| Basic Information | |
|---|---|
| Family ID | F078694 |
| Family Type | Metagenome |
| Number of Sequences | 116 |
| Average Sequence Length | 49 residues |
| Representative Sequence | MPIHKATGPRGGKGYQYGTTGKVYPTRAQAVKQAQAIKASQAAAKKKK |
| Number of Associated Samples | 76 |
| Number of Associated Scaffolds | 116 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 79.31 % |
| % of genes near scaffold ends (potentially truncated) | 6.03 % |
| % of genes from short scaffolds (< 2000 bps) | 62.93 % |
| Associated GOLD sequencing projects | 70 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.57 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (78.448 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (16.379 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.483 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (62.069 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 27.63% β-sheet: 15.79% Coil/Unstructured: 56.58% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 116 Family Scaffolds |
|---|---|---|
| PF02945 | Endonuclease_7 | 9.48 |
| PF05133 | Phage_prot_Gp6 | 8.62 |
| PF05065 | Phage_capsid | 7.76 |
| PF03237 | Terminase_6N | 3.45 |
| PF09718 | Tape_meas_lam_C | 2.59 |
| PF13385 | Laminin_G_3 | 1.72 |
| PF11351 | GTA_holin_3TM | 1.72 |
| PF04255 | DUF433 | 0.86 |
| PF05050 | Methyltransf_21 | 0.86 |
| PF00132 | Hexapep | 0.86 |
| PF00583 | Acetyltransf_1 | 0.86 |
| PF01355 | HIPIP | 0.86 |
| PF06199 | Phage_tail_2 | 0.86 |
| PF05118 | Asp_Arg_Hydrox | 0.86 |
| COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
|---|---|---|---|
| COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 7.76 |
| COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 0.86 |
| COG3555 | Aspartyl/asparaginyl beta-hydroxylase, cupin superfamily | Posttranslational modification, protein turnover, chaperones [O] | 0.86 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.55 % |
| Unclassified | root | N/A | 3.45 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001282|B570J14230_10162546 | Not Available | 632 | Open in IMG/M |
| 3300002447|JGI24768J34885_10000251 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15700 | Open in IMG/M |
| 3300003277|JGI25908J49247_10000625 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10828 | Open in IMG/M |
| 3300004481|Ga0069718_12619511 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300005581|Ga0049081_10013464 | All Organisms → Viruses → Predicted Viral | 3090 | Open in IMG/M |
| 3300005662|Ga0078894_10560971 | All Organisms → cellular organisms → Bacteria | 1021 | Open in IMG/M |
| 3300005758|Ga0078117_1015979 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6155 | Open in IMG/M |
| 3300005941|Ga0070743_10092599 | All Organisms → Viruses → Predicted Viral | 1017 | Open in IMG/M |
| 3300006037|Ga0075465_10000107 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14277 | Open in IMG/M |
| 3300006037|Ga0075465_10022813 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1242 | Open in IMG/M |
| 3300006484|Ga0070744_10225067 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 532 | Open in IMG/M |
| 3300006805|Ga0075464_10268445 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1023 | Open in IMG/M |
| 3300006805|Ga0075464_10475083 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300008107|Ga0114340_1002429 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 19968 | Open in IMG/M |
| 3300008107|Ga0114340_1002715 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 27501 | Open in IMG/M |
| 3300008107|Ga0114340_1008185 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6341 | Open in IMG/M |
| 3300008107|Ga0114340_1009314 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4950 | Open in IMG/M |
| 3300008107|Ga0114340_1060669 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1623 | Open in IMG/M |
| 3300008110|Ga0114343_1001078 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 24353 | Open in IMG/M |
| 3300008111|Ga0114344_1005016 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5766 | Open in IMG/M |
| 3300008116|Ga0114350_1006687 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5527 | Open in IMG/M |
| 3300008116|Ga0114350_1142048 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 685 | Open in IMG/M |
| 3300008261|Ga0114336_1344102 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 538 | Open in IMG/M |
| 3300008339|Ga0114878_1027086 | All Organisms → Viruses → Predicted Viral | 2618 | Open in IMG/M |
| 3300008339|Ga0114878_1159606 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 797 | Open in IMG/M |
| 3300009152|Ga0114980_10031385 | All Organisms → Viruses → Predicted Viral | 3283 | Open in IMG/M |
| 3300009158|Ga0114977_10638826 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 571 | Open in IMG/M |
| 3300009159|Ga0114978_10002761 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14463 | Open in IMG/M |
| 3300009160|Ga0114981_10570274 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 602 | Open in IMG/M |
| 3300009164|Ga0114975_10007304 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7032 | Open in IMG/M |
| 3300009180|Ga0114979_10037173 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3076 | Open in IMG/M |
| 3300009180|Ga0114979_10132846 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1528 | Open in IMG/M |
| 3300009180|Ga0114979_10470468 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 729 | Open in IMG/M |
| 3300009180|Ga0114979_10546782 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 666 | Open in IMG/M |
| 3300009419|Ga0114982_1011445 | All Organisms → Viruses → Predicted Viral | 3120 | Open in IMG/M |
| 3300009419|Ga0114982_1187627 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 639 | Open in IMG/M |
| 3300010354|Ga0129333_10004714 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12760 | Open in IMG/M |
| 3300010354|Ga0129333_10011450 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8404 | Open in IMG/M |
| 3300010354|Ga0129333_10038169 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4534 | Open in IMG/M |
| 3300010354|Ga0129333_10174366 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1965 | Open in IMG/M |
| 3300010354|Ga0129333_10222288 | All Organisms → Viruses → Predicted Viral | 1712 | Open in IMG/M |
| 3300010354|Ga0129333_10488974 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1080 | Open in IMG/M |
| 3300010354|Ga0129333_11712680 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 511 | Open in IMG/M |
| 3300010885|Ga0133913_12478848 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1265 | Open in IMG/M |
| 3300010966|Ga0137675_1000260 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4342 | Open in IMG/M |
| 3300011182|Ga0136707_1048992 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 587 | Open in IMG/M |
| 3300012663|Ga0157203_1000126 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 27551 | Open in IMG/M |
| 3300012663|Ga0157203_1029646 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 770 | Open in IMG/M |
| 3300012665|Ga0157210_1000193 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 30171 | Open in IMG/M |
| 3300012665|Ga0157210_1000272 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 24693 | Open in IMG/M |
| 3300012665|Ga0157210_1000840 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10868 | Open in IMG/M |
| 3300012665|Ga0157210_1011276 | All Organisms → Viruses → Predicted Viral | 1565 | Open in IMG/M |
| 3300012665|Ga0157210_1054981 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 605 | Open in IMG/M |
| 3300012667|Ga0157208_10000118 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 28057 | Open in IMG/M |
| 3300013004|Ga0164293_10465358 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 840 | Open in IMG/M |
| 3300014960|Ga0134316_1002334 | All Organisms → Viruses → Predicted Viral | 1982 | Open in IMG/M |
| 3300017784|Ga0181348_1131714 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 952 | Open in IMG/M |
| 3300019784|Ga0181359_1056382 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1509 | Open in IMG/M |
| 3300020160|Ga0211733_11056449 | Not Available | 1263 | Open in IMG/M |
| 3300020162|Ga0211735_10985307 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1680 | Open in IMG/M |
| 3300020572|Ga0207909_1051494 | Not Available | 640 | Open in IMG/M |
| 3300021956|Ga0213922_1027076 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1403 | Open in IMG/M |
| 3300021956|Ga0213922_1054545 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 879 | Open in IMG/M |
| 3300021961|Ga0222714_10008716 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8999 | Open in IMG/M |
| 3300021961|Ga0222714_10143141 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1445 | Open in IMG/M |
| 3300021962|Ga0222713_10352631 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 920 | Open in IMG/M |
| 3300021962|Ga0222713_10499418 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 728 | Open in IMG/M |
| 3300021963|Ga0222712_10081299 | All Organisms → Viruses → Predicted Viral | 2314 | Open in IMG/M |
| 3300021963|Ga0222712_10193965 | All Organisms → Viruses → Predicted Viral | 1336 | Open in IMG/M |
| 3300021963|Ga0222712_10210496 | All Organisms → Viruses → Predicted Viral | 1266 | Open in IMG/M |
| 3300021963|Ga0222712_10345956 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 918 | Open in IMG/M |
| 3300021963|Ga0222712_10377685 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 867 | Open in IMG/M |
| 3300021963|Ga0222712_10715823 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 562 | Open in IMG/M |
| 3300022200|Ga0196901_1090804 | All Organisms → Viruses → Predicted Viral | 1077 | Open in IMG/M |
| 3300022747|Ga0228703_1049023 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1147 | Open in IMG/M |
| 3300022748|Ga0228702_1118559 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 603 | Open in IMG/M |
| 3300023179|Ga0214923_10231254 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1059 | Open in IMG/M |
| 3300024289|Ga0255147_1001131 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6793 | Open in IMG/M |
| 3300024346|Ga0244775_10131131 | All Organisms → Viruses → Predicted Viral | 2121 | Open in IMG/M |
| 3300024358|Ga0255173_1054170 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 676 | Open in IMG/M |
| 3300024502|Ga0255181_1072142 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 564 | Open in IMG/M |
| 3300025075|Ga0209615_102466 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1169 | Open in IMG/M |
| 3300025080|Ga0209103_1037457 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 594 | Open in IMG/M |
| 3300025451|Ga0208426_1000052 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 26597 | Open in IMG/M |
| 3300026459|Ga0255170_1046027 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 770 | Open in IMG/M |
| 3300027710|Ga0209599_10000556 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 23370 | Open in IMG/M |
| 3300027733|Ga0209297_1021441 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3069 | Open in IMG/M |
| 3300027733|Ga0209297_1316911 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 576 | Open in IMG/M |
| 3300027734|Ga0209087_1002312 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10786 | Open in IMG/M |
| 3300027734|Ga0209087_1352675 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 508 | Open in IMG/M |
| 3300027759|Ga0209296_1282106 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 668 | Open in IMG/M |
| 3300027763|Ga0209088_10015427 | All Organisms → Viruses → Predicted Viral | 4042 | Open in IMG/M |
| 3300027763|Ga0209088_10017201 | All Organisms → Viruses → Predicted Viral | 3789 | Open in IMG/M |
| 3300027763|Ga0209088_10145657 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1051 | Open in IMG/M |
| 3300027805|Ga0209229_10389665 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 606 | Open in IMG/M |
| 3300027805|Ga0209229_10444372 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 559 | Open in IMG/M |
| 3300027808|Ga0209354_10068943 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1433 | Open in IMG/M |
| 3300027808|Ga0209354_10379697 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 552 | Open in IMG/M |
| 3300027836|Ga0209230_10000097 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 31956 | Open in IMG/M |
| 3300027836|Ga0209230_10009190 | All Organisms → Viruses → Predicted Viral | 4405 | Open in IMG/M |
| 3300027836|Ga0209230_10365158 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 830 | Open in IMG/M |
| 3300028392|Ga0304729_1024696 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2505 | Open in IMG/M |
| 3300029930|Ga0119944_1017939 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 985 | Open in IMG/M |
| 3300031758|Ga0315907_11210086 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 528 | Open in IMG/M |
| 3300031784|Ga0315899_10919581 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 786 | Open in IMG/M |
| 3300031857|Ga0315909_10042254 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4297 | Open in IMG/M |
| 3300031951|Ga0315904_10014500 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9810 | Open in IMG/M |
| 3300031951|Ga0315904_10903054 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 713 | Open in IMG/M |
| 3300031952|Ga0315294_10812081 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 804 | Open in IMG/M |
| 3300031999|Ga0315274_11338991 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 695 | Open in IMG/M |
| 3300032053|Ga0315284_11368468 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 762 | Open in IMG/M |
| 3300032116|Ga0315903_10353464 | All Organisms → Viruses → Predicted Viral | 1216 | Open in IMG/M |
| 3300034061|Ga0334987_0332609 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 991 | Open in IMG/M |
| 3300034101|Ga0335027_0036573 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4063 | Open in IMG/M |
| 3300034103|Ga0335030_0541256 | Not Available | 726 | Open in IMG/M |
| 3300034104|Ga0335031_0164779 | All Organisms → Viruses → Predicted Viral | 1524 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 16.38% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 8.62% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 8.62% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 6.90% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 6.03% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 5.17% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 5.17% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.17% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 5.17% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 5.17% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 3.45% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 3.45% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.59% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 2.59% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 2.59% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 2.59% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.72% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.72% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.72% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.86% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.86% |
| Lake Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water | 0.86% |
| Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 0.86% |
| Surface Water | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water | 0.86% |
| Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 0.86% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001282 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
| 3300002447 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005758 | Cyanobacteria communities in tropical freswater systems - freshwater lake in Singapore | Environmental | Open in IMG/M |
| 3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
| 3300006037 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
| 3300008339 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Sept 29, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300010966 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV1bis, april 2016 | Environmental | Open in IMG/M |
| 3300011182 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - 4C3 metaG | Environmental | Open in IMG/M |
| 3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
| 3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
| 3300012667 | Freshwater microbial communities from Maskinonge River, Ontario, Canada - S15 | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300014960 | Surface water microbial communities from Bangladesh - BaraHaldiaSW0709 | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020572 | Freshwater microbial communities from Lake Mendota, WI - 05MAY2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022747 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17_Aug_MG | Environmental | Open in IMG/M |
| 3300022748 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17_Aug_MG | Environmental | Open in IMG/M |
| 3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
| 3300024289 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024358 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepA_8d | Environmental | Open in IMG/M |
| 3300024502 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepC_8d | Environmental | Open in IMG/M |
| 3300025075 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA to study Microbial Dark Matter (Phase II) - 4B3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025080 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - 4C3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025451 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300026459 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepA_8d | Environmental | Open in IMG/M |
| 3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027836 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300028392 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J14230_101625461 | 3300001282 | Freshwater | MPIRKVTGPRGGKGYQYGTTGKVYPTRAGAVRQAQAIKASQAATKKKK* |
| JGI24768J34885_100002518 | 3300002447 | Freshwater And Sediment | MPVHKATGPRGGKGWQYGTTGKVYPTRAGAVRQAQAIKASQASTKQKKK* |
| JGI25908J49247_1000062515 | 3300003277 | Freshwater Lake | MPIHKATGPRGGKGYQYGTTGKVYPTRAQAVKQAQAIKASQAAAKKKK* |
| Ga0069718_126195112 | 3300004481 | Sediment | MPIHRATGPRGGKGYQYGTTGKVYPTRAQAVKQAQAIKASQAAAKKRK* |
| Ga0049081_100134641 | 3300005581 | Freshwater Lentic | MPVHKAIGPRGGKGYQYGTTGKVYPTRAQAVRQAQAIKASQAAAKKDKK* |
| Ga0078894_105609712 | 3300005662 | Freshwater Lake | MPVRKVQGPRGGVGYQYGTTGKIYPTRAQAVRQAQAIKASQSAARYGKPKK* |
| Ga0078117_10159794 | 3300005758 | Lake Water | MPIHRATGPRGGKGWQYGTTGKVYPTRQQAVKQAQAIKASQARAAKKNK* |
| Ga0070743_100925991 | 3300005941 | Estuarine | MPIHRAKGPKGGKGWQYGQSGKVYSSRSQALKQMIAIKISQGKIKPKRKR* |
| Ga0075465_100001075 | 3300006037 | Aqueous | MPVHKAKGPRGGKGYQYGTSGKVYPTKAGAVAQARAIRANQANAKKKK* |
| Ga0075465_100228131 | 3300006037 | Aqueous | INMPIHRATGPRGGKGYQYGSTGKVYPTRAQAVKQAQAIKASQAAAKKKK* |
| Ga0070744_102250672 | 3300006484 | Estuarine | MPIHKATGPRGGKGFQYGTTGKVYPTRAQAVKQAQAIKASQTAAKKKK* |
| Ga0075464_102684453 | 3300006805 | Aqueous | MPIHRAKGPRGGSGFQYGTHGKVYPTRKQAVKQAQAIKASQAASNKKKK* |
| Ga0075464_104750832 | 3300006805 | Aqueous | MPIHRATGPRGGKGYQYGSTGKVYPTRAGAVRQAQAIKASQAAVKKKK* |
| Ga0114340_100242925 | 3300008107 | Freshwater, Plankton | MPVHKATGPRGGKGFQYGTSGKVYPTRAQAVRQAQAIKASQAAAKKSNNSRSR* |
| Ga0114340_100271531 | 3300008107 | Freshwater, Plankton | MPIHKATGPRGGKGWQYGTSGKVYPTRAQAVRQAQAIKASQAAAKKKPNTRSK* |
| Ga0114340_10081857 | 3300008107 | Freshwater, Plankton | MPIHRATGPRGGKGWQYGTTGKVYPTRPQAVRQAQAIKASQSRAKKAKK* |
| Ga0114340_10093146 | 3300008107 | Freshwater, Plankton | MPIHRATGPRGGKGWQYGTTGKVYPTRSQAVRQAQAIKASQSRAKKTKK* |
| Ga0114340_10606693 | 3300008107 | Freshwater, Plankton | MPIHKATGPRGGKGFQYGTSGKVYPTRAQAVRQAQAIKASQAAAKKKGNSRSK* |
| Ga0114343_100107817 | 3300008110 | Freshwater, Plankton | MPIHKATGPSGGKGWQYGTSGKVYPTRAQAVRQAQAIKASQAAAKKKPNTRSK* |
| Ga0114344_10050162 | 3300008111 | Freshwater, Plankton | MPIHRATGPRGGKGWQYGTTGKVYPTRQGAVRQAQAIKASQSRAKKAKTK* |
| Ga0114350_10066877 | 3300008116 | Freshwater, Plankton | MPIHKATGPRGGKGWQYGSQGKVYPTRAGAVRQAQAIKASQAKTAKAKKK* |
| Ga0114350_11420482 | 3300008116 | Freshwater, Plankton | MPVHKAKGPKGGKGWQYGTTGKVYPTRKQAVRQAQAIKASQARAKQRKK* |
| Ga0114336_13441022 | 3300008261 | Freshwater, Plankton | MPVHKATGPRGGKGWQYGTTGKVYPTRAQAVRQAQAIKASQAAAKKDKKK* |
| Ga0114878_10270863 | 3300008339 | Freshwater Lake | MPIHRATGPRGGKGWQYGTTGKVYPTRQGAVRQAQAIKASQS |
| Ga0114878_11596061 | 3300008339 | Freshwater Lake | RATGPRGGKGWQYGTTGKVYPTRQGAVRQAQAIKASQSRAKKAKTK* |
| Ga0114980_100313853 | 3300009152 | Freshwater Lake | MPIHKAKGPRGGKGYQYGESGKVYPTKKQAIKQMVAIKISEGKIKVKKK* |
| Ga0114977_106388262 | 3300009158 | Freshwater Lake | MPIHKAKGPRGGKGYQYGESGKVYPTKAQAIKQMVAIKISQGKIKPKKKK* |
| Ga0114978_1000276111 | 3300009159 | Freshwater Lake | MPIHKATGPRGGKGYQYGESGKVYPTKAQAIKQMVAIKISQGKIKPKKSK* |
| Ga0114981_105702742 | 3300009160 | Freshwater Lake | MPIHKAKGPRGGKGYQYGESGEVYPTKKQAIKQMVAIKISEGKIKVKKK* |
| Ga0114975_100073044 | 3300009164 | Freshwater Lake | MMPIRKVTGPRGGKGYQYGESGKYYPGPGGRAKAVRQAQAIKASQAAAAKRKK* |
| Ga0114979_100371734 | 3300009180 | Freshwater Lake | MPIHKATGPRGGKGFQYGTHGKVYPTRAQAVKQAQAIKASQAALKAKKKK* |
| Ga0114979_101328462 | 3300009180 | Freshwater Lake | MPIHKARGPRGGKGYQYGESGKVYPTKKQAIKQMVAIKISEGKIKVKK |
| Ga0114979_104704682 | 3300009180 | Freshwater Lake | MPIHKAKGPRGGRGYQYGESGKVYPTKKQAIKQMVAIKISEGVIKVKKKK* |
| Ga0114979_105467822 | 3300009180 | Freshwater Lake | MPIHKAKGPRGGRGYQYGESGKVYPTKKQAVKQMVAIKISEGTIKVKKKK* |
| Ga0114982_10114452 | 3300009419 | Deep Subsurface | MPIHKAKGPRGGQGFQYGTTGKVYPTRRQAVAQARAIKASQAAAKRGKK* |
| Ga0114982_11876272 | 3300009419 | Deep Subsurface | MPVHKARGPRGGQGYQYGTTGKVYPTRAQAVRQAQAIKASQAAAKKRKK* |
| Ga0129333_1000471413 | 3300010354 | Freshwater To Marine Saline Gradient | MPIHRARGPRGGQGWQYGTTGKVYPTRSQALQQARAIKAAQSRAKKKK* |
| Ga0129333_100114504 | 3300010354 | Freshwater To Marine Saline Gradient | MPVHKATGPRGGKGWQYGSSGKVYPTRAQAVRQAQAIKASQSRTAKAKKDKK* |
| Ga0129333_100381693 | 3300010354 | Freshwater To Marine Saline Gradient | MPIYRATGPRGGKGWQYGSSGKVYPTRRQAVAQARAIKASQSRTKKK* |
| Ga0129333_101743661 | 3300010354 | Freshwater To Marine Saline Gradient | TGPRGGKGWQYGSSGKVYPTRAQAVRQAQAIKASQARQEKNKSGK* |
| Ga0129333_102222881 | 3300010354 | Freshwater To Marine Saline Gradient | MPIHKAKGPRGGEGWQYGTHGKVYPTRAQAVRQAQAIKASQARAAADKNRGR* |
| Ga0129333_104889743 | 3300010354 | Freshwater To Marine Saline Gradient | MPIHKARGPRGGKGWQYGESGKVYPTKQQAIAQMVAIKISQRQTKTKKKP* |
| Ga0129333_117126801 | 3300010354 | Freshwater To Marine Saline Gradient | MPIHRATGPRGGKGWQYGSSGKVYPTRQQAVAQARAIKASQARAEKKDKR* |
| Ga0133913_124788482 | 3300010885 | Freshwater Lake | VAQATEEIIMPVHKATGPRGGKGYQYGTHGKVYPTKKQAVAQAVAIKISQAAAKKKK* |
| Ga0137675_10002604 | 3300010966 | Pond Fresh Water | MPIHKAKGPRGGKGWQYGTQGKVYPNRADAVRQAQAIKISQAAAKAKQKGK* |
| Ga0136707_10489922 | 3300011182 | Freshwater | MPIHKATGPRGGKGFQYGTTGKVYPTRAQAVKQAQAIKASQAAAKKKK* |
| Ga0157203_100012620 | 3300012663 | Freshwater | MPIHKATGPKGGKGYQYGTHGKVYPTRAQAVKQAQAIKASQAAAKKKK* |
| Ga0157203_10296462 | 3300012663 | Freshwater | MPVHKATGPRGGKGWQYGSSGKVYPTRSQAVRQAQAIKASQSRAKKK* |
| Ga0157210_100019326 | 3300012665 | Freshwater | MPIHKANGPKGGKGWQYGNSGKVYPTKAQAVKQMVAIKISQGKIKPKKKR* |
| Ga0157210_100027216 | 3300012665 | Freshwater | MPVHKATGPRGGKGWQYGDSGKVYPTRAQAVRQAQAIKASQSAQKKAKTK* |
| Ga0157210_10008402 | 3300012665 | Freshwater | MPIHRATGPRGGKGWQYGESGKVYPTRQQAVKQAQAIKASQSSKKKAKTK* |
| Ga0157210_10112763 | 3300012665 | Freshwater | MPVHKATGPRGGKGWQYGETGKVYPTRAKAVKQAQAIKASQAADKKKK* |
| Ga0157210_10549811 | 3300012665 | Freshwater | MPVHKATGPRGGKGWQYGTTGKVYPTRQQAVRQAQAIKASQSKMAETKKK* |
| Ga0157208_100001183 | 3300012667 | Freshwater | MPIHKAKGPRGGAGWQYGTTGKVYPTRKQAVAQAQAIKASQAAAKKRKK* |
| Ga0164293_104653581 | 3300013004 | Freshwater | PIRKVTGPRGGKGYQYGTTGKVYPTRAGAVRQAQAIKASQAATKKKK* |
| Ga0134316_10023342 | 3300014960 | Surface Water | MPIHKATGPRGGKGWQYGQHGKVYPTRAQAVKQAQAIKASQAAAKKKK* |
| Ga0181348_11317142 | 3300017784 | Freshwater Lake | MPIHKTTGPRGGKGYQYGTTGKVYPTRAQAVKQAQAIKASQAAAKKKK |
| Ga0181359_10563822 | 3300019784 | Freshwater Lake | MPIHRATGPKGGKGWQYGTSGKVYPTRAGAVRQAQAIRASQAAATKKKK |
| Ga0211733_110564492 | 3300020160 | Freshwater | MPIQQVIGPRGGRGFRYGETGKVYPTRAQAVKQAQAIKASQAQAKKKK |
| Ga0211735_109853072 | 3300020162 | Freshwater | MPVQQVIGPRGGRGFRYGETGKVYPTRAQAVKQAQAIKASQAQAKKKK |
| Ga0207909_10514942 | 3300020572 | Freshwater | MPIRKVTGPRGGKGYQYGTTGKVYPTRAGAVRQAQAIKASQAATKKKK |
| Ga0213922_10270762 | 3300021956 | Freshwater | MPIHKAKGPRGGSGWQYGTHGKVYPTREQAVRQAQAIKASQAAAKKKK |
| Ga0213922_10545452 | 3300021956 | Freshwater | MPIHKAKGPRGGKGYQYGTHGKVYPTKAQAIKQMVAIKISQGKIKPKKRG |
| Ga0222714_100087164 | 3300021961 | Estuarine Water | MPIHRATGPRGGKGYQYGKTGKVYPTRAGAVAQARAIRASQANAAKKKK |
| Ga0222714_101431412 | 3300021961 | Estuarine Water | MPIHKATGPHGGKGYQYGKSGKVYPTRAGAVAQARAIRASQANAAKKKK |
| Ga0222713_103526312 | 3300021962 | Estuarine Water | MPIHKATGPRGGKGWQYGEHGKVYPTRAQAVRQAQAIKASQAAAKEKKGR |
| Ga0222713_104994182 | 3300021962 | Estuarine Water | MPVHRATGPRGGKGWQYGQSGKVYPTRQQAVKQAQAIKASQAAAKKKK |
| Ga0222712_100812992 | 3300021963 | Estuarine Water | MPIHKATGPRGGKGYQYGTHGKVYPTRAQAVKQAQAIKASQAAAKKKK |
| Ga0222712_101939653 | 3300021963 | Estuarine Water | MPIHKAKGPRGGKGYQYGTHGKVYPTKKQAIKQMVAIKISQGKIKPKTKR |
| Ga0222712_102104963 | 3300021963 | Estuarine Water | MPIHRATGPRGGKGWQYGESGKVYPTRAKAVKQAQAIKASQAAAKKKK |
| Ga0222712_103459562 | 3300021963 | Estuarine Water | MPIHKAKGPRGGTGYQYGQHGKVYPTKKQAIAQMVAIKISEGKIKPKAKKR |
| Ga0222712_103776851 | 3300021963 | Estuarine Water | MPIHRATGPGGGKGWQYGQQGKVYPTRAGAVKQAQAIKAGQARATKKKK |
| Ga0222712_107158231 | 3300021963 | Estuarine Water | MPIHKATGPRGGKGWQYGETGKVYPTRKQAVKQAQAIKASQAAAKKKK |
| Ga0196901_10908043 | 3300022200 | Aqueous | MPIHKATGPRGGKGWQYGESGKVYPTRKQAVKQAQAIKASQAAAKKKKXFVINPFKRDMY |
| Ga0228703_10490232 | 3300022747 | Freshwater | MPIHRATGPRGGKGWQYGTHGKVYPTRAQAVKQAQAIKASQAAAKKVKK |
| Ga0228702_11185592 | 3300022748 | Freshwater | MPIHRATGPRGGKGWQYGTHGKVYPTRAQAVKQAQAIKTSQAAAKKVKK |
| Ga0214923_102312543 | 3300023179 | Freshwater | MPIHKAKGPRGGKGFQYGTHGKVYPTRAGAVKQARAIKASQAAAKKK |
| Ga0255147_100113111 | 3300024289 | Freshwater | MPIHKAKGPKGGKGWQYGNSGKVYPTKAQAIKQMVAIKISQGKIKPKKKR |
| Ga0244775_101311313 | 3300024346 | Estuarine | MPIHRAKGPKGGKGWQYGQSGKVYSSRSQALKQMIAIKISQGKIKPKRKR |
| Ga0255173_10541702 | 3300024358 | Freshwater | MPIHKATGPRGGKGWQYGTHGKVYPTRQQAVRQAQAIKAAQARAKAKKS |
| Ga0255181_10721422 | 3300024502 | Freshwater | HKATGPRGGKGWQYGTHGKVYPTRQQAVRQAQAIKAAQARAKAKKS |
| Ga0209615_1024663 | 3300025075 | Freshwater | MPIHKATGLRGGKGFQYGTTGKVYPTRAQAVKQAQAIKASQAAAKKKK |
| Ga0209103_10374572 | 3300025080 | Freshwater | MPIHKATGPRGGKGFQYGTTGKVYPTRAQAVKQAQAIKASQAAAKKKK |
| Ga0208426_100005212 | 3300025451 | Aqueous | MPVHKAKGPRGGKGYQYGTSGKVYPTKAGAVAQARAIRANQANAKKKK |
| Ga0255170_10460272 | 3300026459 | Freshwater | MPIHKAKGPKGGKGWQYGKHGKVYPTKAQAVKQMVAIKISQGKIKPKKKR |
| Ga0209599_1000055629 | 3300027710 | Deep Subsurface | MPIHKAKGPRGGQGFQYGTTGKVYPTRRQAVAQARAIKASQAAAKRGKK |
| Ga0209297_10214415 | 3300027733 | Freshwater Lake | MPIHKATGPRGGKGFQYGTHGKVYPTRAQAVKQAQAIKASQAALKAKKKK |
| Ga0209297_13169112 | 3300027733 | Freshwater Lake | MPIHKAKGPRGGKGYQYGESGKVYPTKAQAIKQMVAIKISQGKIKPKKKK |
| Ga0209087_100231210 | 3300027734 | Freshwater Lake | MPIHKATGPRGGKGYQYGESGKVYPTKAQAIKQMVAIKISQGKIKPKKSK |
| Ga0209087_13526751 | 3300027734 | Freshwater Lake | MPIHKAKGPRGGKGYQYGTHGKVYPTKAQAIKQMVAIKISEGKIKPKKKSK |
| Ga0209296_12821061 | 3300027759 | Freshwater Lake | MPVHKATGPRGGKGYQYGTHGKVYPTKKQAVAQAVAIKISQAAAKKKK |
| Ga0209088_100154273 | 3300027763 | Freshwater Lake | MPIRKVTGPRGGKGYQYGESGKYYPGPGGRAKAVRQAQAIKASQAAAAKRKK |
| Ga0209088_100172013 | 3300027763 | Freshwater Lake | MPIHKAKGPRGGKGYQYGESGKVYPTKKQAIKQMVAIKISEGKIKVKKK |
| Ga0209088_101456572 | 3300027763 | Freshwater Lake | MPIHKAKGPRGGRGYQYGESGKVYPTKKQAIKQMVAIKISEGVIKVKKKK |
| Ga0209229_103896651 | 3300027805 | Freshwater And Sediment | MPIHKATGPRGGKGYQYGTSGKVYPTRAGAVKQAQAIKASQAAAKNKKK |
| Ga0209229_104443722 | 3300027805 | Freshwater And Sediment | MPIHRATGPRGGKGWQYGTTGKVYPTRPQAVRQAQAIKASQSRAKKAKK |
| Ga0209354_100689432 | 3300027808 | Freshwater Lake | MPIHRATGPKGGKGWQYGTSGKVYPTRAGAVRQAQAIKASQAAATKKKK |
| Ga0209354_103796971 | 3300027808 | Freshwater Lake | MPIHRATGPRGGKGYQYGSTGKVYPTRAQAVKQAQAIKASQAAAKKKK |
| Ga0209230_100000978 | 3300027836 | Freshwater And Sediment | MPVHKATGPRGGKGWQYGTTGKVYPTRAGAVRQAQAIKASQASTKQKKK |
| Ga0209230_100091903 | 3300027836 | Freshwater And Sediment | MPIHRATGPRGGKGYQYGTHGKVYPTRAQAVKQAQAIKASQAAAKKNK |
| Ga0209230_103651581 | 3300027836 | Freshwater And Sediment | MPIMRAKGPKGGKGYKYGKRGHVYPTKAGAIKQMVAIKISQGKIKPKKKR |
| Ga0304729_10246966 | 3300028392 | Freshwater Lake | MPIHRATGPRGGKGYQYGTSGKVYPTRAGAVRQAQAIKASQAAATKKKK |
| Ga0119944_10179392 | 3300029930 | Aquatic | MPIHRATGPRGGKGWQYGSSGKVYPTRSQAVRQAQAIKASQSRAEKAKDKK |
| Ga0315907_112100861 | 3300031758 | Freshwater | MPVHKAKGPRGGPGWQYGTTGKVYPTRKQAVRQAQAIKASQARAKQRKK |
| Ga0315899_109195811 | 3300031784 | Freshwater | MPIHKATGPRGGKGFQYGTSGKVYPTRAQAVRQAQAIKASQAAAKKKGNSRSK |
| Ga0315909_100422543 | 3300031857 | Freshwater | MPIHKATGPRGGKGWQYGSQGKVYPTRAGAVRQAQAIKASQAKTAKAKKK |
| Ga0315904_1001450015 | 3300031951 | Freshwater | MPIHKATGPRGGKGWQYGTSGKVYPTRAQAVRQAQAIKASQAAAKKKPNTRSK |
| Ga0315904_109030542 | 3300031951 | Freshwater | MPIHRATGPRGGKGWQYGKSGKVYPTRAGAVRQAQAIKASQSRAKKAKTK |
| Ga0315294_108120813 | 3300031952 | Sediment | MPIRKTTGPRGGKGYQYGTTGKVYPTRAGAERQAQAIKASQAATKKKK |
| Ga0315274_113389912 | 3300031999 | Sediment | MPIRKTTGPQGGKGWQYGTTGKVYPTRAGAVRQAQAIKASQAATKKKK |
| Ga0315284_113684682 | 3300032053 | Sediment | MPIRKTTGPRGGKGYQYGTTGKVYPTRAGAVRQAQAIKASQAATKKKK |
| Ga0315903_103534642 | 3300032116 | Freshwater | MPIHKATGPRGGKGFQYGTSGKVYPTRAQAVRQAQAIKASQAAAKKKGNSRSR |
| Ga0334987_0332609_192_344 | 3300034061 | Freshwater | MPIHRATGPRGGKGWQYGTTGKVYPTRSGAVRQAQAIKASQSAQKKAKTK |
| Ga0335027_0036573_35_190 | 3300034101 | Freshwater | MPVRKVQGPRGGVGYQYGTTGKIYPTRAQAVRKAQAIKASQSAARYGKPKK |
| Ga0335030_0541256_450_605 | 3300034103 | Freshwater | MPIQKARGPRGGKGFQYGSSGKVYPTKAQAVKQMVAIKISQGKIKPKGRKK |
| Ga0335031_0164779_1074_1220 | 3300034104 | Freshwater | MPVHKATGPRGGKGWQYGESGKVYPTRAKAVKQAQAIKASQAAAKKKK |
| ⦗Top⦘ |