NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F074317

Metagenome / Metatranscriptome Family F074317

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F074317
Family Type Metagenome / Metatranscriptome
Number of Sequences 119
Average Sequence Length 43 residues
Representative Sequence MAFPVRTCALVGRFADPRVAESVGALLPHLQSRGVQVLV
Number of Associated Samples 109
Number of Associated Scaffolds 119

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 93.22 %
% of genes near scaffold ends (potentially truncated) 98.32 %
% of genes from short scaffolds (< 2000 bps) 88.24 %
Associated GOLD sequencing projects 107
AlphaFold2 3D model prediction Yes
3D model pTM-score0.58

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.639 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(26.891 % of family members)
Environment Ontology (ENVO) Unclassified
(23.529 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(44.538 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 23.88%    β-sheet: 8.96%    Coil/Unstructured: 67.16%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.58
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 119 Family Scaffolds
PF03444HrcA_DNA-bdg 68.07
PF01628HrcA 12.61
PF01025GrpE 3.36
PF00012HSP70 3.36
PF01513NAD_kinase 0.84

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 119 Family Scaffolds
COG2524Predicted transcriptional regulator, contains C-terminal CBS domainsTranscription [K] 68.07
COG1420Transcriptional regulator of heat shock responseTranscription [K] 12.61
COG0443Molecular chaperone DnaK (HSP70)Posttranslational modification, protein turnover, chaperones [O] 3.36
COG0576Molecular chaperone GrpE (heat shock protein HSP-70)Posttranslational modification, protein turnover, chaperones [O] 3.36

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.64 %
UnclassifiedrootN/A3.36 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000955|JGI1027J12803_101435231All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae2659Open in IMG/M
3300001213|JGIcombinedJ13530_109668690All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300003331|Ga0006572J49612_1046118All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300005187|Ga0066675_11127687All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300005435|Ga0070714_100990243All Organisms → cellular organisms → Bacteria → Proteobacteria818Open in IMG/M
3300005458|Ga0070681_10315619All Organisms → cellular organisms → Bacteria → Proteobacteria1472Open in IMG/M
3300005539|Ga0068853_101480024All Organisms → cellular organisms → Bacteria657Open in IMG/M
3300005616|Ga0068852_101514585All Organisms → cellular organisms → Bacteria693Open in IMG/M
3300005617|Ga0068859_103142733All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300005719|Ga0068861_102220621All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300005764|Ga0066903_103027601All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria910Open in IMG/M
3300005921|Ga0070766_10099440All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1720Open in IMG/M
3300005921|Ga0070766_10962611All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300009143|Ga0099792_10287324All Organisms → cellular organisms → Bacteria971Open in IMG/M
3300009826|Ga0123355_10676339All Organisms → cellular organisms → Bacteria1195Open in IMG/M
3300009870|Ga0131092_10149480All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2574Open in IMG/M
3300010048|Ga0126373_12335032All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300010333|Ga0134080_10304025All Organisms → cellular organisms → Bacteria716Open in IMG/M
3300010358|Ga0126370_11333307All Organisms → cellular organisms → Bacteria674Open in IMG/M
3300010359|Ga0126376_10619053All Organisms → cellular organisms → Bacteria1027Open in IMG/M
3300010359|Ga0126376_13156424Not Available510Open in IMG/M
3300010360|Ga0126372_11526920All Organisms → cellular organisms → Bacteria705Open in IMG/M
3300010376|Ga0126381_104529409Not Available536Open in IMG/M
3300010398|Ga0126383_11913852All Organisms → cellular organisms → Bacteria681Open in IMG/M
3300010399|Ga0134127_11584575All Organisms → cellular organisms → Bacteria729Open in IMG/M
3300010880|Ga0126350_10067615All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300012925|Ga0137419_10019297All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales3941Open in IMG/M
3300012971|Ga0126369_13062404All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300012971|Ga0126369_13665121All Organisms → cellular organisms → Bacteria → Proteobacteria503Open in IMG/M
3300012988|Ga0164306_10581925All Organisms → cellular organisms → Bacteria874Open in IMG/M
3300013105|Ga0157369_11492657All Organisms → cellular organisms → Bacteria688Open in IMG/M
3300013296|Ga0157374_10426560All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Ferrovales → Ferrovaceae → Ferrovum → Ferrovum myxofaciens1325Open in IMG/M
3300014201|Ga0181537_10635412All Organisms → cellular organisms → Bacteria727Open in IMG/M
3300014658|Ga0181519_10825182All Organisms → cellular organisms → Bacteria → Proteobacteria573Open in IMG/M
3300014658|Ga0181519_10906117All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300014969|Ga0157376_10441829All Organisms → cellular organisms → Bacteria1267Open in IMG/M
3300015080|Ga0167639_1034407All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300016294|Ga0182041_10515284All Organisms → cellular organisms → Bacteria1039Open in IMG/M
3300016357|Ga0182032_11643963All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300016371|Ga0182034_11088516All Organisms → cellular organisms → Bacteria692Open in IMG/M
3300018001|Ga0187815_10290544All Organisms → cellular organisms → Bacteria693Open in IMG/M
3300018060|Ga0187765_10084294All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1703Open in IMG/M
3300018060|Ga0187765_10583695All Organisms → cellular organisms → Bacteria719Open in IMG/M
3300018060|Ga0187765_10922509All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300018086|Ga0187769_11064692All Organisms → cellular organisms → Bacteria612Open in IMG/M
3300018090|Ga0187770_10058899All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2785Open in IMG/M
3300018429|Ga0190272_13325394All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300018482|Ga0066669_10242289All Organisms → cellular organisms → Bacteria1418Open in IMG/M
3300020027|Ga0193752_1346160All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300020202|Ga0196964_10539199All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300020579|Ga0210407_10080359All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2457Open in IMG/M
3300020582|Ga0210395_10968353All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300021171|Ga0210405_10476253Not Available980Open in IMG/M
3300021362|Ga0213882_10389581All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300021402|Ga0210385_10635911All Organisms → cellular organisms → Bacteria → Proteobacteria815Open in IMG/M
3300021402|Ga0210385_10938251All Organisms → cellular organisms → Bacteria665Open in IMG/M
3300021404|Ga0210389_10603979All Organisms → cellular organisms → Bacteria862Open in IMG/M
3300021405|Ga0210387_11785884All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300021420|Ga0210394_10036105All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria4399Open in IMG/M
3300021441|Ga0213871_10079639All Organisms → cellular organisms → Bacteria937Open in IMG/M
3300021444|Ga0213878_10491249All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300021560|Ga0126371_11059631All Organisms → cellular organisms → Bacteria951Open in IMG/M
3300023275|Ga0247776_10091331All Organisms → cellular organisms → Bacteria1182Open in IMG/M
3300025862|Ga0209483_1213001All Organisms → cellular organisms → Bacteria764Open in IMG/M
3300025885|Ga0207653_10065609All Organisms → cellular organisms → Bacteria1233Open in IMG/M
3300025910|Ga0207684_11521364All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300025916|Ga0207663_11541108All Organisms → cellular organisms → Bacteria → Proteobacteria535Open in IMG/M
3300025920|Ga0207649_10401598All Organisms → cellular organisms → Bacteria1026Open in IMG/M
3300025949|Ga0207667_10183409All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2149Open in IMG/M
3300026328|Ga0209802_1027025All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria3061Open in IMG/M
3300026335|Ga0209804_1255611All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300026359|Ga0257163_1017166All Organisms → cellular organisms → Bacteria1115Open in IMG/M
3300027664|Ga0207873_1191859All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300027775|Ga0209177_10392873All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300027889|Ga0209380_10568130All Organisms → cellular organisms → Bacteria → Proteobacteria658Open in IMG/M
3300029882|Ga0311368_10379282All Organisms → cellular organisms → Bacteria1046Open in IMG/M
3300029951|Ga0311371_11020504All Organisms → cellular organisms → Bacteria981Open in IMG/M
3300030046|Ga0302305_1298570All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300030520|Ga0311372_10743727All Organisms → cellular organisms → Bacteria1356Open in IMG/M
3300030737|Ga0302310_10285617All Organisms → cellular organisms → Bacteria933Open in IMG/M
3300031057|Ga0170834_112162949All Organisms → cellular organisms → Bacteria735Open in IMG/M
3300031228|Ga0299914_10379201All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1237Open in IMG/M
3300031543|Ga0318516_10182050All Organisms → cellular organisms → Bacteria1210Open in IMG/M
3300031549|Ga0318571_10284328All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300031561|Ga0318528_10525142All Organisms → cellular organisms → Bacteria636Open in IMG/M
3300031640|Ga0318555_10053076All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans2063Open in IMG/M
3300031640|Ga0318555_10065791All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1865Open in IMG/M
3300031754|Ga0307475_10347550All Organisms → cellular organisms → Bacteria1192Open in IMG/M
3300031754|Ga0307475_11254980All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300031765|Ga0318554_10075531All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1873Open in IMG/M
3300031768|Ga0318509_10318318All Organisms → cellular organisms → Bacteria871Open in IMG/M
3300031768|Ga0318509_10749039All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300031771|Ga0318546_10880038All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300031780|Ga0318508_1012450All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1946Open in IMG/M
3300031832|Ga0318499_10065657All Organisms → cellular organisms → Bacteria1373Open in IMG/M
3300031879|Ga0306919_10774154All Organisms → cellular organisms → Bacteria738Open in IMG/M
3300031890|Ga0306925_11946521All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300031893|Ga0318536_10153299All Organisms → cellular organisms → Bacteria1171Open in IMG/M
3300031896|Ga0318551_10374779All Organisms → cellular organisms → Bacteria807Open in IMG/M
3300031897|Ga0318520_10214373All Organisms → cellular organisms → Bacteria1139Open in IMG/M
3300031910|Ga0306923_10214144All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2203Open in IMG/M
3300031945|Ga0310913_10301230All Organisms → cellular organisms → Bacteria1131Open in IMG/M
3300031947|Ga0310909_10972904All Organisms → cellular organisms → Bacteria694Open in IMG/M
3300031981|Ga0318531_10009724All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria3565Open in IMG/M
3300032041|Ga0318549_10549759All Organisms → cellular organisms → Bacteria → Proteobacteria518Open in IMG/M
3300032063|Ga0318504_10364628All Organisms → cellular organisms → Bacteria687Open in IMG/M
3300032066|Ga0318514_10211794All Organisms → cellular organisms → Bacteria1016Open in IMG/M
3300032067|Ga0318524_10641358All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300032089|Ga0318525_10009852All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria4280Open in IMG/M
3300032174|Ga0307470_10259672All Organisms → cellular organisms → Bacteria1153Open in IMG/M
3300032180|Ga0307471_101501555All Organisms → cellular organisms → Bacteria832Open in IMG/M
3300032205|Ga0307472_100471762All Organisms → cellular organisms → Bacteria1073Open in IMG/M
3300032828|Ga0335080_11903335All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300032895|Ga0335074_10800997All Organisms → cellular organisms → Bacteria879Open in IMG/M
3300032896|Ga0335075_10330428All Organisms → cellular organisms → Bacteria → Proteobacteria1677Open in IMG/M
3300032954|Ga0335083_11464145All Organisms → cellular organisms → Bacteria → Proteobacteria520Open in IMG/M
3300033158|Ga0335077_10856583All Organisms → cellular organisms → Bacteria920Open in IMG/M
3300033489|Ga0299912_10101867All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2515Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil26.89%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil8.40%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.04%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil4.20%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil4.20%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland4.20%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa4.20%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.36%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog2.52%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.52%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.52%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.52%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.52%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil1.68%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.68%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.68%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.84%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.84%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.84%
Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil0.84%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.84%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.84%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.84%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.84%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.84%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.84%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.84%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.84%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.84%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil0.84%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.84%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock0.84%
Termite GutHost-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut0.84%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.84%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.84%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.84%
Feedstock Adapted CompostEngineered → Solid Waste → Feedstock → Composting → Unclassified → Feedstock Adapted Compost0.84%
Activated SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge0.84%
Ionic Liquid And High Solid EnrichedEngineered → Lab Enrichment → Defined Media → Unclassified → Unclassified → Ionic Liquid And High Solid Enriched0.84%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.84%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300003331Ionic liquid and high solid enriched microbial communities from the Joint BioEnergy Institute, USA - AR20-2-R (Metagenome Metatranscriptome, Counting Only)EngineeredOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009826Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1Host-AssociatedOpen in IMG/M
3300009870Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plantEngineeredOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300014201Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaGEnvironmentalOpen in IMG/M
3300014658Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaGEnvironmentalOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015080Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6C, Proglacial plain, adjacent to northern proglacial tributary)EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300018001Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5EnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300020027Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c1EnvironmentalOpen in IMG/M
3300020202Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_10EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021362Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09EnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021441Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1Host-AssociatedOpen in IMG/M
3300021444Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02EnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300023275Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L199-509C-5EnvironmentalOpen in IMG/M
3300025862Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A (SPAdes)EnvironmentalOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026328Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes)EnvironmentalOpen in IMG/M
3300026335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes)EnvironmentalOpen in IMG/M
3300026359Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-AEnvironmentalOpen in IMG/M
3300027664Cellulose adapted compost microbial communities from Newby Island Compost Facility, Milpitas, CA, USA - BGW Initial Compost (SPAdes)EngineeredOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300029882III_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030046Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_3EnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030737Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031228Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031780Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300032896Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033489Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI1027J12803_10143523143300000955SoilMAFPVRTCALVGRFSDPRIAESVGALLPHLSRRGVRVLVSED
JGIcombinedJ13530_10966869013300001213WetlandMAFPVRTCALVGRFVDPRIAETVGALLPHLQRRGVAVLV
Ga0006572J49612_104611823300003331Ionic Liquid And High Solid EnrichedMAFPVRVCALVGRFTDPRVAESAATLVPHLRSRGVDVLLSEDAELGG
Ga0066675_1112768713300005187SoilMAFPVRCCALVGRFEDPRIAESVSALLPHLARRGVEVLVSEHNPPGVPGA
Ga0070714_10099024323300005435Agricultural SoilMAFSVRTCALVGRFSDPRIAESVGALLPHLHGRGVQVLVSATADLDSPIPQ
Ga0070681_1031561913300005458Corn RhizosphereMGFPVRVCALVGKFTDPRVAESAHALVPFLKSRKVDVILSEGAEFSD
Ga0068853_10148002423300005539Corn RhizosphereMALPVRTCALVGRFTDSRVAESAHALLAHLATRQVTVLVS
Ga0068852_10151458523300005616Corn RhizosphereMAFSVRTCALVGRFSDPRIAESVGALLPHLHGRGVQVL
Ga0068859_10314273313300005617Switchgrass RhizosphereMAFPVRACALIGRFTDPRVAESVGVLLPHLKARCSEVLVIDSGELPDWLDGDVVKL
Ga0068861_10222062123300005719Switchgrass RhizosphereMAFPVRACALVGRFADARVAESVSALLPRLKARCAQVLVIDNG
Ga0066903_10302760123300005764Tropical Forest SoilVASPVRTVALVGRFADPRIAEVVATLVPHLARRGVTVLVTEDAA
Ga0070766_1009944033300005921SoilMAFPVRVCAFVGRFADPRVQESVALLLPHLAGRGVEVLVSEEVPASA
Ga0070766_1096261123300005921SoilLAIGTCALVGRFPDARIAESVGALLPYLASRGVRALV
Ga0099792_1028732413300009143Vadose Zone SoilMAFPVRLCALVGRFSDPRVAESVNALIPHLLSREVKVI
Ga0123355_1067633923300009826Termite GutVAFPVRTCALVGRFADPRVAESVGALLPHLASRGVKVLVSTDAELAPGLPV
Ga0131092_1014948013300009870Activated SludgeMPLPARVCALVGRFEDQRAAESTAALLPHLAARGIEVLVAADAALPAGLGPV
Ga0126373_1233503213300010048Tropical Forest SoilMAFPVSSCAVVGRFTDARVAETVKALLPHLVSRGVQVL
Ga0134080_1030402523300010333Grasslands SoilMAFPVGCCALVGRFADPRIAESVGALLPHLAGRGVRVLVSENATLAAGAAGVV
Ga0126370_1133330723300010358Tropical Forest SoilMAFPVRTCALVGRFSDPRIAESVGALLPHLSSRGVRVLVSEDAELPAD
Ga0126376_1061905313300010359Tropical Forest SoilMAFPVRTCALVGRFADPRIAESVGALLPHLESRGVQVLV
Ga0126376_1315642423300010359Tropical Forest SoilMAFPVRTCALVGRFSDARIAESVGALLPHLTAAGVTVLVSEDAELGSPLAQRVP
Ga0126372_1152692013300010360Tropical Forest SoilMASPVRNVALVGRFADPRIAEVIASLVPHLVRRGVTVLASE
Ga0126381_10452940913300010376Tropical Forest SoilMTFPVRACALVGRFMDPRVAESVNALLLHLEERKIQ
Ga0126383_1191385213300010398Tropical Forest SoilMAFPVRTCALVGRFADPRVAESVGALLPHLQSRGVQV
Ga0134127_1158457523300010399Terrestrial SoilMAFPVRVCALIGKFTDARVAESAHALIPYLQSRQVDVLMSEDAPI
Ga0126350_1006761513300010880Boreal Forest SoilLVGRFPDARIAESVGALLPYLASRGVRALVAEEAVLGDAGRL
Ga0137419_1001929713300012925Vadose Zone SoilMAFPVRCCALVGRFEDPRIAESVSALLPHLASRGVR
Ga0126369_1306240423300012971Tropical Forest SoilMSFPVRSCALVGRFTDARVAETVNSLLPHLASRGVQVL
Ga0126369_1366512113300012971Tropical Forest SoilVAFPVRTCALVGRFADPRIAESVGALLPHLESRGVQVLVSEDAEL
Ga0164306_1058192513300012988SoilMAFSVRTCALVGRFSDQRIAESVGALLPHLHGRGVQVLVSATADLDSPIPQR
Ga0157369_1149265713300013105Corn RhizosphereMAFPVRVCALIGKFTDARVAESAHALIPYLQSRQVEVLMSEDAPIAEEPA
Ga0157374_1042656013300013296Miscanthus RhizosphereMAFPVRVCALIGKFTDARVAESADALIPYLQSRQVEVLMREDAPIAEEPAR
Ga0181537_1063541223300014201BogMGFPVQLCALIGRFSDTRVAESVHALVPHLLSSHVKVLVS
Ga0181519_1082518213300014658BogMGFPVRTCALVGRFSDPRIAESVAALLPHLGARGVTVLVSEDAPL
Ga0181519_1090611723300014658BogMAFPVRTCALVGRFADARVAESVATLVPHLAAAGVTVLAFAG
Ga0157376_1044182913300014969Miscanthus RhizosphereMGFPVRLCALVGRFSDPRVAESVNVLIPHLLSRQIQV
Ga0167639_103440723300015080Glacier Forefield SoilMAFPVRACALVGRFADPQVAEPLSVLVPHLQSRQVTVLVSEE
Ga0182041_1051528413300016294SoilMAFPVRTCALVGRFADPRVAESVGALLPHLQSRGVQVL
Ga0182032_1164396323300016357SoilMAFPVRTCALVGRFADPRVAESLGALLPHLSSRGVRVLVSENA
Ga0182034_1108851613300016371SoilMAFPVRTCALVGRFADPRIAESVAALLPHLASRRVEVLVSEDAELG
Ga0187815_1029054423300018001Freshwater SedimentMTLPVRTCALVGRFTDARVAESAHALLAHLATRQVRVL
Ga0187765_1008429413300018060Tropical PeatlandMAFPVRTCALVGRFADPRIAESVGALLPHLAKCGV
Ga0187765_1058369513300018060Tropical PeatlandVAFPVRTCALVGRFEDPRIAETLSALAAHLTSRGVRVLI
Ga0187765_1092250923300018060Tropical PeatlandMASPVRNVALVGRFADPRIAEVVATLVPYLTRRGVAVDLSIFRE
Ga0187769_1106469213300018086Tropical PeatlandMAFPVRTCAVVGRFADARVAESATALLAHLAARGV
Ga0187770_1005889943300018090Tropical PeatlandMAFPVRTCALVGRFADPRIAESVAALLPHLASRGVHVLVSEAAGLAAE
Ga0190272_1332539423300018429SoilMAFPVRVCALVGRFADPRVAESFAALFLHLQSRKVQVLV
Ga0066669_1024228923300018482Grasslands SoilMAFPVRCCALVGRFEDPRIAESVSALLPHLARRGVEVLVSEHNPPGVPGAGV
Ga0193752_134616013300020027SoilMGFPVRKCALIGRFVDPRVAESMSILLPHLKSRAVQV
Ga0196964_1053919923300020202SoilMSFPVRVCALVGRFADPRVAESAGVLVPHLVSRGVRILVADDAAIEPSRHVERAPE
Ga0210407_1008035943300020579SoilMAFPVRTCALVGRFSDARVAESVGALLPHLAAASVTVLVSED
Ga0210395_1096835313300020582SoilMAFPVRSCALVGRFGDPRVAETAATLLPYLAGRGVQVLV
Ga0210405_1047625313300021171SoilMAFPVRTCALVGRFSDARVAESVGALLPYLAAASVTV
Ga0213882_1038958113300021362Exposed RockMAFPVRRCALVGRFTDARVAESVQALFAHLARRGVEVLVG
Ga0210385_1063591123300021402SoilMAFPVRVCAFVGRFADPRVQESVALLLPHLAGRGVEVLVSEEVPASAG
Ga0210385_1093825113300021402SoilMAFPARVCAFIGRFADPRVQESLALLLPHLAASGVEVL
Ga0210389_1060397913300021404SoilMAFPVRTCALVGRFSDPRVAESVGALLPHLMSRGVRVLVNED
Ga0210387_1178588413300021405SoilMAFPVRTCALVGRFSDARVAESVGALLPYLAAASVTVLVSEDAQLSSPGVTR
Ga0210394_1003610513300021420SoilMAFPVRCCALVGRFADPRIAESVGALVPHLVSRGVEVLIGEDAGFGVAA
Ga0213871_1007963913300021441RhizosphereMAFPVRRCALVGRFTDARVAESVQALCAHLARRGVEVLVS
Ga0213878_1049124913300021444Bulk SoilMAFPVRTCALVGRFSDPRIAESVAALLPHLASRSVGVLIAEPAG
Ga0210398_1103421013300021477SoilMAFPVRVCAFVGRFADPRVQESVALLLPHLAGRGVEVLVSEEVPASAGARATLVDEQT
Ga0126371_1105963113300021560Tropical Forest SoilMAFPVRTCALVGRFADPRIAESVAALLPHLASRGIEVLVSEHAELPPEAP
Ga0247776_1009133113300023275Plant LitterMAFPVRVCALVGKFSDPRVAESVWALLPHLASRGIEVLISNESALPETTESVKRVE
Ga0209483_121300113300025862Arctic Peat SoilMGFPVRLCALVGRFSDPRVAESVNALVPHLLSRQV
Ga0207653_1006560913300025885Corn, Switchgrass And Miscanthus RhizosphereMAFPVRTCALVGRFADPRIAESLGALLPHLRQRGVTVLV
Ga0207684_1152136413300025910Corn, Switchgrass And Miscanthus RhizosphereMAFPVRTCALVGRFSDARVAESVAALLPYLAAASVTVLVS
Ga0207663_1154110813300025916Corn, Switchgrass And Miscanthus RhizosphereMAFPVRSCALVGRFVDPRVAESVNALLYHLQERKIQVLVSDE
Ga0207649_1040159823300025920Corn RhizosphereMGFPVQRCALVGRFSDPRVAESVNVLIPHLLSRQIEVL
Ga0207667_1018340933300025949Corn RhizosphereMAFPVRSCALVGRFVDPRVAESVNALLYHLQERKV
Ga0209802_102702533300026328SoilMAFPVRCCALVGRFEDPRIAESVSALLPHLARRGVEVLVSEHNPPGVPG
Ga0209804_125561123300026335SoilMAFPVRRCALVGRLSDPRVAESVAALLPHLSARQVQVIVGE
Ga0257163_101716613300026359SoilMAFPVRCCALVGRFEDPRIAESVSALLPHLASRGVRVLVSEDAALAA
Ga0207873_119185913300027664Feedstock Adapted CompostMAFPVRTCALIGKFADPRVAESVAALLPHLQARQVRVLVSED
Ga0209177_1039287313300027775Agricultural SoilMAVPVRTCALVGRFADPRIAEPLGALLPHLRERGVTVL
Ga0209380_1056813023300027889SoilMAFPVRVCAFVGRFADPRVQESVALLLPHLAGRGVEVLVSEEVPASAGARATL
Ga0311368_1037928213300029882PalsaMAFPVRTCALVGRFADARVAESVATLVPHLAAAGVTVLVQ
Ga0311371_1102050423300029951PalsaMAYPVRTCALVGRFADPRIAESVAALVPHLARRGVTVLVGEDAALAPE
Ga0302305_129857013300030046PalsaMAFPVRTCALVGRFADARVAESVATLVPHLAAAGVTVLVQPHAALG
Ga0311372_1074372713300030520PalsaMTFPVRACALVGRFVDPRVAESVNTLLAHLKEREIT
Ga0302310_1028561723300030737PalsaMAFPVRTCALVGRFADARVAESVATLVPHLAAAGVTVLVQPHAALGGAAVT
Ga0170834_11216294913300031057Forest SoilMAFPVRTCALVGRFSDARVAESVGALLPYLAAASVTVLVSEYAQLTSSS
Ga0299914_1037920113300031228SoilMAFPVRVCALVGRFSDPRVAESFATLFLHLQSRKVQVLVSHDAVLPKGVTGATA
Ga0318516_1018205023300031543SoilMSFPVRVCAFVGRFTDPRVRESAVLLLPHLAARGVEVLVSEDLP
Ga0318571_1028432823300031549SoilMAFPVRTCALVGRFADPRIAESVGALLPHLQSRGVQ
Ga0318528_1052514213300031561SoilMAFPVRTCALVGRFADPRIAESVTALLPHLAGHGVEVLV
Ga0318555_1005307633300031640SoilMSFPVRVCAFVGRFTDPRVRESAVLLLPHLAARGVEVLV
Ga0318555_1006579133300031640SoilMAFPVRTCALVGRFADPRVAESVGALLPHLQSRGVQVLVSEDAELPASAPVT
Ga0307475_1034755013300031754Hardwood Forest SoilMAFPVRACALVGRFVDPRVAESVNALLAHLKERQIQVLVS
Ga0307475_1125498023300031754Hardwood Forest SoilMAFPVRTCALVGRFSDPRVAESVGALLPHLMSRGVRV
Ga0318554_1007553113300031765SoilMAFPVRTCALVGRFADARIAESVGALLPHLRSRGVRVLVSE
Ga0318509_1031831823300031768SoilMAFPVRTCALVGRFADPRVAESVGALLPHLQSRGVQVLV
Ga0318509_1074903913300031768SoilMAFPVRTCALVGRFSDPRIAESVGALLPHLSSRGVRVLVSEDAELPA
Ga0318546_1088003813300031771SoilMAFPVRTCALVGRFADPRIAESVAALLPHLASRGVEVLV
Ga0318508_101245013300031780SoilMAFPVRTCALVGRFADPRIAESVGALLPHLQSRGVQVLVSD
Ga0318499_1006565713300031832SoilMAFPVRTCALVGRFADARIAESVGALLPHLRSRGVRVLVSED
Ga0306919_1077415423300031879SoilMAFPVRTCALVGRFADPRVAESVAALLPHLRGRGVRVLVSE
Ga0306925_1194652113300031890SoilMAFPVRVCAFVGRFDDPRVIESVALLLPHLAARGVEVLVSEDLPPAASTGPV
Ga0318536_1015329923300031893SoilMAFPVRTCALVGRFADPRIAESVAALLPHLASRGVEVLVSEHA
Ga0318551_1037477913300031896SoilMAFPVRTCALVGRFADPRIAESVSALLPHLESRGVQV
Ga0318520_1021437323300031897SoilMAFPVRTCALVGRFADPRIAESVGALLPHLQSRGVQVLVSDDAQLPEDAAV
Ga0306923_1021414443300031910SoilMAFPVRTCALVGRFSDPRIAESVGALLPHLSSRGVRV
Ga0310913_1030123013300031945SoilMSFPVRVCAFVGRFTDPRVRESAVLLLPHLAARGV
Ga0310909_1097290413300031947SoilMAFPVRTCALVGRFADPRIAESVAALLPHLASRGVEVLVSEHAEL
Ga0318531_1000972413300031981SoilMAFPVRTCALVGRFADPRIAESVGALLPHLQSRGVQVLVSDDAQLPEDAAVT
Ga0318549_1054975913300032041SoilMAFPVRTCALVGRFADARIAESVGALLPHLRSRGVRVLVSEDA
Ga0318504_1036462823300032063SoilMAFPVRTCALVGRFADARIAESVGALLPHLRSRGVRVLVSEDARLPADA
Ga0318514_1021179423300032066SoilMAFPVRTCALVGRFADPRVAESVAALLPHLRGRGVR
Ga0318524_1064135813300032067SoilMAFPVRTCALVGRFSDPRIAESVGALLPHLSSRGVRVLVSEDAELPADAP
Ga0318525_1000985253300032089SoilMAFPVRTCALVGRFADPRIAESVSALLPHLESRGVQVL
Ga0307470_1025967223300032174Hardwood Forest SoilMAFSVRTCALVGRFSDPRIAESVGALLPHLHGRGVQVLVSATADLDSPIP
Ga0307471_10150155523300032180Hardwood Forest SoilMAFPVRTCALVGRFSDARVAESVGALLPYLAAASV
Ga0307472_10047176223300032205Hardwood Forest SoilMAFSVRTCALVGRFSDPRIAESVGALLPHLHGRGVQVLVSA
Ga0335080_1190333513300032828SoilMAFPVRLCALVGRFSDPRVAESVNALIPHLLSRQVQVLVSEET
Ga0335074_1080099713300032895SoilMAFPVRVCAFVGRFSDPRVAESASLLLPHLAVRGV
Ga0335075_1033042813300032896SoilMAPPVRTCALVGRFTDSRVAESAHGLLAHLATRQVTVLVSE
Ga0335083_1146414523300032954SoilMPFPVRTCALVGRFVDPRVAESVSVLLTHLKERKVRVLVSE
Ga0335077_1085658313300033158SoilMSFPVRLCALVGRFSDPRVAESVNLLIPHLLARQVKVIVSNETPYP
Ga0299912_1010186743300033489SoilMSFPVRKCALIGRFVDPRVAESVGALLPHLKDRQVQVIISEGADIPNG

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.