| Basic Information | |
|---|---|
| Family ID | F086834 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 110 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MVMCEWTLADIKNRASNKAFAKVTILTLDIETYKRDLREGNIGGVTYE |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Archaea |
| % of genes with valid RBS motifs | 8.18 % |
| % of genes near scaffold ends (potentially truncated) | 98.18 % |
| % of genes from short scaffolds (< 2000 bps) | 96.36 % |
| Associated GOLD sequencing projects | 87 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Archaea (76.364 % of family members) |
| NCBI Taxonomy ID | 2157 |
| Taxonomy | All Organisms → cellular organisms → Archaea |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (14.546 % of family members) |
| Environment Ontology (ENVO) | Unclassified (65.455 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (67.273 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.79% β-sheet: 5.26% Coil/Unstructured: 53.95% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.27 % |
| Unclassified | root | N/A | 2.73 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2236876004|none_p0271592 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 505 | Open in IMG/M |
| 2236876004|none_p0318809 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 501 | Open in IMG/M |
| 3300000119|KGI_S1_ANT01_95mDRAFT_c10152666 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 625 | Open in IMG/M |
| 3300000127|SA_S1_NOR05_45mDRAFT_c10065800 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 881 | Open in IMG/M |
| 3300000128|SA_S1_NOR08_45mDRAFT_c10221342 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 522 | Open in IMG/M |
| 3300000159|LPaug08P2610mDRAFT_c1010902 | All Organisms → Viruses → Predicted Viral | 1114 | Open in IMG/M |
| 3300001589|JGI24005J15628_10206229 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 547 | Open in IMG/M |
| 3300001718|JGI24523J20078_1013132 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1094 | Open in IMG/M |
| 3300001720|JGI24513J20088_1005493 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1768 | Open in IMG/M |
| 3300001853|JGI24524J20080_1020578 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 682 | Open in IMG/M |
| 3300005821|Ga0078746_1048024 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 924 | Open in IMG/M |
| 3300006802|Ga0070749_10378367 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 784 | Open in IMG/M |
| 3300006803|Ga0075467_10341493 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 789 | Open in IMG/M |
| 3300006810|Ga0070754_10405181 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 596 | Open in IMG/M |
| 3300006870|Ga0075479_10253804 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 696 | Open in IMG/M |
| 3300006916|Ga0070750_10144415 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1079 | Open in IMG/M |
| 3300006920|Ga0070748_1202397 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 725 | Open in IMG/M |
| 3300006947|Ga0075444_10345924 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 566 | Open in IMG/M |
| 3300007276|Ga0070747_1158666 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 810 | Open in IMG/M |
| 3300007344|Ga0070745_1317873 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 552 | Open in IMG/M |
| 3300007346|Ga0070753_1145739 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 899 | Open in IMG/M |
| 3300007540|Ga0099847_1115566 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 810 | Open in IMG/M |
| 3300007625|Ga0102870_1164877 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 636 | Open in IMG/M |
| 3300008651|Ga0103623_1002621 | All Organisms → Viruses → Predicted Viral | 1181 | Open in IMG/M |
| 3300008995|Ga0102888_1116834 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 549 | Open in IMG/M |
| 3300009001|Ga0102963_1122618 | All Organisms → Viruses → Predicted Viral | 1054 | Open in IMG/M |
| 3300009003|Ga0102813_1291891 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 505 | Open in IMG/M |
| 3300009024|Ga0102811_1072440 | All Organisms → Viruses → Predicted Viral | 1293 | Open in IMG/M |
| 3300009054|Ga0102826_1063206 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 893 | Open in IMG/M |
| 3300009055|Ga0102905_1144547 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 507 | Open in IMG/M |
| 3300009071|Ga0115566_10598031 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 618 | Open in IMG/M |
| 3300009079|Ga0102814_10137884 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1335 | Open in IMG/M |
| 3300009086|Ga0102812_10321144 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 842 | Open in IMG/M |
| 3300009136|Ga0118735_10024408 | All Organisms → Viruses → Predicted Viral | 1883 | Open in IMG/M |
| 3300009136|Ga0118735_10334039 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 527 | Open in IMG/M |
| 3300009172|Ga0114995_10741476 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 537 | Open in IMG/M |
| 3300009420|Ga0114994_10668321 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 679 | Open in IMG/M |
| 3300009436|Ga0115008_11542738 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 515 | Open in IMG/M |
| 3300009496|Ga0115570_10321710 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 667 | Open in IMG/M |
| 3300009507|Ga0115572_10334324 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 855 | Open in IMG/M |
| 3300009512|Ga0115003_10180869 | All Organisms → Viruses → Predicted Viral | 1272 | Open in IMG/M |
| 3300009512|Ga0115003_10893381 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 516 | Open in IMG/M |
| 3300010392|Ga0118731_109096481 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 510 | Open in IMG/M |
| 3300010430|Ga0118733_104575209 | Not Available | 736 | Open in IMG/M |
| 3300011125|Ga0151663_1028496 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 703 | Open in IMG/M |
| 3300011126|Ga0151654_1038852 | All Organisms → Viruses → Predicted Viral | 1434 | Open in IMG/M |
| 3300011256|Ga0151664_1206537 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 523 | Open in IMG/M |
| 3300017737|Ga0187218_1048664 | Not Available | 1059 | Open in IMG/M |
| 3300017749|Ga0181392_1080896 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 979 | Open in IMG/M |
| 3300017749|Ga0181392_1184946 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 603 | Open in IMG/M |
| 3300017751|Ga0187219_1226097 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 510 | Open in IMG/M |
| 3300017762|Ga0181422_1012820 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 2790 | Open in IMG/M |
| 3300017782|Ga0181380_1026349 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 2145 | Open in IMG/M |
| 3300017786|Ga0181424_10429654 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 534 | Open in IMG/M |
| 3300020185|Ga0206131_10097941 | All Organisms → Viruses → Predicted Viral | 1696 | Open in IMG/M |
| 3300020438|Ga0211576_10324224 | Not Available | 797 | Open in IMG/M |
| 3300021958|Ga0222718_10586397 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 525 | Open in IMG/M |
| 3300022061|Ga0212023_1056650 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 544 | Open in IMG/M |
| 3300022063|Ga0212029_1028815 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 772 | Open in IMG/M |
| 3300022164|Ga0212022_1057385 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 600 | Open in IMG/M |
| 3300022178|Ga0196887_1012425 | All Organisms → Viruses → Predicted Viral | 2696 | Open in IMG/M |
| 3300022206|Ga0224499_10172264 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 738 | Open in IMG/M |
| 3300022308|Ga0224504_10234179 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 758 | Open in IMG/M |
| (restricted) 3300023085|Ga0233406_10084542 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 530 | Open in IMG/M |
| (restricted) 3300023112|Ga0233411_10060067 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1190 | Open in IMG/M |
| (restricted) 3300023210|Ga0233412_10111477 | All Organisms → Viruses → Predicted Viral | 1154 | Open in IMG/M |
| (restricted) 3300023271|Ga0233403_10039923 | All Organisms → Viruses → Predicted Viral | 1457 | Open in IMG/M |
| (restricted) 3300023276|Ga0233410_10216369 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 616 | Open in IMG/M |
| (restricted) 3300024259|Ga0233437_1104551 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1404 | Open in IMG/M |
| (restricted) 3300024519|Ga0255046_10060122 | All Organisms → Viruses → Predicted Viral | 1520 | Open in IMG/M |
| (restricted) 3300024519|Ga0255046_10201501 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 903 | Open in IMG/M |
| (restricted) 3300024520|Ga0255047_10382017 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 710 | Open in IMG/M |
| (restricted) 3300024521|Ga0255056_10297037 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 729 | Open in IMG/M |
| (restricted) 3300024521|Ga0255056_10307658 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 717 | Open in IMG/M |
| (restricted) 3300024528|Ga0255045_10101007 | All Organisms → Viruses → Predicted Viral | 1048 | Open in IMG/M |
| 3300025071|Ga0207896_1071214 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 541 | Open in IMG/M |
| 3300025137|Ga0209336_10136599 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 659 | Open in IMG/M |
| 3300025137|Ga0209336_10189349 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 514 | Open in IMG/M |
| 3300025626|Ga0209716_1039632 | All Organisms → Viruses → Predicted Viral | 1649 | Open in IMG/M |
| 3300025626|Ga0209716_1108582 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 777 | Open in IMG/M |
| 3300025641|Ga0209833_1189570 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 509 | Open in IMG/M |
| 3300025647|Ga0208160_1120131 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 664 | Open in IMG/M |
| 3300025767|Ga0209137_1185826 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 716 | Open in IMG/M |
| 3300025767|Ga0209137_1231390 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 601 | Open in IMG/M |
| 3300025769|Ga0208767_1148822 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 855 | Open in IMG/M |
| 3300025809|Ga0209199_1029353 | All Organisms → Viruses → Predicted Viral | 3144 | Open in IMG/M |
| 3300025849|Ga0209603_1131539 | All Organisms → Viruses → Predicted Viral | 1050 | Open in IMG/M |
| 3300025873|Ga0209757_10061977 | All Organisms → Viruses → Predicted Viral | 1110 | Open in IMG/M |
| 3300027189|Ga0208675_1022567 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 768 | Open in IMG/M |
| 3300027223|Ga0208169_1047144 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 796 | Open in IMG/M |
| 3300027571|Ga0208897_1177528 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 520 | Open in IMG/M |
| 3300027751|Ga0208304_10259505 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 615 | Open in IMG/M |
| 3300027751|Ga0208304_10344920 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 515 | Open in IMG/M |
| 3300027752|Ga0209192_10123951 | All Organisms → Viruses → Predicted Viral | 1044 | Open in IMG/M |
| 3300027753|Ga0208305_10134324 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 913 | Open in IMG/M |
| 3300027758|Ga0209379_10158433 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 794 | Open in IMG/M |
| 3300027820|Ga0209578_10380621 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 646 | Open in IMG/M |
| (restricted) 3300027856|Ga0255054_10153967 | All Organisms → Viruses → Predicted Viral | 1134 | Open in IMG/M |
| (restricted) 3300027856|Ga0255054_10665729 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 503 | Open in IMG/M |
| (restricted) 3300027861|Ga0233415_10091858 | All Organisms → Viruses → Predicted Viral | 1325 | Open in IMG/M |
| (restricted) 3300027861|Ga0233415_10141890 | All Organisms → Viruses → Predicted Viral | 1084 | Open in IMG/M |
| (restricted) 3300027868|Ga0255053_10616222 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 524 | Open in IMG/M |
| 3300027978|Ga0209165_10175835 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 739 | Open in IMG/M |
| 3300031519|Ga0307488_10807489 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 518 | Open in IMG/M |
| 3300031578|Ga0307376_10339265 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 997 | Open in IMG/M |
| 3300031627|Ga0302118_10109684 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1371 | Open in IMG/M |
| 3300031656|Ga0308005_10041415 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1206 | Open in IMG/M |
| 3300032257|Ga0316205_10127497 | All Organisms → Viruses → Predicted Viral | 1028 | Open in IMG/M |
| 3300033742|Ga0314858_109842 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 702 | Open in IMG/M |
| 3300033742|Ga0314858_111445 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 697 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 14.55% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 13.64% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 11.82% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 10.91% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 9.09% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 7.27% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 4.55% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 2.73% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine | 2.73% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 1.82% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.82% |
| Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine Estuarine | 1.82% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.82% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 1.82% |
| Seawater | Environmental → Aquatic → Marine → Gulf → Unclassified → Seawater | 1.82% |
| Marine Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Sediment | 1.82% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 0.91% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 0.91% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 0.91% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.91% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.91% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.91% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.91% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.91% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.91% |
| North Sea | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → North Sea | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2236876004 | Estuarine microbial communities from Columbia River, sample from South Channel ETM site, GS313-0p1-ETM-15m | Environmental | Open in IMG/M |
| 3300000119 | Marine microbial communities from chronically polluted sediments in Antarctica -King George Island site S1 sample ANT 01_9.5m | Environmental | Open in IMG/M |
| 3300000127 | Marine microbial communities from chronically polluted sediments in Adventfjord, Norway - Svalbard Archipelago station 1 sample NOR 05_45m | Environmental | Open in IMG/M |
| 3300000128 | Marine microbial communities from chronically polluted sediments in Adventfjord, Norway : sample - Svalbard Archipelago station 1 sample NOR 08_45m | Environmental | Open in IMG/M |
| 3300000159 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2008 P26 10m | Environmental | Open in IMG/M |
| 3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
| 3300001718 | Marine viral communities from the Pacific Ocean - LP-48 | Environmental | Open in IMG/M |
| 3300001720 | Marine viral communities from the Pacific Ocean - LP-36 | Environmental | Open in IMG/M |
| 3300001853 | Marine viral communities from the Subarctic Pacific Ocean - LP-49 | Environmental | Open in IMG/M |
| 3300005821 | Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 25 cmbsf, PM1 | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006870 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006947 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007625 | Estuarine microbial communities from the Columbia River estuary - metaG 1546B-02 | Environmental | Open in IMG/M |
| 3300008651 | Microbial communities of saline water collected from the North Sea in Germany - HE327_13 | Environmental | Open in IMG/M |
| 3300008995 | Estuarine microbial communities from the Columbia River estuary - metaG 1551A-3 | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009003 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725 | Environmental | Open in IMG/M |
| 3300009024 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705 | Environmental | Open in IMG/M |
| 3300009054 | Estuarine microbial communities from the Columbia River estuary - metaG S.737 | Environmental | Open in IMG/M |
| 3300009055 | Estuarine microbial communities from the Columbia River estuary - metaG 1556B-3 | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009079 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 | Environmental | Open in IMG/M |
| 3300009086 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 | Environmental | Open in IMG/M |
| 3300009136 | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 82 cmbsf | Environmental | Open in IMG/M |
| 3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009436 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome | Environmental | Open in IMG/M |
| 3300009496 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
| 3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
| 3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
| 3300011125 | Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_4, permeate | Environmental | Open in IMG/M |
| 3300011126 | Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, 0.02 | Environmental | Open in IMG/M |
| 3300011256 | Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_4, total | Environmental | Open in IMG/M |
| 3300017737 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 (version 2) | Environmental | Open in IMG/M |
| 3300017749 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 | Environmental | Open in IMG/M |
| 3300017751 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2) | Environmental | Open in IMG/M |
| 3300017762 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18 | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300020185 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1 | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300022061 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v2) | Environmental | Open in IMG/M |
| 3300022063 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022164 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2) | Environmental | Open in IMG/M |
| 3300022178 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3) | Environmental | Open in IMG/M |
| 3300022206 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_24 | Environmental | Open in IMG/M |
| 3300022308 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_24 | Environmental | Open in IMG/M |
| 3300023085 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_5_MG | Environmental | Open in IMG/M |
| 3300023112 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_2_MG | Environmental | Open in IMG/M |
| 3300023210 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MG | Environmental | Open in IMG/M |
| 3300023271 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_1_MG | Environmental | Open in IMG/M |
| 3300023276 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_1_MG | Environmental | Open in IMG/M |
| 3300024259 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_200_MG | Environmental | Open in IMG/M |
| 3300024519 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27 | Environmental | Open in IMG/M |
| 3300024520 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_1 | Environmental | Open in IMG/M |
| 3300024521 (restricted) | Seawater microbial communities from Amundsen Gulf, Northwest Territories, Canada - Cases_109_1 | Environmental | Open in IMG/M |
| 3300024528 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_23 | Environmental | Open in IMG/M |
| 3300025071 | Marine viral communities from the Pacific Ocean - LP-36 (SPAdes) | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025626 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes) | Environmental | Open in IMG/M |
| 3300025641 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506 (SPAdes) | Environmental | Open in IMG/M |
| 3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025767 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_105LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025809 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 (SPAdes) | Environmental | Open in IMG/M |
| 3300025849 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes) | Environmental | Open in IMG/M |
| 3300025873 | Marine viral communities from the Pacific Ocean - ETNP_6_1000 (SPAdes) | Environmental | Open in IMG/M |
| 3300027189 | Estuarine microbial communities from the Columbia River estuary - High salinity metaG S.579 (SPAdes) | Environmental | Open in IMG/M |
| 3300027223 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027571 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 (SPAdes) | Environmental | Open in IMG/M |
| 3300027751 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 (SPAdes) | Environmental | Open in IMG/M |
| 3300027752 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300027753 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 (SPAdes) | Environmental | Open in IMG/M |
| 3300027758 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027820 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027856 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_23 | Environmental | Open in IMG/M |
| 3300027861 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MG | Environmental | Open in IMG/M |
| 3300027868 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_22 | Environmental | Open in IMG/M |
| 3300027978 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.1 (SPAdes) | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300031627 | Marine microbial communities from Western Arctic Ocean, Canada - AG5_33.1 | Environmental | Open in IMG/M |
| 3300031656 | Marine microbial communities from water near the shore, Antarctic Ocean - #67 | Environmental | Open in IMG/M |
| 3300032257 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrite | Environmental | Open in IMG/M |
| 3300033742 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| none_02715922 | 2236876004 | Marine Estuarine | MVMCEWTLADIKNRASNKAFAKQTILKLDIESYKQDLKSGNIGGITHAEAEQVLEG |
| none_03188091 | 2236876004 | Marine Estuarine | MVMCEWTLADVKNRASNKAFAKVTMLKLDIDDYKRSLINGTYGGITYEEAEQVLE |
| KGI_S1_ANT01_95mDRAFT_101526663 | 3300000119 | Marine | MVMCEWTLADVKNRASNKAFAKVTILKLDIEDYKRSLKQGTYGGITYAEAEQVLE |
| SA_S1_NOR05_45mDRAFT_100658004 | 3300000127 | Marine | MVMCEWTLADVKNRASNKAFAKQTILKLDIESYKQELKNGTYGGI |
| SA_S1_NOR08_45mDRAFT_102213421 | 3300000128 | Marine | MVMCEWTLADIKNRASNKAFAKQTILKLDIESYKQELKNGTYGGIT |
| LPaug08P2610mDRAFT_10109021 | 3300000159 | Marine | MVMCEWTLADVKNRASNKAFAKQTILKLDIESYKQELK |
| JGI24005J15628_102062291 | 3300001589 | Marine | MVMCEWTLADIKNRASNKAFAKVTILKLDIESYKQELKNGTYGGITHAEAEQVLEGYK |
| JGI24523J20078_10131321 | 3300001718 | Marine | MVLCEWTLADIKNRASNKAFAKQTILKLDIEDYKQSLKQGTYGGITYEEAE |
| JGI24513J20088_10054931 | 3300001720 | Marine | MVLCEWTLADIKSRASNKAFAKQTILKLDIEDYKRSLKQGTYGGITYEE |
| JGI24524J20080_10205781 | 3300001853 | Marine | MVMCEWTLADIKNRASNKAFAKQTILKLDIEDYKRSLKQGTYGG |
| Ga0078746_10480244 | 3300005821 | Marine Sediment | MVMCEWTLADIKNRASNKAFAKVTILTLDVETYKEDLRTGNIGGVTYE |
| Ga0070749_103783671 | 3300006802 | Aqueous | MVMCEWTLADIKNRASNKAFAKVTILTLDVETYKEDLRTGNIGG |
| Ga0075467_103414934 | 3300006803 | Aqueous | MVMCEWKLADIKNRASNKAFAKVTILTLDIETYKRDL |
| Ga0070754_104051813 | 3300006810 | Aqueous | MVMCEWTLADIKNRASNKAFAKVTILKLDIESYKQELKNGTYG |
| Ga0075479_102538041 | 3300006870 | Aqueous | MVMCEWTLADVKNRASNKAFAKVTMLKLDIDDYKRSLINGTYGGITYEEAEQ |
| Ga0070750_101444151 | 3300006916 | Aqueous | VVMCEWTLADIKNRASNKAFAKVTTLTLDLETYKEDLRTGNIGG |
| Ga0070748_12023971 | 3300006920 | Aqueous | MVMCEWTLADIKNRASNKAFAKVTILTLDIETYKRDLREGS |
| Ga0075444_103459242 | 3300006947 | Marine | MVMCEWTLADIKNRASNKAFAKVTILKLDIEDYKRSLKQGTYGGITYK |
| Ga0070747_11586664 | 3300007276 | Aqueous | MVMCEWTLADIKNRASNKAFAKVTILTLDLETYKEDLRTGNIGGVTYEEFEQ |
| Ga0070745_13178733 | 3300007344 | Aqueous | MVMCEWTLADIKNRASNKAFAKVTILKLDIESYKQELKN |
| Ga0070753_11457391 | 3300007346 | Aqueous | MVMCEWTLADIKNRASNKAFAKVTILTLDVETYKEDLRTGNIGGVTYEEFEQVVKG |
| Ga0099847_11155661 | 3300007540 | Aqueous | MVMCEWTLADIKNRASNKAFAKVTILTLDIETYKRDLREGNI |
| Ga0102870_11648772 | 3300007625 | Estuarine | MVMCEWTLADIKNRASNKAFAKVTILTLDVETYKEDLRTGNIGGVTYEEFEQVVK |
| Ga0103623_10026215 | 3300008651 | North Sea | MCEWTLADIKNRASNKAFAKVTILTLDVETYKEDLRTGNIGGV |
| Ga0102888_11168341 | 3300008995 | Estuarine | MVMCEWTLADIKNRASNKAFAKVTILTLDVETYKEDLRTGNIGGVTYEEFEQV |
| Ga0102963_11226185 | 3300009001 | Pond Water | MVMCKWTLADIKNRASNKAFAKVTILTLDLETYKEDLRRGNIGGITYE |
| Ga0102813_12918911 | 3300009003 | Estuarine | MVMCEWTLADVKNRASNKAFAKVTMLKLDIDDYKRSLI |
| Ga0102811_10724401 | 3300009024 | Estuarine | MVMCEWTLADVKNRASNKAFAKVTILTLDIETYKEDLRTGNIGGVTYEEFEQV |
| Ga0102826_10632063 | 3300009054 | Estuarine | MVMCEWTLADVKNRASNKAFAKVTMLKLDIDDYKRSLINGTYGGITYEEAEQVLEG |
| Ga0102905_11445471 | 3300009055 | Estuarine | MVMCEWTLADIKNRASNKAFAKVTILGLDIEEQKRNLKN |
| Ga0115566_105980313 | 3300009071 | Pelagic Marine | MVMCEWTLADIKNRASNKAFAKVTILGLDIEKQKQDLKNSNIGGITYE |
| Ga0102814_101378844 | 3300009079 | Estuarine | MVMCEWTLADIKNRASNKAFAKVTILGLDIEEQKRNLKNGTYG |
| Ga0102812_103211443 | 3300009086 | Estuarine | MATCEWTLADIKNRASNKAFAKVTILTLDVETYKEDLRTGNIGGV |
| Ga0118735_100244081 | 3300009136 | Marine Sediment | MVMCEWMLADIKNRASNKAFAKQTILKLDIEGYKQELK |
| Ga0118735_103340391 | 3300009136 | Marine Sediment | MVMCEWTLADIKNRASNKAFAKVTVLSLDIETYKEDLRTGNIGGVTYDEFK |
| Ga0114995_107414763 | 3300009172 | Marine | MVMCEWTLADVKNRASNKAFAKQTILKLDIEGYKQELKNGTYGGITHA |
| Ga0114994_106683213 | 3300009420 | Marine | MVMCEWTLADVKNRASNKAFAKVTILALDIETYKQDLREGNIGGVTY |
| Ga0115008_115427381 | 3300009436 | Marine | MVMCEWTLADIKNRASNKAFAKQTILKLDIESYKQELKN |
| Ga0115570_103217103 | 3300009496 | Pelagic Marine | MVMCEWTLADIKNRASNKAFAKVTILTLDVETYKEDLRT |
| Ga0115572_103343244 | 3300009507 | Pelagic Marine | MVMCEWTLADVKNRASNKAFAKVTILTLDVETYKEDLRTGNIGGVTYE |
| Ga0115003_101808695 | 3300009512 | Marine | MVMCEWTLADIKNRASNKAFAKVTILALDIETYKQDLREGNIGGVTYDEFKQ |
| Ga0115003_108933813 | 3300009512 | Marine | MVMCEWTLADIKNRASNKAFAKVTILSLDIEMYKEDLKTGNIGNVTYDEF |
| Ga0118731_1090964811 | 3300010392 | Marine | MVMCEWTLADIKNRASNKAFAKQTILKLDIEGYKQELKNGTYGGITHAEAEQ |
| Ga0118733_1045752094 | 3300010430 | Marine Sediment | MVMCEWTLADIKNRASNKAFAKVTILKLDIEDYKRSLING |
| Ga0151663_10284961 | 3300011125 | Marine | MAMCEWTLADVKNRASNKAFAKVTILTLDVETYKEDLRTGNIGGVTYAEFEQLEKGYE |
| Ga0151654_10388524 | 3300011126 | Marine | MAMCEWTLADVKNRASNKAFAKVTILGLDIERQKQDLKNGNNGGIK* |
| Ga0151664_12065371 | 3300011256 | Marine | MVMCEWTLADVKNRASNKAFAKVTMLKLDIDDYKRSLINGTYGGF |
| Ga0187218_10486644 | 3300017737 | Seawater | MVMCEWTLADIKNRASNKAFAKVTILKLDIEDYKRSLINETYGGITYEEAEQ |
| Ga0181392_10808964 | 3300017749 | Seawater | MVMCEWTLADVKNRASNKAFAKVTMLKLDINDYKRSLINGTYGGITYEEAEQVLEGYK |
| Ga0181392_11849463 | 3300017749 | Seawater | MVMCEWTLADVKNRASNKAFAKVTMLKLDIDDYKRSLIDGTYGGIT |
| Ga0187219_12260973 | 3300017751 | Seawater | MVMCEWTLADVKNRASNKAFAKVTMLKLDIDDYKRSLIDGTYGGITYEE |
| Ga0181422_10128201 | 3300017762 | Seawater | MVMCEWTLADVKNRASNKAFAKVTMLKLDIDDYKRSLIDGTYGGI |
| Ga0181380_10263499 | 3300017782 | Seawater | MVMCEWTLADVKNRASNKAFAKVTMLKLDIDDYKRSLIDGTYGGITYE |
| Ga0181424_104296543 | 3300017786 | Seawater | MVMCEWALADVKNRASNKAFAKVTMLKLDIDDYKRSLIDGTYGGITY |
| Ga0206131_100979415 | 3300020185 | Seawater | MAMCEWTLADIKNRASNKAFAKVTILTLDVETYKEDLRTGNIGGVTYE |
| Ga0211576_103242243 | 3300020438 | Marine | MVMCEWTLADVKNRASNKAFAKVTMLKLDINDYKRSLINGTYGGITYEEAEQ |
| Ga0222718_105863973 | 3300021958 | Estuarine Water | MVMCEWTLADIKNRASNKAFAKVTTLTLDVETYKEDLRTGNIGGVTYEEFEQVVK |
| Ga0212023_10566501 | 3300022061 | Aqueous | MVMCEWTLADIKNRASNKAFAKVTILTLDIETYKRDLREGNIGGVTYEEFEQVLEGYE |
| Ga0212029_10288151 | 3300022063 | Aqueous | MLIREWKLADIKNRASNKAFAKVTILTLDIETYKRDLRQGNIGGVTYE |
| Ga0212022_10573851 | 3300022164 | Aqueous | MLIREWKLADIKNRASNKAFAKVTILTLDIETYKRDLREGNIGGVTYEEFEQVLDS |
| Ga0196887_10124251 | 3300022178 | Aqueous | MVMCEWTLADIKNRASNKAFAKVTILTLDIETYKRDLREGNIGGVTYE |
| Ga0224499_101722641 | 3300022206 | Sediment | MVMCEWTLADIKNRASNKAFAKVTILGLDIEEQRRNLKNGNIGGVTYEEA |
| Ga0224504_102341791 | 3300022308 | Sediment | MVMCEWTLADIKNRASNKAFAKVTMLKLDIDDYKRSLI |
| (restricted) Ga0233406_100845423 | 3300023085 | Seawater | MVMCEWTLADVKNRASNKAFAKVTMLKLDIDDYKRSLINGT |
| (restricted) Ga0233411_100600671 | 3300023112 | Seawater | MVMCEWTLADIKNRASNKAFAKVTILTLDVETYKEDL |
| (restricted) Ga0233412_101114773 | 3300023210 | Seawater | MVMCEWTLADIKNRASNKAFAKVTILTLDVETYKEDLRTGNIGGV |
| (restricted) Ga0233403_100399231 | 3300023271 | Seawater | MAMCEWTLADIKNRASNKAFAKVTILTLDVETYKEDLRTGNIGGVTYEEFEQVVK |
| (restricted) Ga0233410_102163694 | 3300023276 | Seawater | MVMCEWTLADIKNRASNKAFAKVTILTLDVETYKE |
| (restricted) Ga0233437_11045514 | 3300024259 | Seawater | MVMCEWTLADIKNRASNKAFAKQTILKLDIESYKQDLKSGNIGGITHAEAEQVLE |
| (restricted) Ga0255046_100601221 | 3300024519 | Seawater | MVMCEWTLADIKNRASNKAFAKVTTLTLDVETYKEDLRTGNIGGVTYEEFEQVVKGYE |
| (restricted) Ga0255046_102015011 | 3300024519 | Seawater | MVMCEWTLADIKNRASNKAFAKVTILALDIEMYEEDLRT |
| (restricted) Ga0255047_103820173 | 3300024520 | Seawater | MVMCEWTLADIKNRASNKAFAKQTILKLDIEDYKRSLINGTYGGITYEEAEQVLDSYK |
| (restricted) Ga0255056_102970373 | 3300024521 | Seawater | MVMCEWTLADVKNRASNKAFAKQTILKLDIEGYKQELK |
| (restricted) Ga0255056_103076583 | 3300024521 | Seawater | MVMCEWTLADIKNRASNKAFAKQTILKLDIEGYKQELKNGT |
| (restricted) Ga0255045_101010075 | 3300024528 | Seawater | MVMCEWTLADIKNRASNKAFAKVTILTLDVETYKEDLRTGN |
| Ga0207896_10712143 | 3300025071 | Marine | MVLCEWTLADIKNRASNKAFAKQTILKLDIEDYKQSLKQGTY |
| Ga0209336_101365991 | 3300025137 | Marine | MVMCEWTLADVKNRASNKAFAKVTMLKLDIDDYKRSLVNGT |
| Ga0209336_101893491 | 3300025137 | Marine | MAMCEWTLADIKNRASNKAFAKVTILKLDIESYKEELKNGTYGGITHAEAEQ |
| Ga0209716_10396321 | 3300025626 | Pelagic Marine | MVMCEWTLVDIKNRASNKAFAKVTILGLDIEKQKQDLKNGNIGGITYGEA |
| Ga0209716_11085821 | 3300025626 | Pelagic Marine | MVMCEWTLADIKNRASNKAFAKVTILGLDIEKQKQDLKNSNIGGITYEEAEQVLEGY |
| Ga0209833_11895703 | 3300025641 | Pelagic Marine | MVMCEWTLVDIKNRASNKAFAKVTILGLDIEKQKQDLKNG |
| Ga0208160_11201311 | 3300025647 | Aqueous | MVMCEWTLADIKNRASNKAFAKVTILTLDIETYKEDLRTGNIGGVTYEEFEQVLEGY |
| Ga0209137_11858261 | 3300025767 | Marine | MAMCEWTLADIKNRASNKAFAKVTILTLDVETYKEDLRT |
| Ga0209137_12313903 | 3300025767 | Marine | MVTCELTLADIKNRASNKAFAKVTILTLDIETYEEDLRTGNIGGVTYE |
| Ga0208767_11488224 | 3300025769 | Aqueous | VVMCEWTLADIKNRASNKAFAKVTILTLDLETYKEDLRTGNIGGVT |
| Ga0209199_10293531 | 3300025809 | Pelagic Marine | MVMCEWTLADIKNRASNKAFAKVTILTLDVETYKED |
| Ga0209603_11315391 | 3300025849 | Pelagic Marine | MVMCEWTLADIKNRASNKAFAKQTILKLDIESYKQELKNGTYGGITH |
| Ga0209757_100619771 | 3300025873 | Marine | MAMCEWTLADIKNRASNKAFAKVTILTLDIETYKEDL |
| Ga0208675_10225671 | 3300027189 | Estuarine | MVMCEWTLADVKNRASNKAFAKVTMLKLDIDDYKRSLIDGT |
| Ga0208169_10471441 | 3300027223 | Estuarine | MVMCEWTLADIKNRASNKAFAKVTILTLDIETYKQDLRT |
| Ga0208897_11775283 | 3300027571 | Estuarine | MVMCEWTLADIKNRASNKAFAKVTILNLDVETYKEDLRTGNIGGVTYEEFEQVLE |
| Ga0208304_102595053 | 3300027751 | Estuarine | MVMCEWTLADIKNRASNKAFAKVTILTLDIETYEEDLRTGNI |
| Ga0208304_103449201 | 3300027751 | Estuarine | MVMCEWTLADIKNRASNKAFAKVTILTLDVETYKEDLRTGNIGGVTY |
| Ga0209192_101239511 | 3300027752 | Marine | MVMCEWTLADVKNRASNKAFAKQTILKLDIEGYKQELKNG |
| Ga0208305_101343244 | 3300027753 | Estuarine | MVMCEWTLADIKNRASNKAFAKVTILTLDIETHEEDLRTGNIGGVTYEEF |
| Ga0209379_101584331 | 3300027758 | Marine Sediment | MVMCEWTLADVKNRASNKAFAKQTILKLDIESYKQELKNGTYG |
| Ga0209578_103806211 | 3300027820 | Marine Sediment | MVMCEWTLADVKNRASNKAFAKQTILKLDIEGYKQELKNGTYG |
| (restricted) Ga0255054_101539674 | 3300027856 | Seawater | MVMCEWTLADIKNRASNKAFAKQTILKLDIESYKQDLKSGNIGGITHAEAEQVLEGYKT |
| (restricted) Ga0255054_106657293 | 3300027856 | Seawater | MAMCEWTLADIKNRASNKAFAKVTILTLDVETYKEDLRTGNIG |
| (restricted) Ga0233415_100918584 | 3300027861 | Seawater | MVMCEWTLADIKNRASNKAFAKVTILSLDIEMYKEDLKTGNIGNVTYD |
| (restricted) Ga0233415_101418901 | 3300027861 | Seawater | MVMCEWTLADIKNRASNKAFAKQTILKLDIESYKQDLKSGNIGGIT |
| (restricted) Ga0255053_106162223 | 3300027868 | Seawater | MVMCEWTLADIKNRASNKAFAKQTILKLDIESYKQDLKSGN |
| Ga0209165_101758354 | 3300027978 | Marine Sediment | MVMCEWTLADIKNRASNKAFAKVTILTLDVETYKEDLRTGNIGGVT |
| Ga0307488_108074891 | 3300031519 | Sackhole Brine | MAMCEWTLADIKNRASSKAFAKQTILKLDIEDYKRSLKQGTYGGITYEEAEQVLDGYK |
| Ga0307376_103392653 | 3300031578 | Soil | MVMCEWTLADIKNRASNKAFAKVTILGLDIERQKRDLKNGNIGGITYEEAEQVLEGY |
| Ga0302118_101096841 | 3300031627 | Marine | MVMCEWTLADIKNRASSKAFAKQTILKLDIEDYKR |
| Ga0308005_100414154 | 3300031656 | Marine | MVMCEWALADIKNRASSKAFAKVTILKLDIEDYKRSLKNKTYGGITYEEAEQVLD |
| Ga0316205_101274971 | 3300032257 | Microbial Mat | MAMCEWTLADIKNRASNKAFAKVTILGLDIEEQKRNLKNGTYGGITHAEA |
| Ga0314858_109842_3_167 | 3300033742 | Sea-Ice Brine | MVMCEWTLADVKNRASNKAFAKQTILKLDIESYKQELKNGTYGGITHAEAEQVLE |
| Ga0314858_111445_2_127 | 3300033742 | Sea-Ice Brine | MVMCEWTLADIKNRASNKAFAKQTILKLDIEGYKQELKNGTY |
| ⦗Top⦘ |