Basic Information | |
---|---|
Family ID | F085182 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 111 |
Average Sequence Length | 40 residues |
Representative Sequence | GAMIAGALRFVLEGRETAPKAHIEGHAAEESPDSKGRDGG |
Number of Associated Samples | 102 |
Number of Associated Scaffolds | 110 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 2.70 % |
% of genes near scaffold ends (potentially truncated) | 100.00 % |
% of genes from short scaffolds (< 2000 bps) | 100.00 % |
Associated GOLD sequencing projects | 102 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.26 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (78.378 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (43.243 % of family members) |
Environment Ontology (ENVO) | Unclassified (24.324 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (58.559 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 23.53% β-sheet: 0.00% Coil/Unstructured: 76.47% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.26 |
Powered by PDBe Molstar |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 78.38 % |
Unclassified | root | N/A | 21.62 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300004099|Ga0058900_1013358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus jostii → Rhodococcus jostii RHA1 | 513 | Open in IMG/M |
3300004120|Ga0058901_1004792 | Not Available | 671 | Open in IMG/M |
3300004135|Ga0058884_1008368 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 520 | Open in IMG/M |
3300004605|Ga0068952_1314309 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 526 | Open in IMG/M |
3300004609|Ga0068958_1008837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → unclassified Actinoplanes → Actinoplanes sp. OR16 | 512 | Open in IMG/M |
3300004609|Ga0068958_1012445 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 522 | Open in IMG/M |
3300004620|Ga0068957_1044075 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 514 | Open in IMG/M |
3300007327|Ga0075016_1435679 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 505 | Open in IMG/M |
3300010154|Ga0127503_10753459 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 509 | Open in IMG/M |
3300010154|Ga0127503_10912111 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 520 | Open in IMG/M |
3300010855|Ga0126355_1047052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → environmental samples → uncultured delta proteobacterium | 524 | Open in IMG/M |
3300010857|Ga0126354_1172181 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300010859|Ga0126352_1263264 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Gimesia → Gimesia maris → Gimesia maris DSM 8797 | 516 | Open in IMG/M |
3300010860|Ga0126351_1276732 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Gimesia → Gimesia maris → Gimesia maris DSM 8797 | 529 | Open in IMG/M |
3300010862|Ga0126348_1310179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 532 | Open in IMG/M |
3300010866|Ga0126344_1025306 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 520 | Open in IMG/M |
3300011032|Ga0138546_135626 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300011046|Ga0138600_117407 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 525 | Open in IMG/M |
3300011053|Ga0138531_121910 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 516 | Open in IMG/M |
3300011068|Ga0138599_1071036 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Gimesia → Gimesia maris → Gimesia maris DSM 8797 | 612 | Open in IMG/M |
3300011070|Ga0138567_1048535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → environmental samples → uncultured delta proteobacterium | 526 | Open in IMG/M |
3300011087|Ga0138570_1145306 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Gimesia → Gimesia maris → Gimesia maris DSM 8797 | 513 | Open in IMG/M |
3300011120|Ga0150983_16395057 | Not Available | 538 | Open in IMG/M |
3300012379|Ga0134058_1156915 | Not Available | 534 | Open in IMG/M |
3300012382|Ga0134038_1216438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 524 | Open in IMG/M |
3300016698|Ga0181503_1260593 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Gimesia → Gimesia maris → Gimesia maris DSM 8797 | 579 | Open in IMG/M |
3300016702|Ga0181511_1499501 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Gimesia → Gimesia maris → Gimesia maris DSM 8797 | 512 | Open in IMG/M |
3300016728|Ga0181500_1541500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → environmental samples → uncultured delta proteobacterium | 533 | Open in IMG/M |
3300016750|Ga0181505_10917972 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Gimesia → Gimesia maris → Gimesia maris DSM 8797 | 528 | Open in IMG/M |
3300019155|Ga0184568_113911 | Not Available | 517 | Open in IMG/M |
3300019161|Ga0184602_127447 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 508 | Open in IMG/M |
3300019162|Ga0184597_102400 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → environmental samples → uncultured delta proteobacterium | 535 | Open in IMG/M |
3300019165|Ga0184589_100337 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Gimesia → Gimesia maris → Gimesia maris DSM 8797 | 525 | Open in IMG/M |
3300019165|Ga0184589_112157 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 523 | Open in IMG/M |
3300019166|Ga0184595_113887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → environmental samples → uncultured delta proteobacterium | 615 | Open in IMG/M |
3300019176|Ga0184596_118287 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 519 | Open in IMG/M |
3300019178|Ga0184583_121645 | Not Available | 524 | Open in IMG/M |
3300019186|Ga0184588_136344 | Not Available | 518 | Open in IMG/M |
3300019190|Ga0184600_141922 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Gimesia → Gimesia maris → Gimesia maris DSM 8797 | 531 | Open in IMG/M |
3300019194|Ga0184586_151459 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → environmental samples → uncultured delta proteobacterium | 529 | Open in IMG/M |
3300019230|Ga0181501_1340298 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Gimesia → Gimesia maris → Gimesia maris DSM 8797 | 532 | Open in IMG/M |
3300019240|Ga0181510_1179000 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Gimesia → Gimesia maris → Gimesia maris DSM 8797 | 526 | Open in IMG/M |
3300019245|Ga0187791_1128147 | Not Available | 525 | Open in IMG/M |
3300019255|Ga0184643_1088045 | Not Available | 531 | Open in IMG/M |
3300019258|Ga0181504_1014086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → environmental samples → uncultured delta proteobacterium | 540 | Open in IMG/M |
3300019260|Ga0181506_1419783 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Gimesia → Gimesia maris → Gimesia maris DSM 8797 | 529 | Open in IMG/M |
3300019270|Ga0181512_1500250 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Gimesia → Gimesia maris → Gimesia maris DSM 8797 | 527 | Open in IMG/M |
3300021857|Ga0213849_1028722 | Not Available | 525 | Open in IMG/M |
3300021860|Ga0213851_1097982 | Not Available | 533 | Open in IMG/M |
3300021909|Ga0213846_1055085 | Not Available | 510 | Open in IMG/M |
3300021929|Ga0213845_1131771 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
3300022499|Ga0242641_1043357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → environmental samples → uncultured delta proteobacterium | 528 | Open in IMG/M |
3300022501|Ga0242645_1028081 | Not Available | 526 | Open in IMG/M |
3300022503|Ga0242650_1025344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → environmental samples → uncultured delta proteobacterium | 514 | Open in IMG/M |
3300022511|Ga0242651_1047753 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus jostii → Rhodococcus jostii RHA1 | 523 | Open in IMG/M |
3300022512|Ga0242676_1023957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → environmental samples → uncultured delta proteobacterium | 652 | Open in IMG/M |
3300022513|Ga0242667_1051910 | Not Available | 524 | Open in IMG/M |
3300022522|Ga0242659_1123669 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Gimesia → Gimesia maris → Gimesia maris DSM 8797 | 530 | Open in IMG/M |
3300022523|Ga0242663_1036197 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Gimesia → Gimesia maris → Gimesia maris DSM 8797 | 819 | Open in IMG/M |
3300022529|Ga0242668_1037039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Hafniaceae → Edwardsiella → Edwardsiella piscicida | 821 | Open in IMG/M |
3300022529|Ga0242668_1126684 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 543 | Open in IMG/M |
3300022531|Ga0242660_1240318 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 513 | Open in IMG/M |
3300022533|Ga0242662_10311015 | Not Available | 528 | Open in IMG/M |
3300022713|Ga0242677_1070104 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Gimesia → Gimesia maris → Gimesia maris DSM 8797 | 549 | Open in IMG/M |
3300022715|Ga0242678_1057099 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Gimesia → Gimesia maris → Gimesia maris DSM 8797 | 578 | Open in IMG/M |
3300022717|Ga0242661_1144662 | Not Available | 529 | Open in IMG/M |
3300022720|Ga0242672_1042128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → environmental samples → uncultured delta proteobacterium | 739 | Open in IMG/M |
3300022722|Ga0242657_1136121 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Gimesia → Gimesia maris → Gimesia maris DSM 8797 | 636 | Open in IMG/M |
3300022724|Ga0242665_10357233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 524 | Open in IMG/M |
3300022724|Ga0242665_10380320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → environmental samples → uncultured delta proteobacterium | 512 | Open in IMG/M |
3300023551|Ga0247546_101931 | Not Available | 742 | Open in IMG/M |
3300023662|Ga0247545_103386 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Gimesia → Gimesia maris → Gimesia maris DSM 8797 | 619 | Open in IMG/M |
3300023662|Ga0247545_103386 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Gimesia → Gimesia maris → Gimesia maris DSM 8797 | 619 | Open in IMG/M |
3300023672|Ga0247553_110899 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 526 | Open in IMG/M |
3300023675|Ga0247533_105667 | Not Available | 524 | Open in IMG/M |
3300029701|Ga0222748_1120179 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 529 | Open in IMG/M |
3300030730|Ga0307482_1278886 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Gimesia → Gimesia maris → Gimesia maris DSM 8797 | 532 | Open in IMG/M |
3300030759|Ga0265745_1028703 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Gimesia → Gimesia maris → Gimesia maris DSM 8797 | 526 | Open in IMG/M |
3300030762|Ga0265775_114350 | Not Available | 525 | Open in IMG/M |
3300030805|Ga0265756_116573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → environmental samples → uncultured delta proteobacterium | 517 | Open in IMG/M |
3300030816|Ga0265729_104399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → environmental samples → uncultured delta proteobacterium | 530 | Open in IMG/M |
3300030824|Ga0265726_106197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → environmental samples → uncultured delta proteobacterium | 528 | Open in IMG/M |
3300030832|Ga0265752_109316 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 521 | Open in IMG/M |
3300030834|Ga0265738_101838 | Not Available | 791 | Open in IMG/M |
3300030874|Ga0265742_1015910 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Gimesia → Gimesia maris → Gimesia maris DSM 8797 | 610 | Open in IMG/M |
3300030877|Ga0265777_119225 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 556 | Open in IMG/M |
3300030877|Ga0265777_122020 | Not Available | 531 | Open in IMG/M |
3300030884|Ga0265758_108977 | Not Available | 520 | Open in IMG/M |
3300030885|Ga0265743_118602 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Gimesia → Gimesia maris → Gimesia maris DSM 8797 | 533 | Open in IMG/M |
3300030888|Ga0265769_110881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → environmental samples → uncultured delta proteobacterium | 627 | Open in IMG/M |
3300030888|Ga0265769_114104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum → Azospirillum brasilense | 583 | Open in IMG/M |
3300030913|Ga0265759_110255 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → unclassified Actinoplanes → Actinoplanes sp. OR16 | 530 | Open in IMG/M |
3300030940|Ga0265740_1031799 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 589 | Open in IMG/M |
3300030942|Ga0247549_104808 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Gimesia → Gimesia maris → Gimesia maris DSM 8797 | 530 | Open in IMG/M |
3300030990|Ga0308178_1093053 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Gimesia → Gimesia maris → Gimesia maris DSM 8797 | 630 | Open in IMG/M |
3300031017|Ga0265744_115717 | Not Available | 509 | Open in IMG/M |
3300031018|Ga0265773_1041365 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 528 | Open in IMG/M |
3300031024|Ga0265724_102612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → environmental samples → uncultured delta proteobacterium | 613 | Open in IMG/M |
3300031042|Ga0265749_102983 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Gimesia → Gimesia maris → Gimesia maris DSM 8797 | 588 | Open in IMG/M |
3300031099|Ga0308181_1163811 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Gimesia → Gimesia maris → Gimesia maris DSM 8797 | 529 | Open in IMG/M |
3300031114|Ga0308187_10438359 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Gimesia → Gimesia maris → Gimesia maris DSM 8797 | 524 | Open in IMG/M |
3300031128|Ga0170823_13611218 | Not Available | 517 | Open in IMG/M |
3300031128|Ga0170823_17654655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → environmental samples → uncultured delta proteobacterium | 740 | Open in IMG/M |
3300031421|Ga0308194_10245054 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Gimesia → Gimesia maris → Gimesia maris DSM 8797 | 599 | Open in IMG/M |
3300031592|Ga0310117_131351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → environmental samples → uncultured delta proteobacterium | 514 | Open in IMG/M |
3300031636|Ga0310113_129846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → environmental samples → uncultured delta proteobacterium | 531 | Open in IMG/M |
3300031826|Ga0316031_111510 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Gimesia → Gimesia maris → Gimesia maris DSM 8797 | 562 | Open in IMG/M |
3300031827|Ga0247532_104627 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Gimesia → Gimesia maris → Gimesia maris DSM 8797 | 523 | Open in IMG/M |
3300031866|Ga0316049_122750 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Rubripirellula → Rubripirellula amarantea | 516 | Open in IMG/M |
3300031956|Ga0316032_108420 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 529 | Open in IMG/M |
3300032072|Ga0326631_116208 | Not Available | 533 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 43.24% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.02% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 9.01% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 8.11% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 5.41% |
Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 4.50% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.60% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 1.80% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.80% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.80% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.90% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.90% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.90% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300004099 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF236 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004120 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF238 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004135 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF204 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004605 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 40 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004609 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 50 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004620 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 49 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300007327 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaT_ABR_2013 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010855 | Boreal forest soil eukaryotic communities from Alaska, USA - W1-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010857 | Boreal forest soil eukaryotic communities from Alaska, USA - W1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010859 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010860 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010862 | Boreal forest soil eukaryotic communities from Alaska, USA - C4-4 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010866 | Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011032 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 27 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011046 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 68 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011053 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 9 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011068 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 67 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011070 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 52 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011087 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 55 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300012379 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012382 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300016698 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300016702 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300016728 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019155 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLI1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019161 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZA2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019162 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019165 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSA1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019166 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019176 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019178 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019186 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSE3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019190 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZE3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019194 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSE1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019230 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019240 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019245 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019255 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019258 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019260 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019270 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021857 | Metatranscriptome of freshwater microbial communities from pre-fracked creek in Pennsylvania, United States - WE:C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021860 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021909 | Metatranscriptome of freshwater microbial communities from post-fracked creek in Pennsylvania, United States - NH:C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021929 | Metatranscriptome of freshwater microbial communities from pre-fracked creek in Pennsylvania, United States - DR:C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022499 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022501 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022503 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022511 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022512 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022513 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022522 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022523 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022529 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022713 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022715 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022717 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022720 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300023551 | Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSA4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300023662 | Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300023672 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300023675 | Metatranscriptome of spruce litter microbial communities from Bohemian Forest, Czech Republic - CLI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029701 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030759 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030762 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030805 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030816 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLU6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030824 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLU2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030832 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030834 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLA5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030874 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030877 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030884 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSA5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030885 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030888 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030913 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSA6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030940 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030942 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030990 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031017 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031024 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLI6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031042 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031099 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031592 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031636 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031826 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLI3 metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300031827 | Metatranscriptome of spruce litter microbial communities from Bohemian Forest, Czech Republic - CLI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031866 | Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300031956 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU1 metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300032072 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSI2 metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0058900_10133581 | 3300004099 | Forest Soil | AGAMIAGALRFVLEGRETAPKAHIEGHAAEESPDSKGRDGG* |
Ga0058901_10047921 | 3300004120 | Forest Soil | AGAMIAAALRFVLEGRETAPKAHIEGHAAEESPDSKGRDGG* |
Ga0058884_10083681 | 3300004135 | Forest Soil | GAMIAGALRFVLEGRETAPKAHIEGHAAEESPDSKGRDGG* |
Ga0068952_13143092 | 3300004605 | Peatlands Soil | AGAMIAGALRFVLQGRETAAKAHIEGHATEESPDSKGRDGG* |
Ga0068958_10088371 | 3300004609 | Peatlands Soil | VAGAMIAGALRFELQGRETAPSAHIEGHAAEESPDSKGRDGG* |
Ga0068958_10124451 | 3300004609 | Peatlands Soil | VAGAMIAGALRFVLQGRETAAKAHIEGHATEESPDSKGRDGG* |
Ga0068957_10440751 | 3300004620 | Peatlands Soil | AGAMIAGALRFVLEGRETAPKAHIEGHAAEESPDSRGRDGG* |
Ga0075016_14356791 | 3300007327 | Watersheds | ALRFVLQGRETAPKAHIEGHAAEESPDSKGRDGG* |
Ga0127503_107534591 | 3300010154 | Soil | AGAMIAGALRFVLEGLETAPKARIEGHAAEESPDSRGRDGG* |
Ga0127503_109121111 | 3300010154 | Soil | AMIAGALRFVLEGLATAPKAHIEGHAAEESPDSIGRDGG* |
Ga0126355_10470521 | 3300010855 | Boreal Forest Soil | MIAGALRFVLEGWETAPKAHIEGHAAEESPDSRGRDGG* |
Ga0126354_11721811 | 3300010857 | Boreal Forest Soil | MIAGALRFVLRGRETAPKAHIEGLAAEESPDSRGRDGG* |
Ga0126352_12632641 | 3300010859 | Boreal Forest Soil | VAGAMIAGALRCVLQGRVTAPKAQIEGHAAEESPDSEGRDGG* |
Ga0126351_12767321 | 3300010860 | Boreal Forest Soil | GAMIAGALRCVLQGRVTAPKAQIEGHAAEESPDSEGRDGG* |
Ga0126348_13101791 | 3300010862 | Boreal Forest Soil | GAMIAVALRFVLRVRETAPKAHIEGHAAEESPDSEGRDGG* |
Ga0126344_10253061 | 3300010866 | Boreal Forest Soil | AMIAGALRFVLEGRETAPKAHIEGHAAEESPDSRGRDGG* |
Ga0138546_1356261 | 3300011032 | Peatlands Soil | VAGAMIAEALRFVLQGRETAAKAHIEGHAAEESPDSRGRDGG* |
Ga0138600_1174071 | 3300011046 | Peatlands Soil | AGAMIAGALRFVLQGRETAPSAHIEGHATEESPDSKGLDGG* |
Ga0138531_1219101 | 3300011053 | Peatlands Soil | VAGAMIAGALRFVLEGRETAPKAHIEGHATEESPDSKGLDGG* |
Ga0138599_10710361 | 3300011068 | Peatlands Soil | GAMIAGALRFVLQGRETAAKAHIEGHATEESPDSKGRDGG* |
Ga0138567_10485351 | 3300011070 | Peatlands Soil | MIAGALRLALHGRETAPKAQIEGHAAEESPDSEGRDGG* |
Ga0138570_11453061 | 3300011087 | Peatlands Soil | ALRFVLQGRETAAKAHIEGHAAEESPDSRGRDGG* |
Ga0150983_163950571 | 3300011120 | Forest Soil | FVAGAMIAGALQFVLEGRETAPKAHIEGHAAEESPDSKGRDGG* |
Ga0134058_11569151 | 3300012379 | Grasslands Soil | GAMIAGALRFVLKGRETAPKAHIEGHAAEESPDSRGRGGG* |
Ga0134038_12164381 | 3300012382 | Grasslands Soil | AMIAGALRFVLKGRETAPKAHIEGHAAEESPDSRGRGGG* |
Ga0181503_12605931 | 3300016698 | Peatland | AMIAGALRSVLQGRETAPKAQVEGHAAEESPDSKGRDGG |
Ga0181511_14995011 | 3300016702 | Peatland | AGAMIAGALRFVLQGRETAPKAHIEGHAAEESPDSEGRDGG |
Ga0181500_15415002 | 3300016728 | Peatland | AGAMIAGALRCVLQERETAPKAHVEGHAAEESPDSKGRDGG |
Ga0181505_109179721 | 3300016750 | Peatland | GAMIAGALRFVLQGRETAPKAHIEGHAAEESPDSEGRDGG |
Ga0184568_1139111 | 3300019155 | Soil | AGAMIAGALRCVLQGRETAPKAQVEGHAAEESPDSEGRDGG |
Ga0184602_1274471 | 3300019161 | Soil | AMIAGALRFVLQGRETALSAHIEGRAAEESPDSKGRDGG |
Ga0184597_1024001 | 3300019162 | Soil | VAGAMIAGALRFALHGRATAPKAHIEGHAAEESPDSKGRDGG |
Ga0184589_1003371 | 3300019165 | Soil | AMIAGALRCVLGGWETAPKAHIEGNAAEESPDSKGRDGG |
Ga0184589_1121571 | 3300019165 | Soil | IAGALRFVLQGWETCSEAHLEGLASEESPDSKGRDGG |
Ga0184595_1138871 | 3300019166 | Soil | MIAGALRSVLGGWETTPKAHIEGNAAEESPDSKGRDGG |
Ga0184596_1182871 | 3300019176 | Soil | AMIAGALRFVLQGRETAPTAHIEGHAAEESPDSKGRDGG |
Ga0184583_1216451 | 3300019178 | Soil | GAMIAGALRCVLGGWETAAKAHSEGNAAEESPDSKGRDGG |
Ga0184588_1363441 | 3300019186 | Soil | AGAMIAGALRCVLQGRATAPKAHLEGHAAEESPDSEGRDGG |
Ga0184600_1419221 | 3300019190 | Soil | VAGAMIAGALRCVLGGWETAPKAHIEGNAAEESPDSKGRDGG |
Ga0184586_1514591 | 3300019194 | Soil | GAMIAGALRFALHGRATAPKAHIEGHAAEESPDSKGRDGG |
Ga0181501_13402981 | 3300019230 | Peatland | AGAMIAGALRSVLQGRETAPKAQVEGHAAEESPDSKGRDGG |
Ga0181510_11790001 | 3300019240 | Peatland | GAMIAAALRFVLEGRETAPKAHIEGHSAEESPDSEGRDGG |
Ga0187791_11281471 | 3300019245 | Peatland | AMIAGALRFVLEGREIAPTAQIEGHAAEESPDSAGRDGG |
Ga0184643_10880451 | 3300019255 | Groundwater Sediment | GAMIAGALCFVLQGRATAPTAHIEGHAAEESPDSEGRDGG |
Ga0181504_10140862 | 3300019258 | Peatland | VAGAMIAGALRCVLQERETAPKAHVEGHAAEESPDSKGRDGG |
Ga0181506_14197831 | 3300019260 | Peatland | AGAMIAAALRFVLEGRETAPKAHIEGHSAEESPDSEGRDGG |
Ga0181512_15002501 | 3300019270 | Peatland | AGAMIAAALRFVLEGRETAPKAHIEGHAAEESPDSEGRDGG |
Ga0213849_10287221 | 3300021857 | Watersheds | MIAGALRFVLEGRETAPKAHIERHAAEESPDSGGRDGG |
Ga0213851_10979821 | 3300021860 | Watersheds | AMIAGALRFGLQEWATAPVAHIEGHAAEESPDSKGRDGG |
Ga0213846_10550851 | 3300021909 | Watersheds | AGALRFVLQGRETASKAQIEGHAAEESPDSKGRDGG |
Ga0213845_11317711 | 3300021929 | Watersheds | AGAMIAGALRFVLEGRETAPKAHIEGHAAEESPDSKGRDGG |
Ga0242641_10433571 | 3300022499 | Soil | GAMIAAALRFVLEGRETAPKAYIEGHAAEESPDSKGRDGG |
Ga0242645_10280811 | 3300022501 | Soil | AGAMIAGALRFVLEGRETAPKAYIEGHAAEESPDSRGRDGG |
Ga0242650_10253441 | 3300022503 | Soil | AAALRFVLEGRETAPKAYIEGHAAEESPDSKVRDGG |
Ga0242651_10477531 | 3300022511 | Soil | AGAMIAGALRFVLAGRETAPKAHIEGYATEESPDSIGRDGG |
Ga0242676_10239571 | 3300022512 | Soil | AMIAAALRFVLEGRETAPKAYIEGHAAEESPDSKGRDGG |
Ga0242667_10519101 | 3300022513 | Soil | GAMIAGALRFVLQGWATVPTAHIEGHAAEESPDSKGRDGG |
Ga0242659_11236691 | 3300022522 | Soil | AMIAEALRCVLQGRETAPKAQVEGHAAEESPDSEGRDGG |
Ga0242663_10361971 | 3300022523 | Soil | RPWKRSMRSSTESVAGAMIAGALPCVLGGWETAPTAHIEGNAAEESPDSEGRDGG |
Ga0242668_10370391 | 3300022529 | Soil | AGALRFVLEGRETAPKAYIEGHAAEESPDSEGRDGG |
Ga0242668_11266841 | 3300022529 | Soil | MRSSTESVAGAMIAGALRCVLGGWETTPKAHIEGNAAEESP |
Ga0242660_12403181 | 3300022531 | Soil | GALRFVLEGRETAPKAHIEGHATEESPDSIGRDGG |
Ga0242662_103110151 | 3300022533 | Soil | AGAMIAGALRFVIQGRETCFDAHIEGHATGESTGSEGRDGG |
Ga0242677_10701041 | 3300022713 | Soil | AGAMIAEALRFVLEGRETAPKAHIEGHAAEESPDSEGRDGG |
Ga0242678_10570991 | 3300022715 | Soil | AMIAGALGFVLQGRETAPAVHIEGHAAEESPDSAGRDGG |
Ga0242661_11446621 | 3300022717 | Soil | GAMIAGALRFALHGRETAPKAHIEGHAAEESPDSEGRDGG |
Ga0242672_10421281 | 3300022720 | Soil | AGAMIAGALRSVLGGWETAPRAQVEGNAAEESPDSKGRDGG |
Ga0242657_11361211 | 3300022722 | Soil | MRSSTESVAGAMIAGALRCVLGGWETSPKAHIEGNAAEESPDSKGR |
Ga0242665_103572331 | 3300022724 | Soil | AGAMIAGALRFALHGRETAPKAYIEGHAAEESPDSEGRDGG |
Ga0242665_103803201 | 3300022724 | Soil | AGAMIAGALRFVLEGRENAPKAHIEGHAAEESPDSKGRDGG |
Ga0247546_1019312 | 3300023551 | Soil | GAMIAGALRCVLGGWETTPKAHIEGNAAEESPDSKGRDGG |
Ga0247545_1033861 | 3300023662 | Soil | AGVMIAGALRSVRQGRETCFEARIEGHATEESPDSKGRDGG |
Ga0247545_1033862 | 3300023662 | Soil | MRSSTESVAGAMIAGALRCVLGGWETTPKAHIEGNAAEESPDSK |
Ga0247553_1108991 | 3300023672 | Soil | AGAMIAGALRFVLQGRETAPTAHIEGHAAEESPDSKGRDGG |
Ga0247533_1056671 | 3300023675 | Soil | GAMIAGALRCVLEERGTAPKAHVEGHAAEESPDSKGRDGG |
Ga0222748_11201791 | 3300029701 | Soil | AGAMIAGALRFVLQGRETAPTAHIEGRAAEESPDSKGRDGG |
Ga0307482_12788861 | 3300030730 | Hardwood Forest Soil | GAMIAGALRLVREGWETAPKARVEGHAAEESPDSEGRDGG |
Ga0265745_10287031 | 3300030759 | Soil | VAGAMIAGALRYVLEGWETAPKAHIEGNAAEESPDSKGRDGG |
Ga0265775_1143501 | 3300030762 | Soil | MIAEALRCVLQGRETAPKAQIEGHAAEESPDSKGRDGG |
Ga0265756_1165731 | 3300030805 | Soil | IAGALRFVLGGWEPAPKAHIEGNAAEESPDSKGRDGG |
Ga0265729_1043991 | 3300030816 | Soil | GAMIAGALRFVLEGRETAPKAHIEGHAAEESPDSRGRDGG |
Ga0265726_1061971 | 3300030824 | Soil | AMIAGALRFALHGRETAPKAHIEGHAAEESPDSKGRDGG |
Ga0265752_1093161 | 3300030832 | Soil | IAGALRFVLQGRETAPTAHIEGHAAEESPDSKGRDGG |
Ga0265738_1018382 | 3300030834 | Soil | AGSMIAGALRFVLQGRETAPKAHIEGHAAEESPDSKVQLQ |
Ga0265742_10159101 | 3300030874 | Soil | AGAMIAGALRCVLEERGTAPKAHVEGHAAEESPDSKGRDGG |
Ga0265777_1192251 | 3300030877 | Soil | VAGAMIAGALRCVLEERGTAPKAHVEGHAAEESPDSKGRDGG |
Ga0265777_1220201 | 3300030877 | Soil | GAMIAEALRCVLQGRVTAPKAQIEGLAAEESPDSEGRDGG |
Ga0265758_1089771 | 3300030884 | Soil | GALRFVLGGWEPAPKAHIEGNAAEESPDSKGRDGG |
Ga0265743_1186022 | 3300030885 | Soil | AGAMIAGALRCVLQGRETAPKAHLEGHAAEESPDSEGRDGG |
Ga0265769_1108811 | 3300030888 | Soil | AMIAGALRFVLEGRETAPKAHIEGHATEESPDSIGRDGG |
Ga0265769_1141042 | 3300030888 | Soil | AGAMIAGALRFVLEGRETAPKAHIEGHATEESPDSKGRDGG |
Ga0265759_1102551 | 3300030913 | Soil | AGAMIAGALRSGLQGRETCPEAHIEGHATEESPDSKGRDGG |
Ga0265740_10317992 | 3300030940 | Soil | AMIAEALRCVLQGRETAPKAQIEGHAAEESPDSKGRDGG |
Ga0247549_1048081 | 3300030942 | Soil | AGAMIAGALRCVLGGWETTPKAHIEGNAAEESPDSKGRDGG |
Ga0308178_10930531 | 3300030990 | Soil | AGALRFVLEGRATAPTAHIEGHAAEESPDSEGRDGG |
Ga0265744_1157171 | 3300031017 | Soil | GAMIAGALRCVLGGWETSPKAHIEGNAAEESPDSKGRDGG |
Ga0265773_10413651 | 3300031018 | Soil | GAMIAGALRFVLQGRETAPTAHIEGHAAEESPDSKGRDGG |
Ga0265724_1026122 | 3300031024 | Soil | VAGAMIAGAFRFALHGRETAPKAHVEGHAAEESPDSKGRDGG |
Ga0265749_1029831 | 3300031042 | Soil | RSSTESVAGAMIAGALRYVLEGWETAPKAHIEGNAAEESPDSKGRDGG |
Ga0308181_11638111 | 3300031099 | Soil | AGAMIAGALRFVLQERATAPTAHIEGHAAEESPDSEGRDGG |
Ga0308187_104383591 | 3300031114 | Soil | GAMIAEALRFVLQERATAPTAHIEGHAAEESPDSEGRDGG |
Ga0170823_136112181 | 3300031128 | Forest Soil | VAGAMIAGALRFVLGGWEPAPRAHVEGNAAEESPDSKGRDGG |
Ga0170823_176546551 | 3300031128 | Forest Soil | VAGAMIAGALRFVLEGRETAPKAHIEGHATEESPDSKGRDGG |
Ga0308194_102450541 | 3300031421 | Soil | AMIAEALRFVLQERATAPTAHIEGHAAEESPDSEGRDGG |
Ga0310117_1313511 | 3300031592 | Soil | VAGAMIAGALRFALHGRETAPKAHIEGHAAEESPDSKGRDGG |
Ga0310113_1298461 | 3300031636 | Soil | AGAMIAGALRFALHGRETAPKAHIEGHAAEESPDSKGRDGG |
Ga0316031_1115101 | 3300031826 | Soil | AGVMIAGALRSVRQGRETCFEARIEGHATEESLDSKGRDGG |
Ga0247532_1046271 | 3300031827 | Soil | GAMIAGALRFLLQSRETCFDAHIEGHATEESPDSKGRDGG |
Ga0316049_1227501 | 3300031866 | Soil | IAAALRFVLEGRETAPKAHSEGHAAEESPDSEGRDGG |
Ga0316032_1084201 | 3300031956 | Soil | AGAMIAGALRFALHGRATAPKAHIEGHAAEESPDSKGRDGG |
Ga0326631_1162081 | 3300032072 | Soil | GAMIAGALRCVLQGRETAPKAQVEGHAAEESPDSEGRDGG |
⦗Top⦘ |