| Basic Information | |
|---|---|
| Family ID | F080236 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 115 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MNNIYDKKFEIYLIKKGYNLDCISLQECLKEIKIWKKNTENA |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 115 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 46.96 % |
| % of genes near scaffold ends (potentially truncated) | 31.30 % |
| % of genes from short scaffolds (< 2000 bps) | 80.00 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (81.739 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (13.913 % of family members) |
| Environment Ontology (ENVO) | Unclassified (56.522 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (59.130 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.24% β-sheet: 0.00% Coil/Unstructured: 54.76% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 115 Family Scaffolds |
|---|---|---|
| PF01068 | DNA_ligase_A_M | 2.61 |
| PF08279 | HTH_11 | 0.87 |
| PF14743 | DNA_ligase_OB_2 | 0.87 |
| PF04542 | Sigma70_r2 | 0.87 |
| PF02867 | Ribonuc_red_lgC | 0.87 |
| PF00303 | Thymidylat_synt | 0.87 |
| PF06356 | DUF1064 | 0.87 |
| COG ID | Name | Functional Category | % Frequency in 115 Family Scaffolds |
|---|---|---|---|
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 2.61 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 2.61 |
| COG0207 | Thymidylate synthase | Nucleotide transport and metabolism [F] | 0.87 |
| COG0209 | Ribonucleotide reductase alpha subunit | Nucleotide transport and metabolism [F] | 0.87 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.87 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.87 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.87 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.87 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 81.74 % |
| All Organisms | root | All Organisms | 18.26 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 13.91% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 11.30% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 6.96% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 6.96% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 6.09% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 6.09% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 5.22% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 5.22% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 4.35% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 4.35% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 3.48% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 2.61% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 2.61% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 2.61% |
| Worm Burrow | Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow | 1.74% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.74% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine | 1.74% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.74% |
| Hydrothermal Vent Microbial Mat | Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Vent Microbial Mat | 1.74% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.87% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.87% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.87% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 0.87% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.87% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.87% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.87% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.87% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.87% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.87% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.87% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000118 | Marine microbial communities from chronically polluted sediments in Tierra del Fuego - site OR sample ARG 06_12.3m | Environmental | Open in IMG/M |
| 3300000122 | Marine microbial communities from chronically polluted sediments in Tierra del Fuego - site OR sample ARG 04_12.3m | Environmental | Open in IMG/M |
| 3300001938 | Marine microbial communities from Bedford Basin, Nova Scotia, Canada - GS005 | Environmental | Open in IMG/M |
| 3300003264 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_54_BLW_10 | Environmental | Open in IMG/M |
| 3300003847 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - COGITO 998_met_11 | Environmental | Open in IMG/M |
| 3300004461 | Marine viral communities from Newfoundland, Canada BC-2 | Environmental | Open in IMG/M |
| 3300005588 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.1 | Environmental | Open in IMG/M |
| 3300005589 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.2 | Environmental | Open in IMG/M |
| 3300005590 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 | Environmental | Open in IMG/M |
| 3300005600 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.1 | Environmental | Open in IMG/M |
| 3300005601 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.1 | Environmental | Open in IMG/M |
| 3300005612 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2 | Environmental | Open in IMG/M |
| 3300005782 | Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 125 cmbsf, PM3 | Environmental | Open in IMG/M |
| 3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
| 3300006191 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA | Environmental | Open in IMG/M |
| 3300006467 | Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935 | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006925 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG | Environmental | Open in IMG/M |
| 3300006947 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007552 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.571 | Environmental | Open in IMG/M |
| 3300007655 | Estuarine microbial communities from the Columbia River estuary - High salinity metaG S.579 | Environmental | Open in IMG/M |
| 3300008470 | Sediment core microbial communities from Adelie Basin, Antarctica. Combined Assembly of Gp0136540, Gp0136562, Gp0136563 | Environmental | Open in IMG/M |
| 3300009002 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573 | Environmental | Open in IMG/M |
| 3300009051 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-02 | Environmental | Open in IMG/M |
| 3300009058 | Estuarine microbial communities from the Columbia River estuary - metaG 1370A-02 | Environmental | Open in IMG/M |
| 3300009079 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 | Environmental | Open in IMG/M |
| 3300009130 | Combined Assembly of Gp0139511, Gp0139512 | Environmental | Open in IMG/M |
| 3300009173 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 | Environmental | Open in IMG/M |
| 3300009432 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome | Environmental | Open in IMG/M |
| 3300009440 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110512 | Environmental | Open in IMG/M |
| 3300009441 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome | Environmental | Open in IMG/M |
| 3300009505 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 | Environmental | Open in IMG/M |
| 3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
| 3300009526 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 | Environmental | Open in IMG/M |
| 3300009705 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
| 3300013098 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay11, Core 4567-28, 0-3 cm | Environmental | Open in IMG/M |
| 3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
| 3300018642 | Metatranscriptome of marine microbial communities from Baltic Sea - GS695_0p1 | Environmental | Open in IMG/M |
| 3300020166 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160426_1 | Environmental | Open in IMG/M |
| 3300020182 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160502_2 | Environmental | Open in IMG/M |
| 3300020347 | Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994) | Environmental | Open in IMG/M |
| 3300020421 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556005-ERR599007) | Environmental | Open in IMG/M |
| 3300020595 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160412_1 | Environmental | Open in IMG/M |
| 3300021185 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 | Environmental | Open in IMG/M |
| 3300021373 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282 | Environmental | Open in IMG/M |
| 3300021471 | Hydrothermal vent microbial mat bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4872-18-2-3_MG | Environmental | Open in IMG/M |
| 3300021504 | Hydrothermal vent microbial mat bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4872-13-2-3_MG | Environmental | Open in IMG/M |
| 3300022053 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022072 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3) | Environmental | Open in IMG/M |
| 3300022220 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_21 | Environmental | Open in IMG/M |
| 3300022913 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_2_MG | Environmental | Open in IMG/M |
| 3300023109 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MG | Environmental | Open in IMG/M |
| 3300023112 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_2_MG | Environmental | Open in IMG/M |
| 3300023210 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MG | Environmental | Open in IMG/M |
| 3300024062 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_1 | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300024518 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_2 | Environmental | Open in IMG/M |
| 3300024519 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27 | Environmental | Open in IMG/M |
| 3300025617 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_153SG_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025626 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025704 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 (SPAdes) | Environmental | Open in IMG/M |
| 3300025849 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes) | Environmental | Open in IMG/M |
| 3300027522 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
| 3300027687 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300027704 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027758 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027780 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 (SPAdes) | Environmental | Open in IMG/M |
| 3300027790 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027810 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027828 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027838 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300027883 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027967 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027978 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.1 (SPAdes) | Environmental | Open in IMG/M |
| 3300031140 | Marine microbial communities from water near the shore, Antarctic Ocean - #420 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031569 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2 | Environmental | Open in IMG/M |
| 3300031589 | Marine microbial communities from David Island wharf, Antarctic Ocean - #35 | Environmental | Open in IMG/M |
| 3300031612 | Marine microbial communities from water near the shore, Antarctic Ocean - #127 | Environmental | Open in IMG/M |
| 3300031628 | Marine microbial communities from water near the shore, Antarctic Ocean - #229 | Environmental | Open in IMG/M |
| 3300031629 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #80 | Environmental | Open in IMG/M |
| 3300031630 | Marine microbial communities from water near the shore, Antarctic Ocean - #38 | Environmental | Open in IMG/M |
| 3300031659 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #82 | Environmental | Open in IMG/M |
| 3300032276 | Coastal sediment microbial communities from Maine, United States - Phippsburg worm burrow 1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_100946691 | 3300000101 | Marine | MNNIYDKKFEIYLIKKGYDLDCISLQECLKEIKLWKKNTANA* |
| DelMOSum2010_101425461 | 3300000101 | Marine | KSMNNIYDKKFEIYLIKKGYNLDCISLQECLKEIKLWKKNTENA* |
| DelMOSum2010_102192361 | 3300000101 | Marine | MNNIYDKKFEIYLAKKGYNLDKISLTECLKEIKIWKKN |
| DelMOSum2010_102450851 | 3300000101 | Marine | MNNIYDKKFEIYLIKKGYDLDCISLNECLKEIKLWKKNTENA* |
| DelMOSum2010_102793702 | 3300000101 | Marine | MNNIYDKKFEIYLAKKGYNLDKISLTECLKEIKIWKKNTENV* |
| TDF_OR_ARG05_123mDRAFT_10009302 | 3300000118 | Marine | LRSIGKNKNTMNNIYDKQFEIYLVKKGFNLDTISLQECLTQIKIWKKNIANA* |
| TDF_OR_ARG04_123mDRAFT_10083072 | 3300000122 | Marine | LRSIGKNKNTMNNIYDKQFEIYLVKKGFNLNTISLQECLTQIKIWKKNIANA* |
| GOS2221_10131515 | 3300001938 | Marine | MNNIYDKKFELYLVKKGYNLDQISLQECLKEMKLWKKNTVNA* |
| JGI26119J46589_10056081 | 3300003264 | Marine | MNNIYDKKFEIYLIKKGYNLDCISLQECLKEIKIWKKNTENA* |
| Ga0055582_10253371 | 3300003847 | Pelagic Marine | MNNIYDKKFEIYLVQKGYDLNCISLNECLKEIKLWKKNTENV* |
| Ga0066223_10571274 | 3300004461 | Marine | MNNIYDKKFEIYLAKKGYNLDKISLTECLKEIKIWKKNTENA* |
| Ga0070728_101808825 | 3300005588 | Marine Sediment | MNNIYDKKFEIYLAKKGYNLNEISLTECLKEIKIWKKNTENV* |
| Ga0070728_106269982 | 3300005588 | Marine Sediment | MNNIYDKKFEIYLIKKGYDLDCISLQECLKEIKIWKKNTENA* |
| Ga0070729_104194363 | 3300005589 | Marine Sediment | MNNIYDKKFEIYLIKKGYDLDCISLNECLKEIKLWKKNTANA* |
| Ga0070727_102271572 | 3300005590 | Marine Sediment | MNNIYDKKFEIYLIKKGYNLDCVSLQECLKEIKIWKKNTENA* |
| Ga0070726_100833782 | 3300005600 | Marine Sediment | MNNIYDKKFEIYLAKKGYNLDKISLTECLKEMKIWKKNTENV* |
| Ga0070722_102688983 | 3300005601 | Marine Sediment | MNNIYDKKFEIYLAKKGYNLNEISLTECLKEIKIWKKNTEN |
| Ga0070723_101008482 | 3300005612 | Marine Sediment | MNNIYDKKFEIYLIKKGYDLDCISLNECLKEIKLWKKNTENV* |
| Ga0079367_12302253 | 3300005782 | Marine Sediment | MNNIYDKKFEIYLIKKGYDLDCISLQECLKEIKIW |
| Ga0078893_111034982 | 3300005837 | Marine Surface Water | MNNIYDKKFELYLVTKGYDLDTISLQECLKEIKIWKKNTENA* |
| Ga0075447_101899772 | 3300006191 | Marine | MNNIYDKKFEIYLAKKGYNLNEISLTECLKEIKIWKKNTENA* |
| Ga0099972_106809401 | 3300006467 | Marine | MNNIYDKKFEIYLVQKGYDLNCISLNECLKEIKLWKKNTANA* |
| Ga0070744_100154628 | 3300006484 | Estuarine | MNNIYDKKFELYLISKGYDLDTISLTECLTEIKIWKKNTTNA* |
| Ga0098048_12626651 | 3300006752 | Marine | KFELYLIKKGFNLDTISLQECLKQIKIWKSNTENA* |
| Ga0098055_10123267 | 3300006793 | Marine | MNNIYDKKFELYLIKKGFNLDTISLQECLKQIKIWKSNTENA* |
| Ga0070748_13272332 | 3300006920 | Aqueous | MNNIYDKKFELYLVKKGYNLDQISLQECLKEMKLWKKNTVDA* |
| Ga0098050_10828742 | 3300006925 | Marine | MNNIYDKKFELYLIKKGFNLDTISLQECLKQIKILKSNTENA* |
| Ga0075444_103635693 | 3300006947 | Marine | MNNIYDKKFEIYLVKKGFNLDTISLQECLTQIKIWKRNIASV* |
| Ga0070747_10769441 | 3300007276 | Aqueous | MNNIYDKKFELYLVKKGYNLDQISLQECLKEMKLWKKNT |
| Ga0070747_11485281 | 3300007276 | Aqueous | NMNNIYDKKFELYLVKKGYNLDQISLQECLKEMKLWKKNTVDA* |
| Ga0099851_101760711 | 3300007538 | Aqueous | MNNIYDKKFELYLVKKGYNLDKISLQECLKEIKIWKKNTVDA* |
| Ga0099849_10471385 | 3300007539 | Aqueous | MDMNNIYDKKFELYLVAKGYDLDTISLQECLKEIKLWKKNTENA* |
| Ga0102818_10025741 | 3300007552 | Estuarine | KKFEIYLVQKGYDLNCISLQECLKEIKIWKKNTENA* |
| Ga0102825_10990611 | 3300007655 | Estuarine | NNIYDKKFELYLISKGYDLDTISLTECLTEIKIWKKNTTNA* |
| Ga0115371_112831292 | 3300008470 | Sediment | MNTMNNIYDKKFEIYLVKKGFNLDTISLQECLTQIKIWKQT* |
| Ga0102810_10226407 | 3300009002 | Estuarine | MNNIYDKKFEIYLVQKGYDLNCISLQECLKEIKIWKKNTENA* |
| Ga0102864_11168291 | 3300009051 | Estuarine | KTFTNMNNIYDKKFEIYLVQKGYNLDCISLQECLKEIKIWKKNTENA* |
| Ga0102854_10197798 | 3300009058 | Estuarine | NNSMNNIYDKKFELYLISKGYDLDTISLTECLTEIKIWKKNTTNA* |
| Ga0102814_104196243 | 3300009079 | Estuarine | MNNIYDKKFEIYLVQKGYNLDCISLQECLKEIKIWKKNTEKE* |
| Ga0118729_11066544 | 3300009130 | Marine | MNNIYDKKFELYLVTKGYDLDTISLQECLKEIKIWKKNTKNA* |
| Ga0114996_106038571 | 3300009173 | Marine | MKQDNNNMNNIYDKKFEIYLIKKGYDLDCISLQECLKEIKIWKKNTENA* |
| Ga0115005_109738644 | 3300009432 | Marine | MNNIYDKKFEIYLIKKGYDLDCISLQECLKEIKLWK |
| Ga0115005_116615652 | 3300009432 | Marine | MNNIYDKKFEIYLIKKGYDLDCISLQECLKEIKLWKKNT |
| Ga0115561_10169903 | 3300009440 | Pelagic Marine | MNNIYDKKFELYLVTKGYDLDTISLNECLKEIKIWKKNTTNA* |
| Ga0115007_105324192 | 3300009441 | Marine | MNNIYDKKFEIYLIKKGYDLDCISLQECLKEIKIWKKNTENV* |
| Ga0115564_104692242 | 3300009505 | Pelagic Marine | MNNIYDKKFEIYLVQKGYDLDCISLNECLKEMKLWKKNTANA* |
| Ga0115003_104007194 | 3300009512 | Marine | MNNIYDKKFEIYLAKKGYNLNKISLTECLKEIKIWKKNTENA* |
| Ga0115004_102478952 | 3300009526 | Marine | MNNIYDKKFEIYLAKKGYDLDCISLTECLKEIKIWKKNTENV* |
| Ga0115000_105408362 | 3300009705 | Marine | MNNIYNKKFEIYLAKKGYNLNEISLTECLKEIKIWKKNTENA* |
| Ga0129348_10266165 | 3300010296 | Freshwater To Marine Saline Gradient | MNNIYDKKFELYLVAKGYDLDTISLQECLKEIKIWKKNTENA* |
| Ga0129351_12727512 | 3300010300 | Freshwater To Marine Saline Gradient | MNNIYDKKFELYLVAKGYDLDTISLQECLKEIKLWKKNTENA* |
| Ga0118731_1065773772 | 3300010392 | Marine | MNNIYDKKFEIYLAKKGYNLNEISLTECLKEIKIWKKNTGNA* |
| Ga0118731_1131094242 | 3300010392 | Marine | MNNIYDKKFEIYLAKKGYNLDKISLQECLKEIKIWKKNTENA* |
| Ga0164320_100208038 | 3300013098 | Marine Sediment | MNNIYDKKFELYLISKGYDLDTISLNECLKEIKIWKKNTENA* |
| Ga0181369_10031596 | 3300017708 | Marine | MNNIYDKKFELYLITKGYDLNTISLQECLKEIKIWKKNTENA |
| Ga0181412_11063042 | 3300017714 | Seawater | DKKFELYLISKGYDLDTISLTECLTEIKIWKKNTTNA |
| Ga0181390_100218523 | 3300017719 | Seawater | MNNIYDKKFEFYLIKKGFDLDTISLQECLKQIKIWKSNTENA |
| Ga0188867_10002363 | 3300018642 | Freshwater Lake | MNNIYDKKFEIYLVQKGYDLNCISLNECLKEIKLWKKNTENV |
| Ga0206128_10023276 | 3300020166 | Seawater | MNNIYDKKFEIYLIKKGYDLDCISLNECLKEIKLWKKNTENV |
| Ga0206129_100274721 | 3300020182 | Seawater | MNNIYDKKFEIYLIKKGYDLDCISLNECLKEIKLWKKNTENA |
| Ga0211504_10049622 | 3300020347 | Marine | MNNIYDKKFELYLISKGYDLDTISLNECLKEIKIWKKNTINA |
| Ga0211653_100729635 | 3300020421 | Marine | MNNIYDKKFELYLIKKGFDLDTISLQECLKQIKIWKSNTENA |
| Ga0206126_1000223342 | 3300020595 | Seawater | MNNIYDKKFELYLVTKGYDLDTISLNECLKEIKIWKKNTTNA |
| Ga0206682_104856201 | 3300021185 | Seawater | MNNIYDKKFELYLISKGYDLDTISLTECLTEIKIWKKNTTNA |
| Ga0213865_102780992 | 3300021373 | Seawater | MNNIYDKKFELYLVAKGYDLDTISLQECLKEIKLWKKNTENA |
| Ga0190359_12395942 | 3300021471 | Hydrothermal Vent Microbial Mat | MNNIYDKKFELYLISKGYDLDTISLNECLKEIKIWKKNTENA |
| Ga0190344_10890932 | 3300021504 | Hydrothermal Vent Microbial Mat | MNNIYDKKFELYLISKGYDLDTISLNECLKEIKIWKKNTTNA |
| Ga0212030_10476342 | 3300022053 | Aqueous | MNNIYDKKFELYLVKKGYNLDKISLQECLKEIKIWKKNTVDA |
| Ga0196889_10171154 | 3300022072 | Aqueous | MNNIYDKKFEIYLIKKGYDLDCISLQECLKEIKIWKKNTENA |
| Ga0224513_104779002 | 3300022220 | Sediment | NIYDKKFELYLISKGYDLDTISLTECLTEIKIWKKNTTNA |
| (restricted) Ga0233404_100241522 | 3300022913 | Seawater | MNNIYDKKFEIYLVQKGYDLNCISLQECLKEIKIWKKNTENA |
| (restricted) Ga0233432_100413523 | 3300023109 | Seawater | MNNIYDKKFELYLIKKGFNLDTISLQECLKQIKIWKSNTENA |
| (restricted) Ga0233411_100688111 | 3300023112 | Seawater | MNNIYDKKFEIYLIKKGYNLDCISLQECLKEIKIWKKNTEN |
| (restricted) Ga0233411_102221841 | 3300023112 | Seawater | NIYDKKFEIYLVQKGYDLNCISLQECLKEIKIWKKNTENA |
| (restricted) Ga0233412_100278916 | 3300023210 | Seawater | MNNIYDKKFEIYLIKKGYNLDCISLQECLKEIKIWKKNTENA |
| (restricted) Ga0233412_101992142 | 3300023210 | Seawater | MNNIYDKKFEIYLVQKGYNLDCISLQECLKEIKIWKKNTENA |
| (restricted) Ga0233412_104108771 | 3300023210 | Seawater | MNNIYDKKFEIYLVQKGYDLNCISLQECLKEIKIWKKNTEN |
| (restricted) Ga0255039_100613785 | 3300024062 | Seawater | MNNIYDKKFEVYLIKKGYNLDCISLQECLKEIKIWKKNTENA |
| Ga0244776_102917914 | 3300024348 | Estuarine | MNNIYDKKFEIYLAKKGYNLNEISLTECLKEIKIWKKNTENA |
| (restricted) Ga0255048_103835151 | 3300024518 | Seawater | KFELYLVKKGYNLDCISLQECLKEIKIWKKNTENA |
| (restricted) Ga0255046_103730331 | 3300024519 | Seawater | KFELYLVKKGFNLDTISLQECLTQMKLWKKNIVDA |
| (restricted) Ga0255046_104713542 | 3300024519 | Seawater | MNNIYDKKFEIYLVKKGFNLDTISLQECLTQMKLWKKNIVDA |
| Ga0209138_101205417 | 3300025617 | Marine | MNNIYDKKFELYLVKKGFNLDTISLQECLTQMKLWKKNTVDA |
| Ga0209716_10798391 | 3300025626 | Pelagic Marine | MNNIYDKKFEIYLAKKGYNLNEISLTECLKEIKIWKKNTGNA |
| Ga0209716_11080531 | 3300025626 | Pelagic Marine | MNNIYDKKFEIYLIKKGYDLDCISLNECLKEIKLWKKNTEN |
| Ga0208162_11025323 | 3300025674 | Aqueous | MDMNNIYDKKFELYLVAKGYDLDTISLQECLKEIKIWKKNTENA |
| Ga0209602_12221422 | 3300025704 | Pelagic Marine | NINMNNIYDKKFEIYLAKKGYNLNEISLTECLKEIKIWKKNTENA |
| Ga0209603_13294611 | 3300025849 | Pelagic Marine | SPVLNNKNMNNIYDKKFELYLIKKGFDLDTISLQECLTQIKIWKSNTENA |
| Ga0209384_10298594 | 3300027522 | Marine | MNNIYDKKFEIYLVKKGFNLDTISLQECLTQIKIWKRNIASA |
| Ga0208133_10267851 | 3300027631 | Estuarine | MNNIYDKKFEIYLVQKGYDLNCISLQECLKEIKIW |
| Ga0209710_11559532 | 3300027687 | Marine | MNNIYDKKFEIYLAKKGYNLNKISLTECLKEIKIWKKNTENA |
| Ga0209816_101430114 | 3300027704 | Marine | MNNIYDKKFEIYLVKKGFNLDTISLQECLTQIKIWKRNIASV |
| Ga0209379_102466581 | 3300027758 | Marine Sediment | MNNIYDKKFEIYLAKKGYNLNEISLTECLKEIKIWKKNTENV |
| Ga0209502_103471621 | 3300027780 | Marine | MNNIYDKKFEIYLIKKGYDLDCISLQECLKEIKLWKKN |
| Ga0209273_101342815 | 3300027790 | Marine Sediment | IYDKKFEIYLAKKGYNLDKISLTECLKEMKIWKKNTENV |
| Ga0209302_104123172 | 3300027810 | Marine | MNNIYDKKFEIYLAKKGYNLNEISLTECLKEIKIWKKNTE |
| Ga0209692_101351022 | 3300027828 | Marine Sediment | MNNIYDKKFEIYLIKKGYDLDCISLNECLKEIKLWKKNTANA |
| Ga0209089_101311561 | 3300027838 | Marine | MNNIYDKKFEIYLVQKGYDLNCISLNECLKEIKLWKKNTANA |
| Ga0209713_100007921 | 3300027883 | Marine | MNNIYDKKFEIYLIKKGYDLDCISLQECLKEIKIWKKNTENV |
| Ga0209272_100477863 | 3300027967 | Marine Sediment | MNNIYDKKFEIYLIKKGYDLDCISLNECLKEIKIWKKNTENV |
| Ga0209165_101388961 | 3300027978 | Marine Sediment | MNNIYDKKFEIYLAKKGYNLDKISLTECLKEIKIWKKNTENV |
| Ga0308024_10947452 | 3300031140 | Marine | MNTMNNIYDKKFEIYLVKKGFNLDTISLQECLTQIKIWKRNIASA |
| Ga0307488_104547254 | 3300031519 | Sackhole Brine | MNNIYDKKFEIYLAKKGYNLDKISLTECLKEMKIWKKNTENV |
| Ga0307488_107490841 | 3300031519 | Sackhole Brine | MNMNNIYDKKFEIYLAKKGYNLDEISLTECLKEIKIWKKNTENA |
| Ga0307380_107820181 | 3300031539 | Soil | MNNIYDKKFELYLVKKGYNLNQISLQECLKEMKLWKKNTVDA |
| Ga0307489_100392947 | 3300031569 | Sackhole Brine | MNNIYDKKFEIYLIKKGYNLDCISLQECLKEIKIWK |
| Ga0307489_102447721 | 3300031569 | Sackhole Brine | MNNIYDKKFEIYLVQKGYDLNCISLNECLKEIKLWK |
| Ga0307996_10156257 | 3300031589 | Marine | MNNIYDKKFEIYLVKKGFNLDTISLQECLTQIKIWKQT |
| Ga0308009_101350342 | 3300031612 | Marine | MMNNIYDKQFEIYLVKKGFNLDTISLQECLTQIKIWKSL |
| Ga0308014_10256331 | 3300031628 | Marine | MNTMNNIYDKKFEIYLVKKGFNLDTISLQECLTQIKIWKRNIASV |
| Ga0307985_103147693 | 3300031629 | Marine | NNIYDKKFEIYLVKKGFNLDTISLQECLTQIKIWKRNIASV |
| Ga0308004_103993053 | 3300031630 | Marine | MNNIYDKKFEIYLVKKGFNLDTISLQECLTQIKIWKRNIAS |
| Ga0307986_100151191 | 3300031659 | Marine | IYDKKFEIYLVKKGFNLDTISLQECLTQIKIWKRNIASV |
| Ga0316188_102851791 | 3300032276 | Worm Burrow | MNNIYDKKFEIYLIKKGYNLDCISLQECLKEIKIWKK |
| Ga0316188_103502353 | 3300032276 | Worm Burrow | LTDNNNMNNIYDKKFEIYLIKKGYDLDCISLNECLKEIKLWKKNTENA |
| ⦗Top⦘ |