKTVTINGAILVKA* |
| Ga0115371_113180881 | 3300008470 | Sediment | MVNIKEIRQDVYTQAEYAKKIGKSRAWVNQQIKAGNLKTLTIKGATLVKLK |
| Ga0105152_101727312 | 3300009039 | Lake Sediment | MPKKEIRQDVATQSEYAKMVGKTPQWVNQQIKLGNISTLHVKGAVLVKLQ* |
| Ga0079224_1001731352 | 3300009095 | Agricultural Soil | MKKEVRQDVYTQAAYAKKVGKTRAWVNQQIKAGNLKILRINGATLVKE* |
| Ga0079224_1002948074 | 3300009095 | Agricultural Soil | MKEIRKDLFTQAEYAKKVGLTPARINQMVKKGELKTVRINGATLIKV* |
| Ga0079224_1019467633 | 3300009095 | Agricultural Soil | MLTMKKEIRQDLFTQAQYAVRIGVSRARVNQMIKNGELNTVTINGATLVKI* |
| Ga0079224_1035136971 | 3300009095 | Agricultural Soil | MKEIRRDLFTQAEYAKKVGLTPARINQMVKKGELKTITINGATLIKV* |
| Ga0079224_1039985822 | 3300009095 | Agricultural Soil | MKKEIRQDLFTQAQYAVRIGVSRARVNQMIKNGELSTVTINGATLVKI* |
| Ga0114983_10074753 | 3300009194 | Deep Subsurface | MLKEIRKDIFTQAEYAKKVGKSRAWVNQQIKSGNLKTLTVNGAVLVKI* |
| Ga0116190_10230141 | 3300009655 | Anaerobic Digestor Sludge | MKSKEIRYDIYTQAEYAKKIGVSRARVNQMAKNGELKTLTINGATLIKV* |
| Ga0116182_14402112 | 3300009666 | Anaerobic Digestor Sludge | MSKERRHDIYTQAEYAKKIGVSRARVNQMAKNGELKTLTINGATLIKV* |
| Ga0116147_11297981 | 3300009667 | Anaerobic Digestor Sludge | MYMSKEIRHDIYTQAEYAKKIGVSRARVNQMTKNGELKTLTINGATLIKV* |
| Ga0116183_11338061 | 3300009670 | Anaerobic Digestor Sludge | MMSKERRHDIYTQAEYAKKIGVSRARVNQMAKNGELKTLTINGATLIKV* |
| Ga0116183_13068171 | 3300009670 | Anaerobic Digestor Sludge | MSKEIRHDIYTQAEYAKKIGVSRARVNQMAKNGELKTLTINGATLIKV* |
| Ga0116173_11669411 | 3300009674 | Anaerobic Digestor Sludge | NLTMHMSKEIRHDIYTQAEYAKKIGVSRARVNQMAKNGELKTLTINGATLIKV* |
| Ga0116145_10249453 | 3300009704 | Anaerobic Digestor Sludge | MSKEIRHDIYTQAEYAKKIGVSRARVNQMTKNGELKTLTINGATLIKV* |
| Ga0116160_10145621 | 3300009715 | Anaerobic Digestor Sludge | EIRYDIYTQAEYAKKIGVSRARVNQMAKNGELKTLTINGATLIKV* |
| Ga0116159_10417113 | 3300009720 | Anaerobic Digestor Sludge | MIKEIRQDLYTQSEYAKLKGITRARVNQLVKSGDLQTLTINGATLIKV* |
| Ga0116161_12415691 | 3300009767 | Anaerobic Digestor Sludge | DIYTQAEYAKKIGVSRARVNQMAKNGELKTLTINGATLIKV* |
| Ga0116156_100417575 | 3300009780 | Anaerobic Digestor Sludge | MSKEIRQDVYTQSEYSKKVGKTRAWVNQQVKAGNLKTLTVNGAVLIKV* |
| Ga0116156_100966572 | 3300009780 | Anaerobic Digestor Sludge | MMSKEIRHDIYTQAEYAKKIGVSRARVNQMVKNGELKTLTINGATLIKA* |
| Ga0116158_101136992 | 3300009783 | Anaerobic Digestor Sludge | MSKEIRHDIYTQAEYAKKIGVSRARVNQMVKNGELKTLTINGATLIKA* |
| Ga0116243_101007591 | 3300010344 | Anaerobic Digestor Sludge | KSKEIRYDIYTQAEYAKKIGVSRARVNQMAKNGELKTLTINGATLIKV* |
| Ga0116243_103863022 | 3300010344 | Anaerobic Digestor Sludge | MNKEIRHDVYTQAEYAKKIGVSRARVNQMTKNGELKTLTINGATLIKV* |
| Ga0116239_103577153 | 3300010346 | Anaerobic Digestor Sludge | MSKEIRHDIYTQAEYAKKIGVSRARVNQMVKNGELKTLTINGATLIKV* |
| Ga0116238_100370057 | 3300010347 | Anaerobic Digestor Sludge | YAKKIGVSRARVNQMAKNGELKTLTINGATLIKV* |
| (restricted) Ga0172364_107215602 | 3300013129 | Sediment | MTKEIRQDIYTQSEYAKLIGITRARVNQMVKAGELKTLTIKGATLIKV* |
| (restricted) Ga0172375_100714704 | 3300013137 | Freshwater | MTKEIRQDVYTQAEYAKMIGVTRARVNQMIKEGEVKILKVQGATLIKV* |
| (restricted) Ga0172371_101089772 | 3300013138 | Freshwater | MTKEIRQDVYTQAEYAKMIGVTRARVNQMIKAGEVKILKVQGATLIKV* |
| Ga0172378_101516095 | 3300014203 | Groundwater | MKEIRRDLFTQAEYAKKVGLTPARINQMVKKGELKTIKINGATLIKV* |
| Ga0172381_1000070767 | 3300014204 | Landfill Leachate | MTETKREIRQDIFTQAEYARRVRKTRAWVNQQIKEGNLRTLTVNGATLIKA* |
| Ga0172381_1000244824 | 3300014204 | Landfill Leachate | MSIKEIRQDIFTQSAYAKHVGKTRAWVNQQVKAGNLKILKINGTILIKK* |
| Ga0172381_1000252218 | 3300014204 | Landfill Leachate | MSKEIREDLYTQAEYAKKVGKTRAWVNQQIKAGNIKTLTVKGATLVKA* |
| Ga0172381_100331233 | 3300014204 | Landfill Leachate | MSKEIRQDLFTQAEYAKKVKKTRAWVNQQVKSGKLKTLIINGATLVKA* |
| Ga0172381_100368215 | 3300014204 | Landfill Leachate | MVKEIRQDIYTQAEYARKIRKTRTWVNQQIKAGNLKTLTVNGAILIKV* |
| Ga0172381_104286562 | 3300014204 | Landfill Leachate | MVKEVRQDVYTQTEYAKKIGKTKAWVNQQIKAGNLKTLSVKGATLVKV* |
| Ga0172380_1000246733 | 3300014205 | Landfill Leachate | MSSRFLGIKKLTMLKEIRKDLYTQAEYARLVHKSRAWVNQKIMSGDLRTVNINGATLVKI |
| Ga0172380_101044794 | 3300014205 | Landfill Leachate | MAETKEIRQDVYTQAEYARKIGKTRAWVNQQIKEGNLRTLSVKGAILVKV* |
| Ga0172382_103415041 | 3300015214 | Landfill Leachate | MKKEIRQDLYTQAAYAKKIGKSRAWVNQQIKAGNLKTLRINGATLVKE* |
| Ga0194138_102619172 | 3300018405 | Watersheds | MLKEIRKDIFTQAEYAKKVGKSRAWVNQQIKSGNLKTLTVNGAVLVKI |
| Ga0194136_11861842 | 3300018412 | Watersheds | MLKEIRKDIFTQAEYAKKVCKSRAWVNQQIKSGNLKTLTVNGAVLVKI |
| Ga0212088_100240594 | 3300022555 | Freshwater Lake Hypolimnion | MLKEIRQDIYTQAEYAKLMGKTRSWVNQKIKAGELKTLTIKGATLVKA |
| Ga0209817_10057495 | 3300025524 | Arctic Peat Soil | MPVKEIRQDVATQTEYAKMVGKTPQWVNQQIKAGNLSTLHIKGAILVKIK |
| Ga0209430_100018867 | 3300025575 | Arctic Peat Soil | MSIQPKEIRKDLYTQAEYAKKVGKTRSWVNLQIKSGSLKTLTVMGTTLVKV |
| Ga0209430_100036941 | 3300025575 | Arctic Peat Soil | MPKKEIRHDVATQTEYAKMVGKTPQWVNQQIKAGNLNTLQIKGAVLIKLK |
| Ga0208461_10232551 | 3300025613 | Anaerobic Digestor Sludge | MKSKEIRYDIYTQAEYAKKIGVSRARVNQMAKNGELKTLTINGATLIKV |
| Ga0209719_10297201 | 3300025677 | Anaerobic Digestor Sludge | IRYDIYTQAEYAKKIGVSRARVNQMAKNGELKTLTINGATLIKV |
| Ga0209506_12195142 | 3300025686 | Anaerobic Digestor Sludge | YDIYTQAEYAKKIGVSRARVNQMAKNGELKTLTINGATLIKV |
| Ga0208694_10992634 | 3300025737 | Anaerobic Digestor Sludge | MMSKERRHDIYTQAEYAKKIGVSRARVNQMAKNGELKTLTINGATLIKV |
| Ga0209538_10040281 | 3300025846 | Arctic Peat Soil | PKKEIRHDVATQTEYAKMVGKTPQWVNQQIKAGNLNTLQIKGAVLIKLK |
| Ga0209538_101267512 | 3300025846 | Arctic Peat Soil | MPKKEIRHDVATQTEYAKMVGKTPQWVNQQIKAGNLNTLQIKGAVLVKLK |
| Ga0209311_10563384 | 3300025871 | Anaerobic Digestor Sludge | MSKEIRQDVYTQSEYSKKVGKTRAWVNQQVKAGNLKTLTVNGAVLIKV |
| Ga0209311_10576934 | 3300025871 | Anaerobic Digestor Sludge | MMSKEIRHDIYTQAEYAKKIGVSRARVNQMVKNGELKTLTINGATLIKA |
| Ga0209585_1000002435 | 3300025891 | Arctic Peat Soil | MPVKEIRQDVATQTEYAKMVGKTPQWVNQQIKAGNLSTLHIKGAILVKLK |
| Ga0209936_11811612 | 3300026156 | Pond Soil | KEIRKDLYTQAEYAKKIGKHRSWVNQQIKLGNIKTVTINGAILVKA |
| Ga0209942_10198511 | 3300026157 | Pond Soil | MYKKEIRKDLYTQAEYAKKIGKHRSWVNQQIKLGNIKTVTINGAILVKA |
| Ga0209510_10238242 | 3300026290 | Anaerobic Biogas Reactor | MKKEIRQDLYTQAAYAKKIGKSRAWVNQQIKAGNLKILRINGATLIKE |
| Ga0209723_10656003 | 3300026311 | Anaerobic Biogas Reactor | MMSKEIRHDIYTQAEYAKKIGVSRARVNQMAKNGELKTLTINGATLIKV |
| Ga0209075_10146767 | 3300027711 | Agricultural Soil | MKKEIRQDVYTQAAYAKKIGKSRAWVNQQIKAGNIKTLRINGATLIKE |
| Ga0209075_10474863 | 3300027711 | Agricultural Soil | MKKEIRQDVYTQAAYAKKIGKSRAWVNQQIKAGNIKTLRVNGATLIKE |
| Ga0209514_1000837910 | 3300027819 | Groundwater | MSIKEIRQDIFTQSAYAKHVGKTRAWVNQQVKAGNLKILKINGTILIKA |
| Ga0209777_100064129 | 3300027896 | Freshwater Lake Sediment | MIKEIRHDLYTQVEYAKLVGKTPAWVNQQIKAGNLKTLTVKGGILIKV |
| Ga0209668_102589092 | 3300027899 | Freshwater Lake Sediment | MAKKEIRQDVATQAEYAKMVGKTRAWVNQQIKLGKLSTLHIKGAVLIKLEQKEI |
| Ga0209475_101187653 | 3300027980 | Marine Sediment | MVKEIRKDLFTQAEWAKKICKSRAWVNQQIKAGNIKTVTINGAVLVKQ |
| Ga0265593_10836114 | 3300028178 | Saline Water | LDFEFKIVNMAKKEIRQDVATQVEYARIIGKSAAWVNQQIKAGNINTLHVKGAVLVKLK |
| (restricted) Ga0255343_13394672 | 3300028561 | Wastewater | MHMSKEIRHDIYTQAEYAKKIGVSRARVNQMAKNGELKTLTINGATLIKV |
| (restricted) Ga0255342_10801491 | 3300028567 | Wastewater | MNKEIRHDIYTQAEYAKKIGVSRARVNQMAKNGELKTLTINGAT |
| (restricted) Ga0255342_11240923 | 3300028567 | Wastewater | KKLTMYMSKEIRHDIYTQAEYAKKIGVSRARVNQMAKNGELKTLTINGATLIKV |
| (restricted) Ga0255345_12253752 | 3300028568 | Wastewater | MSKEIRHDIYTQAEYAKKIGVSRARVNQMAKNGELKTLTINGATLIKA |
| (restricted) Ga0255347_10019462 | 3300028593 | Wastewater | MSKEIRRDIYTQAEYAKKIGVSRARVNQMTKNGELKTLTINGATLIKV |
| (restricted) Ga0255347_11126482 | 3300028593 | Wastewater | MSKEIRHDIYTQAEYAKKIGVSRARVNQMAKNGELKTLTINGATLIKV |
| (restricted) Ga0255347_12735302 | 3300028593 | Wastewater | SKEIRHDIYTQAEYAKKIGVSRARVNQMAKNGELKTLTINGATLIKA |
| Ga0265293_101610984 | 3300028603 | Landfill Leachate | MKKEIRQDLYTQAAYAKKIGKSRAWVNQQIKAGNLKTLRINGATLVKE |
| (restricted) Ga0255346_11940242 | 3300028677 | Wastewater | MHMSKEIRHDIYTQAEYAKKIGVSRARVNQMAKNGELKTLTINGATLIKA |
| Ga0302206_10708672 | 3300028734 | Fen | MIKEIRQDLYTQAEYAKLVHKSAAWVNQQIKANNLKTLTVNGAILVKI |
| Ga0302292_12377692 | 3300028738 | Fen | MSKKEIRQDVATQTEYAKLVGKTPQWVNQQIKAGNLSTLHIKGAILVKIK |
| Ga0302296_11425632 | 3300028862 | Fen | MLKEIRQDLITQAEYAKMVGKTRSWVNQQIKAGNLKVLHVKGTVLIKL |
| Ga0311361_104169763 | 3300029911 | Bog | MAKKEIRKDVMTQAAYAVKVGKTRAWVNQQIKAGNIDTLHIEGAILVKLN |
| Ga0311349_104734431 | 3300030294 | Fen | MSKEIRHDLYTQAEYAKLVGKTRSWVCLQVKDGKLKTLTVKGAILVKI |
| Ga0311349_117088952 | 3300030294 | Fen | MIKEIRQDLYTQAEYAKLVHKSAAWVNQQIKANNLKTLTVNGA |
| Ga0307928_100407392 | 3300031227 | Saline Water | MIKEIRKDLFTQADWAKKVGKSRAWVNQQIKAGNIKTVTINGAILVKL |
| Ga0302323_1034755012 | 3300031232 | Fen | MIKEIRQDLYTQSEYAKLVHKSAAWVNQQIKANNLKTLTVNGAILVKV |
| Ga0311364_106386532 | 3300031521 | Fen | MIKEIRQDLYTQAEYAKLVHKSAAWVNQQIKANNLKTLTVNGAILVKV |
| Ga0302321_1001297381 | 3300031726 | Fen | RQDLYTQSEYAKLVHKSAAWVNQQIKANNLKTLTVNGAILVKV |
| Ga0334722_110463162 | 3300033233 | Sediment | MKEARKDVYTQAAYAKKVGKTRAWVNQQVKAGNLQTLIINGAILVKEKN |
| Ga0335066_0251888_152_298 | 3300034112 | Freshwater | MTKEIRQDIYTQSEFAKLKGITRARVNQMVKAGELRTLTVKGATLIKV |
| ⦗Top⦘ |