| Basic Information | |
|---|---|
| Family ID | F076067 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 118 |
| Average Sequence Length | 43 residues |
| Representative Sequence | VPTLVVSALSTFDNKGLKKGKKEVSAFEKQIKGFGKTFAAVFS |
| Number of Associated Samples | 83 |
| Number of Associated Scaffolds | 118 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 99.15 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 93.22 % |
| Associated GOLD sequencing projects | 80 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (58.475 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (48.305 % of family members) |
| Environment Ontology (ENVO) | Unclassified (78.814 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (74.576 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 57.75% β-sheet: 0.00% Coil/Unstructured: 42.25% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 118 Family Scaffolds |
|---|---|---|
| PF05065 | Phage_capsid | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 118 Family Scaffolds |
|---|---|---|---|
| COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 61.02 % |
| Unclassified | root | N/A | 38.98 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000561|F21B_12116132 | Not Available | 586 | Open in IMG/M |
| 3300002408|B570J29032_109276263 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 667 | Open in IMG/M |
| 3300002408|B570J29032_109587706 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 905 | Open in IMG/M |
| 3300002835|B570J40625_100632826 | Not Available | 972 | Open in IMG/M |
| 3300003394|JGI25907J50239_1058309 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 776 | Open in IMG/M |
| 3300004123|Ga0066181_10089013 | Not Available | 845 | Open in IMG/M |
| 3300004769|Ga0007748_10804687 | Not Available | 607 | Open in IMG/M |
| 3300005517|Ga0070374_10343267 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 755 | Open in IMG/M |
| 3300005525|Ga0068877_10471692 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 698 | Open in IMG/M |
| 3300005581|Ga0049081_10189841 | Not Available | 740 | Open in IMG/M |
| 3300005584|Ga0049082_10094914 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1046 | Open in IMG/M |
| 3300005584|Ga0049082_10239471 | Not Available | 614 | Open in IMG/M |
| 3300005805|Ga0079957_1220142 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 901 | Open in IMG/M |
| 3300005943|Ga0073926_10126747 | Not Available | 533 | Open in IMG/M |
| 3300006484|Ga0070744_10163614 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 637 | Open in IMG/M |
| 3300006802|Ga0070749_10234313 | Not Available | 1044 | Open in IMG/M |
| 3300006802|Ga0070749_10655184 | Not Available | 563 | Open in IMG/M |
| 3300007670|Ga0102862_1171117 | Not Available | 559 | Open in IMG/M |
| 3300008108|Ga0114341_10369676 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 710 | Open in IMG/M |
| 3300008120|Ga0114355_1094580 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1192 | Open in IMG/M |
| 3300008266|Ga0114363_1247325 | Not Available | 944 | Open in IMG/M |
| 3300009180|Ga0114979_10459443 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 739 | Open in IMG/M |
| 3300010160|Ga0114967_10356421 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 738 | Open in IMG/M |
| 3300011011|Ga0139556_1077100 | Not Available | 504 | Open in IMG/M |
| 3300011738|Ga0120086_100581 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3336 | Open in IMG/M |
| 3300012702|Ga0157596_1069550 | All Organisms → Viruses → Predicted Viral | 4080 | Open in IMG/M |
| 3300012720|Ga0157613_1049768 | All Organisms → Viruses → Predicted Viral | 1577 | Open in IMG/M |
| 3300012723|Ga0157604_1028464 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2813 | Open in IMG/M |
| 3300013005|Ga0164292_10378153 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 950 | Open in IMG/M |
| 3300013372|Ga0177922_11014288 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1029 | Open in IMG/M |
| 3300013372|Ga0177922_11195847 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1040 | Open in IMG/M |
| 3300017701|Ga0181364_1026944 | Not Available | 935 | Open in IMG/M |
| 3300017701|Ga0181364_1038994 | Not Available | 760 | Open in IMG/M |
| 3300017701|Ga0181364_1070181 | Not Available | 536 | Open in IMG/M |
| 3300017716|Ga0181350_1063621 | Not Available | 958 | Open in IMG/M |
| 3300017716|Ga0181350_1126436 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 610 | Open in IMG/M |
| 3300017722|Ga0181347_1052254 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1232 | Open in IMG/M |
| 3300017722|Ga0181347_1102485 | Not Available | 815 | Open in IMG/M |
| 3300017722|Ga0181347_1188414 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 547 | Open in IMG/M |
| 3300017722|Ga0181347_1198480 | Not Available | 528 | Open in IMG/M |
| 3300017723|Ga0181362_1025115 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1275 | Open in IMG/M |
| 3300017723|Ga0181362_1039196 | Not Available | 1000 | Open in IMG/M |
| 3300017736|Ga0181365_1064532 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 906 | Open in IMG/M |
| 3300017736|Ga0181365_1080349 | Not Available | 799 | Open in IMG/M |
| 3300017747|Ga0181352_1148728 | Not Available | 621 | Open in IMG/M |
| 3300017761|Ga0181356_1071598 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1163 | Open in IMG/M |
| 3300017761|Ga0181356_1096737 | Not Available | 965 | Open in IMG/M |
| 3300017761|Ga0181356_1126422 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 811 | Open in IMG/M |
| 3300017766|Ga0181343_1215142 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 524 | Open in IMG/M |
| 3300017774|Ga0181358_1098538 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1050 | Open in IMG/M |
| 3300017774|Ga0181358_1114978 | Not Available | 951 | Open in IMG/M |
| 3300017774|Ga0181358_1163789 | Not Available | 750 | Open in IMG/M |
| 3300017774|Ga0181358_1242396 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 571 | Open in IMG/M |
| 3300017774|Ga0181358_1265295 | Not Available | 535 | Open in IMG/M |
| 3300017777|Ga0181357_1132345 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 929 | Open in IMG/M |
| 3300017777|Ga0181357_1134124 | Not Available | 922 | Open in IMG/M |
| 3300017777|Ga0181357_1148829 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 864 | Open in IMG/M |
| 3300017778|Ga0181349_1108599 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1032 | Open in IMG/M |
| 3300017778|Ga0181349_1111296 | Not Available | 1016 | Open in IMG/M |
| 3300017780|Ga0181346_1103561 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1103 | Open in IMG/M |
| 3300017780|Ga0181346_1131928 | Not Available | 949 | Open in IMG/M |
| 3300017780|Ga0181346_1325217 | Not Available | 516 | Open in IMG/M |
| 3300017784|Ga0181348_1239783 | Not Available | 632 | Open in IMG/M |
| 3300019784|Ga0181359_1061179 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1441 | Open in IMG/M |
| 3300019784|Ga0181359_1216506 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 606 | Open in IMG/M |
| 3300020048|Ga0207193_1100616 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2634 | Open in IMG/M |
| 3300020515|Ga0208234_1022581 | Not Available | 730 | Open in IMG/M |
| 3300020557|Ga0208231_1004524 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2760 | Open in IMG/M |
| 3300021091|Ga0194133_10077789 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2657 | Open in IMG/M |
| 3300021108|Ga0214162_1068708 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 575 | Open in IMG/M |
| 3300021962|Ga0222713_10451090 | Not Available | 780 | Open in IMG/M |
| 3300021962|Ga0222713_10828436 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 514 | Open in IMG/M |
| 3300022190|Ga0181354_1093545 | Not Available | 984 | Open in IMG/M |
| 3300022190|Ga0181354_1182290 | Not Available | 637 | Open in IMG/M |
| 3300022190|Ga0181354_1225961 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 545 | Open in IMG/M |
| 3300022190|Ga0181354_1231040 | Not Available | 536 | Open in IMG/M |
| 3300022407|Ga0181351_1125284 | Not Available | 957 | Open in IMG/M |
| 3300027114|Ga0208009_1029662 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1151 | Open in IMG/M |
| 3300027193|Ga0208800_1050982 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 562 | Open in IMG/M |
| 3300027586|Ga0208966_1170757 | Not Available | 567 | Open in IMG/M |
| 3300027631|Ga0208133_1025867 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1490 | Open in IMG/M |
| 3300027644|Ga0209356_1143298 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 671 | Open in IMG/M |
| 3300027656|Ga0209357_1066448 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1086 | Open in IMG/M |
| 3300027656|Ga0209357_1089876 | Not Available | 885 | Open in IMG/M |
| 3300027688|Ga0209553_1209386 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 630 | Open in IMG/M |
| 3300027689|Ga0209551_1245601 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 538 | Open in IMG/M |
| 3300027707|Ga0209443_1256254 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 595 | Open in IMG/M |
| 3300027710|Ga0209599_10204180 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 534 | Open in IMG/M |
| 3300027744|Ga0209355_1358711 | Not Available | 532 | Open in IMG/M |
| 3300027747|Ga0209189_1105441 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1256 | Open in IMG/M |
| 3300027759|Ga0209296_1247541 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 735 | Open in IMG/M |
| 3300027764|Ga0209134_10176073 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 737 | Open in IMG/M |
| 3300027777|Ga0209829_10218412 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 820 | Open in IMG/M |
| 3300027785|Ga0209246_10051663 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1585 | Open in IMG/M |
| 3300027785|Ga0209246_10363763 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 548 | Open in IMG/M |
| 3300027798|Ga0209353_10126746 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1146 | Open in IMG/M |
| 3300027798|Ga0209353_10195031 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 889 | Open in IMG/M |
| 3300027798|Ga0209353_10333348 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 637 | Open in IMG/M |
| 3300027969|Ga0209191_1172127 | Not Available | 870 | Open in IMG/M |
| 3300027974|Ga0209299_1267878 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 604 | Open in IMG/M |
| 3300028393|Ga0304728_1057082 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1598 | Open in IMG/M |
| 3300031746|Ga0315293_10836364 | Not Available | 671 | Open in IMG/M |
| 3300031772|Ga0315288_11047024 | Not Available | 721 | Open in IMG/M |
| 3300031857|Ga0315909_10272640 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1283 | Open in IMG/M |
| 3300031952|Ga0315294_11436264 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 544 | Open in IMG/M |
| 3300032516|Ga0315273_11315087 | Not Available | 902 | Open in IMG/M |
| 3300033993|Ga0334994_0055773 | All Organisms → Viruses → Predicted Viral | 2447 | Open in IMG/M |
| 3300034062|Ga0334995_0429451 | Not Available | 817 | Open in IMG/M |
| 3300034062|Ga0334995_0822308 | Not Available | 506 | Open in IMG/M |
| 3300034092|Ga0335010_0459395 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 680 | Open in IMG/M |
| 3300034092|Ga0335010_0517968 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 623 | Open in IMG/M |
| 3300034102|Ga0335029_0545341 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 663 | Open in IMG/M |
| 3300034104|Ga0335031_0333868 | Not Available | 974 | Open in IMG/M |
| 3300034106|Ga0335036_0253845 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1189 | Open in IMG/M |
| 3300034106|Ga0335036_0291718 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1087 | Open in IMG/M |
| 3300034119|Ga0335054_0658636 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 566 | Open in IMG/M |
| 3300034120|Ga0335056_0262061 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 972 | Open in IMG/M |
| 3300034283|Ga0335007_0091907 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2262 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 48.31% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 13.56% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 6.78% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 3.39% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 3.39% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.54% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 2.54% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 2.54% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.54% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.69% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.69% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.69% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.69% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.69% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.85% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.85% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.85% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.85% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.85% |
| Mine Pit Pond | Environmental → Terrestrial → Geologic → Mine → Unclassified → Mine Pit Pond | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000561 | Amended soil microbial communities from Kansas Great Prairies, USA - acetate DNA F2.1B clc assemly | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300004123 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (version 2) | Environmental | Open in IMG/M |
| 3300004769 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300005943 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14 | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300007670 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-3 | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300011011 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300011738 | Mine pit pond microbial communities from Vermont, USA - 1M | Environmental | Open in IMG/M |
| 3300012702 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES114 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012720 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES141 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012723 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES129 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020515 | Freshwater microbial communities from Lake Mendota, WI - 27SEP2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020557 | Freshwater microbial communities from Lake Mendota, WI - 15JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021091 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015055 Kigoma Offshore 40m | Environmental | Open in IMG/M |
| 3300021108 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300027114 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes) | Environmental | Open in IMG/M |
| 3300027193 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 (SPAdes) | Environmental | Open in IMG/M |
| 3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
| 3300027644 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027656 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027688 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027689 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027707 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes) | Environmental | Open in IMG/M |
| 3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
| 3300027744 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027747 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027777 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027974 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028393 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034119 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166 | Environmental | Open in IMG/M |
| 3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F21B_121161322 | 3300000561 | Soil | VPTLVVSALSTFDNKGLKKAKKEVSAFDKQIKSFAKVFATA |
| B570J29032_1092762632 | 3300002408 | Freshwater | MANLIVSAVSTFDNKGLKKGKKEISTFEKQVKSFAKVFATAFSVR |
| B570J29032_1095877062 | 3300002408 | Freshwater | VPNLIVSAVSTFDNKGLKKGKKEISAFDKNVQSLGKTFAKVFGSI |
| B570J40625_1006328262 | 3300002835 | Freshwater | VPTLVVSALSTFDNKGLKKGKKEVSAFEKQIKSFAKVFATA |
| JGI25907J50239_10583092 | 3300003394 | Freshwater Lake | VPNLIVSAVSTFDNKGLKKGKKEISAFDKNVQSLGKTFAKV |
| Ga0066181_100890131 | 3300004123 | Freshwater Lake | VPTLVVSALSTFDNKGLKKAKKEVSAFDKQIKSFAKVFAT |
| Ga0007748_108046871 | 3300004769 | Freshwater Lake | VPTLVVSALSTFDNKGLKKGKKEVSAFEKQIKSFGKVFAGVFSATALLNY |
| Ga0070374_103432672 | 3300005517 | Freshwater Lake | VPNLIVSAVSTFDNKGLKKGKKEISAFDKNVQSLGKTF |
| Ga0068877_104716922 | 3300005525 | Freshwater Lake | MANLIVSAVSTFDNKGLKKGKKELTAFEQTVNKLGKTFASVFAAR |
| Ga0049081_101898411 | 3300005581 | Freshwater Lentic | MPTLVVSALSTFDNKGLKKAKKEVSAFEKQVKNFGKVFAGVFGAQQLLSFS |
| Ga0049082_100949143 | 3300005584 | Freshwater Lentic | VANVVVSAVSTFDNKGLKKGKKEVSAFEKQIKGFGKTFAAVFSATALLN |
| Ga0049082_102394711 | 3300005584 | Freshwater Lentic | VPTLVVSALSTFDNKGLKKGKKEVSAFEKQIKGFGKTFAAVFSATALLN |
| Ga0079957_12201422 | 3300005805 | Lake | VANLIVSAVSTFDNKGLKKGKKEITAFEQTVNKLGK |
| Ga0073926_101267472 | 3300005943 | Sand | VPTLVVSALSTFDNKGLKKAKKEVSAFDKQLKSFAKVFATAFSVTA |
| Ga0070744_101636142 | 3300006484 | Estuarine | VPNLIVSAVSTFDNKGLKKGTKEISAFDKNVKKLGKTFAKTFAGYQLL |
| Ga0070749_102343133 | 3300006802 | Aqueous | VANIVVSALSTFNNKGLKKGKKEIGIFEKQIKSCQRTFLAAFSVTALT |
| Ga0070749_106551841 | 3300006802 | Aqueous | MANIVVSALSTFNNKGLKKGKKEIGIFEKQVKTFGKT |
| Ga0102862_11711171 | 3300007670 | Estuarine | VPTIVASVLSTFDNKGLKKGKKEISAFDKNLKALGKTSAKVFGSLA |
| Ga0114341_103696761 | 3300008108 | Freshwater, Plankton | VANLIVSAVSTFDNKGLKKGKKEITAFEQTVNKLGKTFASVF |
| Ga0114355_10945801 | 3300008120 | Freshwater, Plankton | VANLIVSAVSTFDNKGLKKGKKELTAFEQTVNKLG |
| Ga0114363_12473253 | 3300008266 | Freshwater, Plankton | MANIVVSALSTFNNKGLKKGKKEISVFEKQVKNFGRTFAAAFSVTALTRFGKEA |
| Ga0114979_104594432 | 3300009180 | Freshwater Lake | MANLIVSAVSTFDNKGLKKGQKEISAFDKTVKTLGKTFLGVFGAQKLLA |
| Ga0114967_103564212 | 3300010160 | Freshwater Lake | MANLVVSAVSTFDNKGLKKGQKEISAFEKNLKSLGKTF |
| Ga0139556_10771001 | 3300011011 | Freshwater | VPTLVVSALSTFDNKGLKKAKKEVSAFDKQIKSFAKVFATAFSVTALS |
| Ga0120086_1005811 | 3300011738 | Mine Pit Pond | VANLIVSAVSTFDNKGLKKGQKEIGAFDKTLKTLGKTFAG |
| Ga0157596_10695501 | 3300012702 | Freshwater | MANIVVSALSTFNNKGLKKGKKEISAFEKQVKNFGRTFAAAFS |
| Ga0157613_10497681 | 3300012720 | Freshwater | MANIVVSALSTFNNKGLKKGKKEISAFEKQVKNFGRTFAA |
| Ga0157604_10284648 | 3300012723 | Freshwater | MASLVVSALSTWSNKGLKKAEKDVSAFDKTVKNLGKTFAGVFAASTILNFSK |
| Ga0164292_103781531 | 3300013005 | Freshwater | VPNLIVSAVSTFDNKGLKKAKKEVSTFEKQIKSFAKVFAAA |
| Ga0177922_110142881 | 3300013372 | Freshwater | VPNLIVSAVSTFDNKGLKKGTKEISAFEKRVKSFAKVFAAAFS |
| Ga0177922_111958471 | 3300013372 | Freshwater | MANIVVSAVSTFDNKGLKKGKKEVSAFEKQVKTFGKTFAAVFSARALFNYSKN |
| Ga0181364_10269441 | 3300017701 | Freshwater Lake | VANVVVAATSTFDNKGLKKGKKEVSAFDKQVKKFGKTFAAVFSATALFN |
| Ga0181364_10389942 | 3300017701 | Freshwater Lake | VPTLVVSALSTFDNKGLKKGKKEVSAFEKQIKGFGK |
| Ga0181364_10701812 | 3300017701 | Freshwater Lake | VPTIVASVLSTFDNKGLKKGKKEISAFDKNLKALGKTSA |
| Ga0181350_10636213 | 3300017716 | Freshwater Lake | MPTIVASVLSTFDNKGLKKGKKEITAFEKQVKGFGKTFTKVFAGVAVAAF |
| Ga0181350_11264362 | 3300017716 | Freshwater Lake | VPNLIVSAVSTFDNKGLKKGKKEISAFDKNVQSLGKTFAK |
| Ga0181347_10522541 | 3300017722 | Freshwater Lake | MPNLIVSAVSTFDNKGLKKGKKEITAFEKQVKGFGKTFTKVFAGVAVA |
| Ga0181347_11024851 | 3300017722 | Freshwater Lake | VPTLVVSALSTFDNKGLKKGKKEVSAFEKQIKGFGKTFAAVFS |
| Ga0181347_11884142 | 3300017722 | Freshwater Lake | VPNLIVSAVSTFDNKGLKKGRKEVSAFDKQVKKFGKTFAAVFSATALFNYSKNAV |
| Ga0181347_11984802 | 3300017722 | Freshwater Lake | VPTIVASVLSTFDNKGLKKGKKEISAFDKNLKALGK |
| Ga0181362_10251151 | 3300017723 | Freshwater Lake | MPNLIVSAVSTFDNKGLKKGKKEVSAFEKQIKGFGKTFAAVFSATAL |
| Ga0181362_10391961 | 3300017723 | Freshwater Lake | VPTIVASVLSTFDNKGLKKGKKEISAFDKNLKALGKTSAKVFGSLAV |
| Ga0181365_10645321 | 3300017736 | Freshwater Lake | MPNLIVSAVSTFDNKGLKKGQKEISAFDKRVKSLGKTFASVFAV |
| Ga0181365_10803491 | 3300017736 | Freshwater Lake | VPTLVVSALSTFDNKGLKKGKKEVSAFEKQIKGFGKTFA |
| Ga0181352_11487282 | 3300017747 | Freshwater Lake | MANIVVSALSTFNNKGLKKGKKEISVFEKQVKNFGRTFAAAFSVTL |
| Ga0181356_10715983 | 3300017761 | Freshwater Lake | VPNLIVSAVSTFDNKGLKKGKKEVSAFEKQIKSFAKVFAAAFSVTALTNYSKKAV |
| Ga0181356_10967371 | 3300017761 | Freshwater Lake | MPTIVASVLSTFDNKGLKKGKKEVSAFEKQIKGFGKTFAAVF |
| Ga0181356_11264223 | 3300017761 | Freshwater Lake | MPNLIVSAVSTFDNKGLKKGKKEVSAFEKQIKGFGKTFAAVFSATALLN |
| Ga0181343_12151422 | 3300017766 | Freshwater Lake | VPNLIVSAVSTFDNKGLKKGKKEVSAFEKQIKSFAKVFAAAFSVTALTNYSKK |
| Ga0181358_10985381 | 3300017774 | Freshwater Lake | MPNLIVSAVSTFDNKGLKKGKKELTAFEKQVKSFGKTFAAVFS |
| Ga0181358_11149783 | 3300017774 | Freshwater Lake | MPTIVASVLSTFDNKGLKKGKKEVSAFEKQIKGFGKTFAAVFSATALL |
| Ga0181358_11637892 | 3300017774 | Freshwater Lake | VPTIVASVLSTFDNKGLKKGKKEITAFEKQVKGFGKTFT |
| Ga0181358_12423961 | 3300017774 | Freshwater Lake | VANLIVSAVSTFDNKGLKKGQKEIGAFDKQVNKLGKTFAGVFGVF |
| Ga0181358_12652952 | 3300017774 | Freshwater Lake | VANVVVAATSTFDNKGLKKGKKEVSAFDKQVKKFGKT |
| Ga0181357_11323453 | 3300017777 | Freshwater Lake | MPNLIVSAVSTFDNKGLKKGKKEVSAFEKQIKGFGK |
| Ga0181357_11341243 | 3300017777 | Freshwater Lake | VPTIVASVLSTFDNKGLKKGKKEITAFEKQVKGFGKTFTK |
| Ga0181357_11488291 | 3300017777 | Freshwater Lake | VPNLIVSAVSTFDNKGLKKGKKEISAFDKNVQSLGK |
| Ga0181349_11085991 | 3300017778 | Freshwater Lake | MPTIVASVLSTFDNKGLKKGKKEITAFEKQVKGFGKTFTKV |
| Ga0181349_11112961 | 3300017778 | Freshwater Lake | VPTLVVSALSTFDNKGLKKGKKEVSAFEKQIKGFGKTFTK |
| Ga0181346_11035613 | 3300017780 | Freshwater Lake | VPNLIVSAVSTFDNKGLKKGKKEVSAFEKQIKSFA |
| Ga0181346_11319281 | 3300017780 | Freshwater Lake | MPTIVASVLSTFDNKGLKKGKKEVSAFEKQIKGFGK |
| Ga0181346_13252171 | 3300017780 | Freshwater Lake | VPTLVVSALSTFDNKGLKKGKKEVAAFEKQVKSFGKVFAGVFSATALLNYSK |
| Ga0181348_12397832 | 3300017784 | Freshwater Lake | VPTIVASVLSTFDNKGLKKGKKEITAFEKQVKGFG |
| Ga0181359_10611791 | 3300019784 | Freshwater Lake | VPNLIVSAVSTFDNKGLKKGKKEISAFDKNVQSLGKTFA |
| Ga0181359_12165061 | 3300019784 | Freshwater Lake | VPNLIVSAVSTFDNKGLKKGTKEISAFEKRVKSFAKVFAAAFSARAL |
| Ga0207193_11006167 | 3300020048 | Freshwater Lake Sediment | VANLIVSAVSTFDNKGLKKGQKEISAFDKTLKSLGKTFASVFAVGAI |
| Ga0208234_10225811 | 3300020515 | Freshwater | VANIVVSALSTFNNKGLKKGKKEIGIFEKQVKSFQRTFLAAFSVTALTRFSKEAVKA |
| Ga0208231_10045247 | 3300020557 | Freshwater | VANLIVSAVSTFDNKGLKKGQKEVSVFEKQVKNFGKVF |
| Ga0194133_100777891 | 3300021091 | Freshwater Lake | MPTLVVSALSTFDNKGLKKGRKEVAGFDKQLKTFA |
| Ga0214162_10687081 | 3300021108 | Freshwater | VPNLIVSAVSTFDNKGLKKGKKEISAFDKNVQSLGKTFAKVF |
| Ga0222713_104510901 | 3300021962 | Estuarine Water | VPTLVVSALSTFDNKGLKKAKKEVSAFEKQVKNFSKVFAGVF |
| Ga0222713_108284362 | 3300021962 | Estuarine Water | VPNLIVSAVSTFDNRGLKKGQKEIGAFDRTLKSLGKTFAGVF |
| Ga0181354_10935453 | 3300022190 | Freshwater Lake | VPTLVVSALSTFDNKGLKKGKKEVSAFEKQIKGFGKT |
| Ga0181354_11822902 | 3300022190 | Freshwater Lake | VANVVVAATSTFDNKGLKKGKKEVSAFDKQVKKFGKTFAAVFSATALFNYSKNAVKV |
| Ga0181354_12259612 | 3300022190 | Freshwater Lake | VPNLIVSAVSTFDNKGLKKGKKEISAFDKNVQSLA |
| Ga0181354_12310401 | 3300022190 | Freshwater Lake | VPTLVVSALSTFDNKGLKKGKKEVSAFEKQIKSFGKVFAGVFSAT |
| Ga0181351_11252842 | 3300022407 | Freshwater Lake | MPTIVASVLSTFDNKGLKKGKKEVSAFEKQIKGFGKTFAA |
| Ga0208009_10296621 | 3300027114 | Deep Subsurface | VANLIVSAVSTFDNKGLKKGKKEITAFEQTVNKLGKTFASVFAAQ |
| Ga0208800_10509822 | 3300027193 | Estuarine | VPNLIVSAVSTFDNKGLKKGTKEISAFDKNVKNLGKT |
| Ga0208966_11707571 | 3300027586 | Freshwater Lentic | VPTLVVSALSTFDNKGLKKAKKEVSTFEKQIKSFAKVFGAAFSVTALTKY |
| Ga0208133_10258671 | 3300027631 | Estuarine | VPTIVASVLSTFDNKGLKKGKKEISAFDKNLKALG |
| Ga0209356_11432982 | 3300027644 | Freshwater Lake | MPNLIVSAVSTFDNKGLKKGKKEVSAFEKQIKGFGKTFAAVFSATALLNY |
| Ga0209357_10664481 | 3300027656 | Freshwater Lake | MPNLIVSAVSTFDNKGLKKGKKEVSAFEKQIKGFGKTFAAV |
| Ga0209357_10898761 | 3300027656 | Freshwater Lake | VPTLVVSALSTFDNKGLKKAKKEVSAFDKQIKSFAK |
| Ga0209553_12093861 | 3300027688 | Freshwater Lake | VPNLIVSAVSTFDNKGLKKGKKEISAFDKNVQSLGKTFAKVFG |
| Ga0209551_12456012 | 3300027689 | Freshwater Lake | VPNLIVSAVSTFDNKGLKKGKKEISAFDKNVQSLG |
| Ga0209443_12562541 | 3300027707 | Freshwater Lake | VPNLIVSAVSTFDNKGLKKGTKEISAFDKNVKKLGKTFAKTFAG |
| Ga0209599_102041801 | 3300027710 | Deep Subsurface | VANLIVSAVSTFDNKGLKKGQKEIGAFEKQVKSFGKVFAGVFSATAL |
| Ga0209355_13587111 | 3300027744 | Freshwater Lake | VANVVVAATSTFDNKGLKKGKKEVSAFDKQVKKFGKTFAAVFSATAL |
| Ga0209189_11054411 | 3300027747 | Freshwater Lake | MANLIVSAVSTFDNKGLKKGQKDISAFDKSVKSLGKTFAGVFGA |
| Ga0209296_12475411 | 3300027759 | Freshwater Lake | VPNLIVSAVSTFDNKGLKKGKKEISTFEKQIKSFAKVFAAAFSVNALTNYGKKAVNA |
| Ga0209134_101760732 | 3300027764 | Freshwater Lake | MPNLIVSAVSTFDNKGLKKGKKEISAFDKNVQSLGKTF |
| Ga0209829_102184123 | 3300027777 | Freshwater Lake | MANLVVSAVTTYNGKGLSKAKKDISAFDKTVNKLGKTFASVFAARELVAFG |
| Ga0209246_100516634 | 3300027785 | Freshwater Lake | VPTLVVSALSTFDNKGLKKGKKEVSAFEKQIKGFGKTFAAVFSA |
| Ga0209246_103637632 | 3300027785 | Freshwater Lake | VPNLIVSAVSTFDNKGLKKAKKEVSAFDKQIKSFAKVFATAFSVTALSK |
| Ga0209353_101267463 | 3300027798 | Freshwater Lake | VANVVVAATSTFDNKGLKKGKKEVSAFDKQVKKFGKTFAAVFSATALFNYSKNAVK |
| Ga0209353_101950311 | 3300027798 | Freshwater Lake | VPNLIVSAVSTFDNKGLKKGKKEVSAFEKQIKSFAKVFAA |
| Ga0209353_103333481 | 3300027798 | Freshwater Lake | VPNLIVSAVSTFDNKGLKKGTKEISAFEKRVKSFAKVFAAAFSARALT |
| Ga0209191_11721271 | 3300027969 | Freshwater Lake | VPTLVVSALSTFDNKGLKKGKKEVSAFEKQIKSFGKVFAGVF |
| Ga0209299_12678782 | 3300027974 | Freshwater Lake | VPNLIVSAVSTFDNKGLKKGNKEVSAFEKRVKSFAKVFAAAFSARALTNF |
| Ga0304728_10570821 | 3300028393 | Freshwater Lake | MANLVVSAVSTFDNKGLKKGQKEISAFEKNLKSLGKTFGIAFGAAAIVNYG |
| Ga0315293_108363642 | 3300031746 | Sediment | VPTLVVSALSTFDNKGLKKAKKEVSAFDKQIKSFAKVF |
| Ga0315288_110470241 | 3300031772 | Sediment | VPTLVVSALSTFDNKGLKKAKKEVSAFDKQIKSFA |
| Ga0315909_102726404 | 3300031857 | Freshwater | MANIVVSAVSTFDNKGLKKGQKEVSKFEKQVKSFAKVFA |
| Ga0315294_114362641 | 3300031952 | Sediment | VPNLIVSAVSTFDNKGLKKGRKEVSAFEKQVKSFGKTFGTV |
| Ga0315273_113150873 | 3300032516 | Sediment | VPTIVASVLSTFDNKGLKKGKKEVSAFEKQIKTFGKTFAAVFSARALFNY |
| Ga0334994_0055773_1_141 | 3300033993 | Freshwater | VANIVVSALSTFNNKGLKKGKKEIGIFEKQLKSFQRTFLAAFSVTAL |
| Ga0334995_0429451_2_154 | 3300034062 | Freshwater | VPTLVVSALSTFDNKGLKKAKKEVSAFDKQLKTFAKTFATAFSVTALTRFG |
| Ga0334995_0822308_3_119 | 3300034062 | Freshwater | MANLIVSAVSTFDNKGLKKGKKELTAFEQTVNKLGKTFA |
| Ga0335010_0459395_562_678 | 3300034092 | Freshwater | VANLIVSAVSTFDNKGLKKGQKEVSAFDKQLKKLGSTFA |
| Ga0335010_0517968_491_622 | 3300034092 | Freshwater | VANLIVSAVSTFDNKGLKKGQKEIGAFDKQVNKLGKTFAGVFGA |
| Ga0335029_0545341_537_662 | 3300034102 | Freshwater | MASLVVSALSTWSNKGLKKAEKDVSAFDKTVKNLGKTFAGVF |
| Ga0335031_0333868_812_973 | 3300034104 | Freshwater | MANIVVSALSTFNNKGLKKGKKEISAFEKQVKTFGRTFAAAFSVTALTRFSREA |
| Ga0335036_0253845_1075_1188 | 3300034106 | Freshwater | MPNLIVSAVSTFDNKGLKKGKKEISTFEKQIKSFAKVF |
| Ga0335036_0291718_977_1087 | 3300034106 | Freshwater | MANLIVSAVSTFDNKGLKKGQKEISAFDKTVKALGKT |
| Ga0335054_0658636_3_131 | 3300034119 | Freshwater | VANLIVSAVSTFDNKGLKKGKKEITAFEQTVNKLGKTFASVFA |
| Ga0335056_0262061_821_970 | 3300034120 | Freshwater | VPNLIVSAVSTFDNRGLKKGQKEISSFDKSLKKLAGTFATVFGAQKLLQF |
| Ga0335007_0091907_2108_2260 | 3300034283 | Freshwater | VANLIVSAVSTFDNKGLKKGQKQISAFDKQVSKLGKTFAGVFGAQALYNYG |
| ⦗Top⦘ |