| Basic Information | |
|---|---|
| Family ID | F074177 |
| Family Type | Metagenome |
| Number of Sequences | 120 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MKNNVYQKKSALSVFFSQLAKNFVALFESGNKREFQRLKDFITS |
| Number of Associated Samples | 87 |
| Number of Associated Scaffolds | 120 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.83 % |
| % of genes near scaffold ends (potentially truncated) | 30.83 % |
| % of genes from short scaffolds (< 2000 bps) | 59.17 % |
| Associated GOLD sequencing projects | 74 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.500 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil (15.833 % of family members) |
| Environment Ontology (ENVO) | Unclassified (45.833 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (50.833 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.39% β-sheet: 0.00% Coil/Unstructured: 48.61% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 120 Family Scaffolds |
|---|---|---|
| PF00271 | Helicase_C | 45.83 |
| PF08455 | SNF2_assoc | 5.83 |
| PF04029 | 2-ph_phosp | 2.50 |
| PF00580 | UvrD-helicase | 2.50 |
| PF01266 | DAO | 2.50 |
| PF00535 | Glycos_transf_2 | 1.67 |
| PF02777 | Sod_Fe_C | 1.67 |
| PF13361 | UvrD_C | 1.67 |
| PF03825 | Nuc_H_symport | 0.83 |
| PF01810 | LysE | 0.83 |
| PF08669 | GCV_T_C | 0.83 |
| PF01850 | PIN | 0.83 |
| PF06580 | His_kinase | 0.83 |
| PF00210 | Ferritin | 0.83 |
| PF01835 | MG2 | 0.83 |
| PF13632 | Glyco_trans_2_3 | 0.83 |
| PF00639 | Rotamase | 0.83 |
| PF12867 | DinB_2 | 0.83 |
| PF00216 | Bac_DNA_binding | 0.83 |
| PF04434 | SWIM | 0.83 |
| PF03853 | YjeF_N | 0.83 |
| PF04542 | Sigma70_r2 | 0.83 |
| PF12732 | YtxH | 0.83 |
| PF00383 | dCMP_cyt_deam_1 | 0.83 |
| PF07859 | Abhydrolase_3 | 0.83 |
| PF00534 | Glycos_transf_1 | 0.83 |
| PF01329 | Pterin_4a | 0.83 |
| PF00472 | RF-1 | 0.83 |
| PF00912 | Transgly | 0.83 |
| PF05532 | CsbD | 0.83 |
| PF13470 | PIN_3 | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
|---|---|---|---|
| COG0553 | Superfamily II DNA or RNA helicase, SNF2 family | Transcription [K] | 11.67 |
| COG2045 | Phosphosulfolactate phosphohydrolase or related enzyme | Coenzyme transport and metabolism [H] | 5.00 |
| COG0210 | Superfamily I DNA or RNA helicase | Replication, recombination and repair [L] | 2.50 |
| COG3973 | DNA helicase IV | Replication, recombination and repair [L] | 2.50 |
| COG1074 | 3’-5’ helicase subunit RecB of the DNA repair enzyme RecBCD (exonuclease V) | Replication, recombination and repair [L] | 2.50 |
| COG0605 | Superoxide dismutase | Inorganic ion transport and metabolism [P] | 1.67 |
| COG2373 | Uncharacterized conserved protein YfaS, alpha-2-macroglobulin family | General function prediction only [R] | 0.83 |
| COG5431 | Predicted nucleic acid-binding protein, contains SWIM-type Zn-finger domain | General function prediction only [R] | 0.83 |
| COG5009 | Membrane carboxypeptidase/penicillin-binding protein | Cell wall/membrane/envelope biogenesis [M] | 0.83 |
| COG4953 | Membrane carboxypeptidase/penicillin-binding protein PbpC | Cell wall/membrane/envelope biogenesis [M] | 0.83 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.83 |
| COG4715 | Uncharacterized protein, contains SWIM-type Zn finger domain | Function unknown [S] | 0.83 |
| COG4279 | Uncharacterized protein, contains SWIM-type Zn finger domain | Function unknown [S] | 0.83 |
| COG0062 | NAD(P)H-hydrate repair enzyme Nnr, NAD(P)H-hydrate epimerase domain | Nucleotide transport and metabolism [F] | 0.83 |
| COG3275 | Sensor histidine kinase, LytS/YehU family | Signal transduction mechanisms [T] | 0.83 |
| COG3237 | Uncharacterized conserved protein YjbJ, UPF0337 family | Function unknown [S] | 0.83 |
| COG2972 | Sensor histidine kinase YesM | Signal transduction mechanisms [T] | 0.83 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.83 |
| COG2154 | Pterin-4a-carbinolamine dehydratase | Coenzyme transport and metabolism [H] | 0.83 |
| COG0216 | Protein chain release factor RF1 | Translation, ribosomal structure and biogenesis [J] | 0.83 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.83 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.83 |
| COG1186 | Protein chain release factor PrfB | Translation, ribosomal structure and biogenesis [J] | 0.83 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.83 |
| COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 0.83 |
| COG0760 | Peptidyl-prolyl isomerase, parvulin family | Posttranslational modification, protein turnover, chaperones [O] | 0.83 |
| COG0744 | Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.83 |
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.50 % |
| Unclassified | root | N/A | 7.50 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090015|GPICI_8996725 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 2303 | Open in IMG/M |
| 3300000156|NODE_c0733207 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Niastella → Niastella koreensis | 8760 | Open in IMG/M |
| 3300001398|JGI20207J14881_1000468 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 14675 | Open in IMG/M |
| 3300001398|JGI20207J14881_1004479 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 4351 | Open in IMG/M |
| 3300001403|JGI20205J14842_1000259 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 13562 | Open in IMG/M |
| 3300001534|A15PFW1_10098129 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 7340 | Open in IMG/M |
| 3300001538|A10PFW1_10964773 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Ginsengibacter → Ginsengibacter hankyongi | 511 | Open in IMG/M |
| 3300002100|JGI24809J26612_1001466 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Niastella → Niastella koreensis | 8163 | Open in IMG/M |
| 3300002100|JGI24809J26612_1007534 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Ginsengibacter → Ginsengibacter hankyongi | 2590 | Open in IMG/M |
| 3300003321|soilH1_10193019 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 6200 | Open in IMG/M |
| 3300003402|JGI26528J50254_1000139 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 61875 | Open in IMG/M |
| 3300004114|Ga0062593_100222151 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1529 | Open in IMG/M |
| 3300005258|Ga0074071_1083694 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 537 | Open in IMG/M |
| 3300005327|Ga0070658_10054239 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 3255 | Open in IMG/M |
| 3300005327|Ga0070658_10062052 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Niastella | 3046 | Open in IMG/M |
| 3300005327|Ga0070658_10064865 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 2979 | Open in IMG/M |
| 3300005327|Ga0070658_10362884 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1241 | Open in IMG/M |
| 3300005327|Ga0070658_10499574 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1051 | Open in IMG/M |
| 3300005329|Ga0070683_100233411 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Niastella → Niastella koreensis | 1749 | Open in IMG/M |
| 3300005336|Ga0070680_101157312 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 669 | Open in IMG/M |
| 3300005337|Ga0070682_101281349 | Not Available | 622 | Open in IMG/M |
| 3300005339|Ga0070660_100012596 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 6042 | Open in IMG/M |
| 3300005339|Ga0070660_101347829 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 606 | Open in IMG/M |
| 3300005344|Ga0070661_100203915 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1512 | Open in IMG/M |
| 3300005344|Ga0070661_100933643 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 717 | Open in IMG/M |
| 3300005355|Ga0070671_101158086 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Ginsengibacter → Ginsengibacter hankyongi | 680 | Open in IMG/M |
| 3300005444|Ga0070694_100973006 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 703 | Open in IMG/M |
| 3300005530|Ga0070679_100326068 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1484 | Open in IMG/M |
| 3300005535|Ga0070684_100966010 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 799 | Open in IMG/M |
| 3300005539|Ga0068853_101888705 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 579 | Open in IMG/M |
| 3300005548|Ga0070665_101133885 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 793 | Open in IMG/M |
| 3300005563|Ga0068855_100456697 | All Organisms → cellular organisms → Bacteria | 1393 | Open in IMG/M |
| 3300005563|Ga0068855_101152341 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 808 | Open in IMG/M |
| 3300005563|Ga0068855_101853613 | Not Available | 612 | Open in IMG/M |
| 3300005578|Ga0068854_100153008 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Ginsengibacter → Ginsengibacter hankyongi | 1780 | Open in IMG/M |
| 3300005616|Ga0068852_100287365 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1587 | Open in IMG/M |
| 3300005617|Ga0068859_102461298 | Not Available | 573 | Open in IMG/M |
| 3300005891|Ga0075283_1086028 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 577 | Open in IMG/M |
| 3300005899|Ga0075271_10065424 | Not Available | 666 | Open in IMG/M |
| 3300006755|Ga0079222_11116468 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 695 | Open in IMG/M |
| 3300006804|Ga0079221_10001657 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 7298 | Open in IMG/M |
| 3300006949|Ga0075528_10178768 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 572 | Open in IMG/M |
| 3300006949|Ga0075528_10228703 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 508 | Open in IMG/M |
| 3300006950|Ga0075524_10023163 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2450 | Open in IMG/M |
| 3300006950|Ga0075524_10034234 | Not Available | 2059 | Open in IMG/M |
| 3300006950|Ga0075524_10216827 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales | 834 | Open in IMG/M |
| 3300007740|Ga0104326_134692 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 44737 | Open in IMG/M |
| 3300007820|Ga0104324_134998 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 4008 | Open in IMG/M |
| 3300010371|Ga0134125_10002214 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 23203 | Open in IMG/M |
| 3300010371|Ga0134125_12675606 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Ginsengibacter → Ginsengibacter hankyongi | 542 | Open in IMG/M |
| 3300010396|Ga0134126_10001176 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 33209 | Open in IMG/M |
| 3300010396|Ga0134126_10002303 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 24129 | Open in IMG/M |
| 3300012201|Ga0137365_10820169 | Not Available | 679 | Open in IMG/M |
| 3300012942|Ga0164242_10335681 | All Organisms → cellular organisms → Bacteria | 1130 | Open in IMG/M |
| 3300012958|Ga0164299_11660012 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 506 | Open in IMG/M |
| 3300013102|Ga0157371_10000361 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 57844 | Open in IMG/M |
| 3300013102|Ga0157371_10002863 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 16123 | Open in IMG/M |
| 3300013102|Ga0157371_10025269 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 4331 | Open in IMG/M |
| 3300013102|Ga0157371_10037937 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 3448 | Open in IMG/M |
| 3300013102|Ga0157371_10157208 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1623 | Open in IMG/M |
| 3300013104|Ga0157370_10667720 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Ginsengibacter → Ginsengibacter hankyongi | 949 | Open in IMG/M |
| 3300013105|Ga0157369_10019338 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 7620 | Open in IMG/M |
| 3300013296|Ga0157374_10065777 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 3406 | Open in IMG/M |
| 3300013297|Ga0157378_10118621 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 2436 | Open in IMG/M |
| 3300013307|Ga0157372_10156031 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 2637 | Open in IMG/M |
| 3300013427|Ga0120106_1015269 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 1681 | Open in IMG/M |
| 3300013772|Ga0120158_10286443 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Ginsengibacter → Ginsengibacter hankyongi | 804 | Open in IMG/M |
| 3300014498|Ga0182019_10317970 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1042 | Open in IMG/M |
| 3300017553|Ga0182744_1000239 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 58233 | Open in IMG/M |
| 3300017937|Ga0187809_10011350 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 2966 | Open in IMG/M |
| 3300017959|Ga0187779_10908537 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 606 | Open in IMG/M |
| 3300019998|Ga0193710_1025072 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 610 | Open in IMG/M |
| 3300019999|Ga0193718_1001171 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 5668 | Open in IMG/M |
| 3300020018|Ga0193721_1118589 | Not Available | 667 | Open in IMG/M |
| 3300020137|Ga0206107_1064037 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 536 | Open in IMG/M |
| 3300021478|Ga0210402_11796138 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 539 | Open in IMG/M |
| 3300022756|Ga0222622_11143911 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 573 | Open in IMG/M |
| 3300024978|Ga0209941_1000365 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 62052 | Open in IMG/M |
| 3300025495|Ga0207932_1075977 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 699 | Open in IMG/M |
| 3300025574|Ga0208717_1000027 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 106272 | Open in IMG/M |
| 3300025574|Ga0208717_1009054 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 2966 | Open in IMG/M |
| 3300025574|Ga0208717_1009311 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 2919 | Open in IMG/M |
| 3300025581|Ga0208355_1014870 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Ginsengibacter → Ginsengibacter hankyongi | 2453 | Open in IMG/M |
| 3300025588|Ga0208586_1044086 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1019 | Open in IMG/M |
| 3300025679|Ga0207933_1000023 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 149683 | Open in IMG/M |
| 3300025703|Ga0208357_1158571 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 629 | Open in IMG/M |
| 3300025829|Ga0209484_10087512 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 711 | Open in IMG/M |
| 3300025862|Ga0209483_1031824 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 2604 | Open in IMG/M |
| 3300025891|Ga0209585_10000303 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 19182 | Open in IMG/M |
| 3300025901|Ga0207688_10898899 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 561 | Open in IMG/M |
| 3300025904|Ga0207647_10021262 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 4334 | Open in IMG/M |
| 3300025909|Ga0207705_10196007 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Ginsengibacter → Ginsengibacter hankyongi | 1529 | Open in IMG/M |
| 3300025909|Ga0207705_10258276 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1330 | Open in IMG/M |
| 3300025909|Ga0207705_10267213 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 1307 | Open in IMG/M |
| 3300025909|Ga0207705_10305684 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1220 | Open in IMG/M |
| 3300025912|Ga0207707_11356401 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 569 | Open in IMG/M |
| 3300025913|Ga0207695_10011421 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 10761 | Open in IMG/M |
| 3300025913|Ga0207695_10775625 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 839 | Open in IMG/M |
| 3300025917|Ga0207660_10131772 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1903 | Open in IMG/M |
| 3300025919|Ga0207657_10058990 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 3300 | Open in IMG/M |
| 3300025919|Ga0207657_10115280 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2215 | Open in IMG/M |
| 3300025919|Ga0207657_10202771 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1595 | Open in IMG/M |
| 3300025919|Ga0207657_11188920 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 580 | Open in IMG/M |
| 3300025921|Ga0207652_10086087 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2755 | Open in IMG/M |
| 3300025921|Ga0207652_10250046 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 1599 | Open in IMG/M |
| 3300025921|Ga0207652_10345566 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1343 | Open in IMG/M |
| 3300025926|Ga0207659_11239359 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 641 | Open in IMG/M |
| 3300025931|Ga0207644_10778643 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 800 | Open in IMG/M |
| 3300026041|Ga0207639_11318805 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 677 | Open in IMG/M |
| 3300026041|Ga0207639_11897210 | Not Available | 557 | Open in IMG/M |
| 3300026116|Ga0207674_10064004 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 3710 | Open in IMG/M |
| 3300026142|Ga0207698_10055071 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 3063 | Open in IMG/M |
| 3300026142|Ga0207698_12011755 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 592 | Open in IMG/M |
| 3300026142|Ga0207698_12137644 | Not Available | 573 | Open in IMG/M |
| 3300027725|Ga0209178_1000175 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 16855 | Open in IMG/M |
| 3300027765|Ga0209073_10139119 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 888 | Open in IMG/M |
| 3300028379|Ga0268266_11651553 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 616 | Open in IMG/M |
| 3300029987|Ga0311334_11973259 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Ginsengibacter → Ginsengibacter hankyongi | 500 | Open in IMG/M |
| 3300031446|Ga0170820_16495031 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 606 | Open in IMG/M |
| 3300033475|Ga0310811_10777302 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 901 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 15.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 14.17% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 10.83% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 8.33% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 6.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.83% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.33% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.33% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 3.33% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.67% |
| Compost | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Compost | 1.67% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.67% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.67% |
| Wastewater Bioreactor | Engineered → Bioremediation → Hydrocarbon → Unclassified → Unclassified → Wastewater Bioreactor | 1.67% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.83% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.83% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.83% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.83% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.83% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.83% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.83% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.83% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.83% |
| Ant Dump | Host-Associated → Arthropoda → Ant Dump → Unclassified → Unclassified → Ant Dump | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.83% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.83% |
| Sugar Cane Bagasse Incubating Bioreactor | Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090015 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000156 | Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic | Engineered | Open in IMG/M |
| 3300001398 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-3 deep-092012 | Environmental | Open in IMG/M |
| 3300001403 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-2 shallow-092012 | Environmental | Open in IMG/M |
| 3300001534 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-PF-7A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001538 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300002100 | Soil microbial communities from Manhattan, Kansas, USA - Sample 500um MDA | Environmental | Open in IMG/M |
| 3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
| 3300003402 | Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_solids_1 | Engineered | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300005258 | Microbial communities on the surface of bentonite enhanced biochar | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005891 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_304 | Environmental | Open in IMG/M |
| 3300005899 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_302 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006949 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost159B-16B | Environmental | Open in IMG/M |
| 3300006950 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one | Environmental | Open in IMG/M |
| 3300007740 | Permafrost core soil microbial communities from Svalbard, Norway - sample 2-9-2 Soapdenovo | Environmental | Open in IMG/M |
| 3300007820 | Permafrost core soil microbial communities from Svalbard, Norway - sample 2-12-2 Soapdenovo | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012942 | Miracle-Growth compost microbial communities from Emeryville, California, USA - Original compost - Miracle growth compost (MG) | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013427 | Permafrost microbial communities from Nunavut, Canada - A15_35cm_18M | Environmental | Open in IMG/M |
| 3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300017553 | Enriched Miracle-Growth compost microbial communities from Emeryville, California, USA - eDNA 3rd pass 30_C Kraft MG (version 2) | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300019998 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3m1 | Environmental | Open in IMG/M |
| 3300019999 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a1 | Environmental | Open in IMG/M |
| 3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
| 3300020137 | Enriched microbial communities from leaf-cutter ant dump, University of Wisconsin, Madison, United States - 2B0 | Host-Associated | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300024978 | Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_solids_1 (SPAdes) | Engineered | Open in IMG/M |
| 3300025495 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025574 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-3 shallow (SPAdes) | Environmental | Open in IMG/M |
| 3300025581 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025588 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-3 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025679 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-3 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025703 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F52-2 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025829 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost159B-16B (SPAdes) | Environmental | Open in IMG/M |
| 3300025862 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A (SPAdes) | Environmental | Open in IMG/M |
| 3300025891 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one (SPAdes) | Environmental | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPICI_00933560 | 2088090015 | Soil | MKTDVYQKKTQLSMFLSNLHRNFVALFESGNKREFQRLKDFITS |
| NODE_07332075 | 3300000156 | Sugar Cane Bagasse Incubating Bioreactor | MKDNAYESKSAFSAFLKNLARNFVALFESGNKRDFQRLKDFITH* |
| JGI20207J14881_10004686 | 3300001398 | Arctic Peat Soil | MKNATHENKSLFSVFFKNLAKNFAALFESGNKKEFQRLKEFISS* |
| JGI20207J14881_10044793 | 3300001398 | Arctic Peat Soil | MKHQDYHSKSALSIFFSHIAKSFVALFESGNKREFQRLKDFISS* |
| JGI20205J14842_10002597 | 3300001403 | Arctic Peat Soil | MKHQDYHSKSALSIFLSHIAKSFVALFESGNKKEFQRLKDFISS* |
| A15PFW1_100981295 | 3300001534 | Permafrost | MKNQDYQNPTALSLFFSHLAKNFVALFESGNQREFQRLKDFITS* |
| A10PFW1_109647731 | 3300001538 | Permafrost | MKNQVYQKKTAFSMFFHTLSKNFIALFESGNKKEFQRLKDF |
| JGI24809J26612_10014664 | 3300002100 | Soil | MKTQMTQKKTVLSVFFTALSKNLIALFESGDKKEFQRLKDFISS* |
| JGI24809J26612_10075345 | 3300002100 | Soil | MKTQITQKKTVLSVFFTALSKNFIALFESGDKKEFQRLKDFISS* |
| soilH1_101930195 | 3300003321 | Sugarcane Root And Bulk Soil | MKNNAYESKSAFSVFLKNFARNFVALFESGNKRDFQRLKDFITS* |
| JGI26528J50254_10001394 | 3300003402 | Wastewater Bioreactor | MKNQSYQSKSALSLFFSHLAKNFIALFESGNKREFQRLKDFIAS* |
| Ga0062593_1002221512 | 3300004114 | Soil | MKTEVYQKKTVLSQFFSNLSKNFIALFETGNKKEFQRLKDFISS* |
| Ga0074071_10836942 | 3300005258 | Soil | MKNEVYQNKSALSIFLRHVAKNFLAFFESGNKRDFQRLKDFITS* |
| Ga0070658_100542392 | 3300005327 | Corn Rhizosphere | MKNNVYQKKSALSVFFSQVAKNFVALFESGNKREFQRLKDFITS* |
| Ga0070658_100620522 | 3300005327 | Corn Rhizosphere | MKNQVYQKKTAITVFFNSLSKNLVALFEAPDKREFQRLKDFISS* |
| Ga0070658_100648652 | 3300005327 | Corn Rhizosphere | MKNNAYESKSAFSVFLKNFTRNFVALFESGNKRDFQRLKDFITS* |
| Ga0070658_103628842 | 3300005327 | Corn Rhizosphere | MKNQVYQKKTAVSVFFHTLSKNFIALFESGNKKEFQRLKDFIAH* |
| Ga0070658_104995742 | 3300005327 | Corn Rhizosphere | MKNQNYQKPSVLALFFNHVAKNFVALFESGNKREFQRLKDFITS* |
| Ga0070683_1002334112 | 3300005329 | Corn Rhizosphere | MKNQVYQKKPVFTVFISNLSKNLVALFESPDKREFQRLKDFITS* |
| Ga0070680_1011573122 | 3300005336 | Corn Rhizosphere | MKNPAYKRKSALSVFFSYLAKNFVALFESGNKREFQRLKDFITS* |
| Ga0070682_1012813492 | 3300005337 | Corn Rhizosphere | MKNNVYQKKSALSVFFSQLAKNFVALFESGNKREFQRLKDFITS* |
| Ga0070660_1000125964 | 3300005339 | Corn Rhizosphere | SNSMKNQVYQKKPVFTVFISNLSKNLVALFESPDKREFQRLKDFITS* |
| Ga0070660_1013478292 | 3300005339 | Corn Rhizosphere | MKNQVYQRKSALSVFFSYLAKNFVALFESGNKREFQRLKDFITS* |
| Ga0070661_1002039152 | 3300005344 | Corn Rhizosphere | MKNQVYQKKPVFTVFISNLSKNLAALFESPDKREFQRLKDFITS* |
| Ga0070661_1009336432 | 3300005344 | Corn Rhizosphere | MKNQVYQKKTVLAVFLSNLSKNFIALFESGDKREFQRLKDFISS* |
| Ga0070671_1011580862 | 3300005355 | Switchgrass Rhizosphere | MKNEVYQKKTVLSQFFSNLSKNFIALFETGNKKDFQRLKDFISS* |
| Ga0070694_1009730061 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTQMTQKKTVLSVFFTALSKNFIALFESGDKKEFQRLKDFISS* |
| Ga0070679_1003260681 | 3300005530 | Corn Rhizosphere | FLKFHVMKNNVYQKKSALSVFFSQVAKNFVALFESGNKREFQRLKDFITS* |
| Ga0070684_1009660102 | 3300005535 | Corn Rhizosphere | MNDFFTLMYQSYLLTIFKPTVMKNQVYQKKTAISLFFSYFSKNIVALFESGNKKEFQRLKDFITS* |
| Ga0068853_1018887052 | 3300005539 | Corn Rhizosphere | MKNQVYQRKSVFSVFFSNLAKNFAALFESGNKREFQRLKDFITS* |
| Ga0070665_1011338852 | 3300005548 | Switchgrass Rhizosphere | MKNQVYQKKTVLSLFLSNLSKNFIALFESGDKKEFQRLKDFISS* |
| Ga0068855_1004566972 | 3300005563 | Corn Rhizosphere | MKNNVYQRKSAFSVFFSQLAKNFVALFESGNKREFQRLKDFITS* |
| Ga0068855_1011523412 | 3300005563 | Corn Rhizosphere | ISKSAFSVFFKHLTKNFVALFESGNKREFQRLKDFITS* |
| Ga0068855_1018536131 | 3300005563 | Corn Rhizosphere | MKNQVYQKKTAITVFFNSLSKNLVALFEAPDKREFQRLKDFI |
| Ga0068854_1001530085 | 3300005578 | Corn Rhizosphere | MKNQVYQKKTVLAVFLSNLSKNFIALFESGDKREFQ |
| Ga0068852_1002873651 | 3300005616 | Corn Rhizosphere | KNKYHYPLLKTKFMKNQVYQKKTAVSVFFHTLSKNFIALFESGNKKEFQRLKDFIAH* |
| Ga0068859_1024612982 | 3300005617 | Switchgrass Rhizosphere | MKTQMTQKKTVLSVFFTALSKNFIALFESGDKKEFQRLKDFIS |
| Ga0075283_10860282 | 3300005891 | Rice Paddy Soil | MKNDAYESKSALTVFFKHVAKNFVALFESGNKREFQRLKDFITS* |
| Ga0075271_100654242 | 3300005899 | Rice Paddy Soil | MKNHSYENKSAFSQLLKHVAKNFVALFESGNKREFQRLK |
| Ga0079222_111164681 | 3300006755 | Agricultural Soil | SAFSLFCRNLARNFVALFESGNKREFQRLKDFITS* |
| Ga0079221_100016572 | 3300006804 | Agricultural Soil | MKHSAPHKKSLLTVFFSNLSKNFIALFESGNKRDFQKLKDFITS* |
| Ga0075528_101787681 | 3300006949 | Arctic Peat Soil | MKNQVYQKKTAFSMFFHTLSKNFIALFESGNKKEFQRLKDFITS* |
| Ga0075528_102287032 | 3300006949 | Arctic Peat Soil | LLVMKNQVYQKRSVFSLFFSQITKNFVALFESGNKKEFQRLKDFITS* |
| Ga0075524_100231633 | 3300006950 | Arctic Peat Soil | MKKHVKQKKTVLSLFFSNLTKNFIALFESGNKKEFQRLKDFITS* |
| Ga0075524_100342344 | 3300006950 | Arctic Peat Soil | MKNQVYQKRSVFSLFFSQITKNFVALFESGNKKEFQRLKDFITS* |
| Ga0075524_102168272 | 3300006950 | Arctic Peat Soil | MKNQVYQKRSVFSLFFSQIAKNFVALFESGNKKEFQRLKDFITS* |
| Ga0104326_13469232 | 3300007740 | Soil | MKNQVYQKKTGFSVFFRTLSKNFIALFESGNKKEFQRLKDFITS* |
| Ga0104324_1349983 | 3300007820 | Soil | MKKQVYQKKTVVSLFFSNLSKNFIALFESGNKKEFQRLKDFITS* |
| Ga0134125_100022144 | 3300010371 | Terrestrial Soil | MKNNVYQRKSAMSVFLSQLAKNFVALFESGNKREFQRLKDFITS* |
| Ga0134125_126756061 | 3300010371 | Terrestrial Soil | MKNQVYQKKTAVSVFFHTLSKNFIALFESGNKKEFQRLKDFI |
| Ga0134126_1000117619 | 3300010396 | Terrestrial Soil | MKNETHENKSLFSVFFKNLAKNFAALFESGNKKEFQRLKEFITS* |
| Ga0134126_1000230312 | 3300010396 | Terrestrial Soil | MKNQDYQHKSALSLFFSHLAKNFIALFESGNDKEFQRLKDFISS* |
| Ga0137365_108201691 | 3300012201 | Vadose Zone Soil | MKIKTASQKSSFKLFMSKLSKKFILLFESGSKKESQRLKDFISS* |
| Ga0164242_103356812 | 3300012942 | Compost | MKNQAYQKKSALSLFLSQLAKNFVALFESGNKRDFQRLKDFITS* |
| Ga0164299_116600121 | 3300012958 | Soil | EFLTLFKSSVMKKQDYQKKTVLSLFFNNLSKNFIALFESGNKKEFQRLKDFISS* |
| Ga0157371_1000036119 | 3300013102 | Corn Rhizosphere | MMKNPVYPRKSALSVFFSYFAKNFVALFESGNKREFQRLKDFITS* |
| Ga0157371_100028634 | 3300013102 | Corn Rhizosphere | MKNDAYESKSALTVFFKNVAKNFVALFESGNKREFQRLKDFITS* |
| Ga0157371_100252692 | 3300013102 | Corn Rhizosphere | MRNDAYESKSAFSLFFKHLAKNFVALFESGNKREFQRLKDFITS* |
| Ga0157371_100379372 | 3300013102 | Corn Rhizosphere | MKNDANESKSALSVFFKHFAKNFVALFESGNKREFQRLKDFITS* |
| Ga0157371_101572081 | 3300013102 | Corn Rhizosphere | KSNSMKNQVYQKKPVFTVFISNLSKNLVALFESPDKREFQRLKDFITS* |
| Ga0157370_106677202 | 3300013104 | Corn Rhizosphere | MKNQVYQKRTAFTVFFNNLSKNLVALFESPNKREFQ |
| Ga0157369_100193382 | 3300013105 | Corn Rhizosphere | MKNNAYESKSAFSIFLKNFTRNFVALFESGNKRDFQRLKDFITS* |
| Ga0157374_100657772 | 3300013296 | Miscanthus Rhizosphere | MKNQVYQKKTAISVLFNYFSKNIVALFESGNKKEFQRLKDFITS* |
| Ga0157378_101186212 | 3300013297 | Miscanthus Rhizosphere | MKTEMTQKKTVLSVFFTALSKNFIALFESGDKKEFQRLKDFISS* |
| Ga0157372_101560311 | 3300013307 | Corn Rhizosphere | KTKFMKNQVYQKKTAVSVFFHTLSKNFIALFESGNKKEFQRLKDFIAH* |
| Ga0120106_10152692 | 3300013427 | Permafrost | MKNQVYQKQSVFSHFFSQVAKNFVALFESGNKKEFQRLKDFITS* |
| Ga0120158_102864431 | 3300013772 | Permafrost | MKNQIDQKKTVLSMFISNLSKNFIALFESGNKKEFQRLKD |
| Ga0182019_103179701 | 3300014498 | Fen | MKNQVYQKKTAFSVFFHTLSKNFVALFESGNKKEFQRLKDFIAH* |
| Ga0182744_100023956 | 3300017553 | Compost | MKNQVYQKRSLFSQFIGEFMKNLSALFESSDKKEFQRLKNFIAS |
| Ga0187809_100113502 | 3300017937 | Freshwater Sediment | MKKYANQKRSPWTLFFSHLSKNFIALFESGNKKEFQRLKDFISS |
| Ga0187779_109085371 | 3300017959 | Tropical Peatland | CFMKHAANQKKSVLNVFFSNLSKNFMALFESGNKKEFQKLKDFITS |
| Ga0193710_10250721 | 3300019998 | Soil | NPNFMKTQMTQKKTVLSVFFTALSKNFIALFESGDKKEFQRLKDFISS |
| Ga0193718_10011714 | 3300019999 | Soil | MKNQVYQKKTAFSVFFHALSKNFIALFESGNKKEFQRLKDFITS |
| Ga0193721_11185892 | 3300020018 | Soil | MKKQDYQKKTVLSLFFNSLSKNFIALFESGNKKEFQRLKDFISS |
| Ga0206107_10640372 | 3300020137 | Ant Dump | YQKSYFMKNHANQKKSALSVFFAHLAKNFAALFESGNKREFQRLKDFITS |
| Ga0210402_117961382 | 3300021478 | Soil | NKYYNPFLKPSFMKNQVYQKKTAFSMFFHTLSKNFIALFESGNKKEFQRLKDFITS |
| Ga0222622_111439112 | 3300022756 | Groundwater Sediment | MKTQMTQKKTVLSVFFTALSKNLIALFESGDKKEFQRLKDFISS |
| Ga0209941_100036553 | 3300024978 | Wastewater Bioreactor | MKNQSYQSKSALSLFFSHLAKNFIALFESGNKREFQRLKDFIAS |
| Ga0207932_10759772 | 3300025495 | Arctic Peat Soil | MKKHVKQKKTVLSLFFSNLTKNFIALFESGNKKEFQRLKDFITS |
| Ga0208717_100002769 | 3300025574 | Arctic Peat Soil | MKHQDYHSKSALSIFFSHIAKSFVALFESGNKREFQRLKDFISS |
| Ga0208717_10090544 | 3300025574 | Arctic Peat Soil | MKNHVYQKKSVLAIFFRQLSKKFAALFDSGNKREFQRLKDFIAS |
| Ga0208717_10093112 | 3300025574 | Arctic Peat Soil | MKNQVYQKKTAFSVFFHTLSKNFIALFESGNKKDFQRLKDFITS |
| Ga0208355_10148703 | 3300025581 | Arctic Peat Soil | MKNQVYQKKTPFSMFFHTLSKNFIALFESGNKKEFQRLKDFITS |
| Ga0208586_10440862 | 3300025588 | Arctic Peat Soil | MKHQDYHSKSALSIFLSHIAKSFVALFESGNKKEFQRLKDFISS |
| Ga0207933_100002344 | 3300025679 | Arctic Peat Soil | MKNATHENKSLFSVFFKNLAKNFAALFESGNKKEFQRLKEFISS |
| Ga0208357_11585712 | 3300025703 | Arctic Peat Soil | MKNETHENKSLFSVFFKNLAKNFAALFESGNKKEFQRLKEFITS |
| Ga0209484_100875122 | 3300025829 | Arctic Peat Soil | LLVMKNQVYQKRSVFSLFFSQITKNFVALFESGNKKEFQRLKDFITS |
| Ga0209483_10318241 | 3300025862 | Arctic Peat Soil | MKNATHENKSLFSVFFKNLAKNFAALFESGNKREFQRLKTFITS |
| Ga0209585_100003033 | 3300025891 | Arctic Peat Soil | MKNQVYQKRSVFSLFFSQITKNFVALFESGNKKEFQRLKDFITS |
| Ga0207688_108988992 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTQMTQKKTVLSVFFTALSKNFIALFESGDKKEFQRLKDFISS |
| Ga0207647_100212622 | 3300025904 | Corn Rhizosphere | MKNNVYQKKSALSVFFSQLAKNFVALFESGNKREFQRLKDFITS |
| Ga0207705_101960073 | 3300025909 | Corn Rhizosphere | MKNQVYQKKPVFTVFISNLSKNLVALFESPDKREFQR |
| Ga0207705_102582762 | 3300025909 | Corn Rhizosphere | MKNQNYQKPSVLALFFNHVAKNFVALFESGNKREFQRLKDFITS |
| Ga0207705_102672132 | 3300025909 | Corn Rhizosphere | MKNQVYQKKTAITVFFNSLSKNLVALFEAPDKREFQRLKDFISS |
| Ga0207705_103056841 | 3300025909 | Corn Rhizosphere | MKNQVYQKKPVFTVFISNLSKNLAALFESPDKREFQRLKDFITS |
| Ga0207707_113564012 | 3300025912 | Corn Rhizosphere | MKNPAYKRKSALSVFFSYLAKNFVALFESGNKREFQRLKDFITS |
| Ga0207695_100114212 | 3300025913 | Corn Rhizosphere | MKNQVYQKKTAVSVFFHTLSKNFIALFESGNKKEFQRLKDFIAH |
| Ga0207695_107756252 | 3300025913 | Corn Rhizosphere | MKNNVYQRKSAFSVFFSQLAKNFVALFESGNKREFQRLKDFITS |
| Ga0207660_101317721 | 3300025917 | Corn Rhizosphere | QKKPVFTVFISNLSKNLVALFESPDKREFQRLKDFITS |
| Ga0207657_100589901 | 3300025919 | Corn Rhizosphere | MKNQVYQKKPVFTVFISNLSKNLVALFESPDKREFQRLKDFITS |
| Ga0207657_101152802 | 3300025919 | Corn Rhizosphere | MKNNAYESKSAFSVFLKNFTRNFVALFESGNKRDFQRLKDFITS |
| Ga0207657_102027712 | 3300025919 | Corn Rhizosphere | MKKQNYQKPSVLALFFNHVAKNFVALFESGNKREFQRLKDFITS |
| Ga0207657_111889202 | 3300025919 | Corn Rhizosphere | YQRKSVFSVFFSNLAKNFAALFESGNKREFQRLKDFITS |
| Ga0207652_100860874 | 3300025921 | Corn Rhizosphere | MKNNAYESKSAFSVFLKNFGRNFVALFESGNKRDFQRLKDFITS |
| Ga0207652_102500462 | 3300025921 | Corn Rhizosphere | MKNQVYQRKSVFSVFFSNLAKNFAALFESGNKREFQRLKDFITS |
| Ga0207652_103455662 | 3300025921 | Corn Rhizosphere | NKYHYPLFKTKFMKNQVYQKKTAVSVFFHTLSKNFIALFESGNKKEFQRLKDFIAH |
| Ga0207659_112393591 | 3300025926 | Miscanthus Rhizosphere | QKKTVLSVFFTALSKNFIALFESGDKKEFQRLKDFISS |
| Ga0207644_107786431 | 3300025931 | Switchgrass Rhizosphere | MKNEVYQKKTVLSQFFSNLSKNFIALFETGNKKDFQRLKDFISS |
| Ga0207639_113188051 | 3300026041 | Corn Rhizosphere | YQKKTVLSQFFSNLSKNFIALFETGNKKEFQRLKDFISS |
| Ga0207639_118972101 | 3300026041 | Corn Rhizosphere | MRNQLYKRKSALSVFFSYLAKNFVALFESGNKREFQ |
| Ga0207674_100640041 | 3300026116 | Corn Rhizosphere | MKNNAYESKSAFSVFLKNFARNFVALFESGNKRDF |
| Ga0207698_100550711 | 3300026142 | Corn Rhizosphere | ILFLKTKFMKNQVYQKKTAVSVFFHTLSKNFIALFESGNKKEFQRLKDFIAH |
| Ga0207698_120117551 | 3300026142 | Corn Rhizosphere | DAYESKSALTVFFKNVAKNFVALFESGNKREFQRLKDFITS |
| Ga0207698_121376442 | 3300026142 | Corn Rhizosphere | MKNQVYQKKTAVSVFFHTLSKNFIALFESGNKKEFQRL |
| Ga0209178_10001758 | 3300027725 | Agricultural Soil | MKHSAPHKKSLLTVFFSNLSKNFIALFESGNKRDFQKLKDFITS |
| Ga0209073_101391191 | 3300027765 | Agricultural Soil | IVYLKIENVMKNHSYENKSAFSQFLKHVAKNFVALFESGNKREFQRLKDFITS |
| Ga0268266_116515532 | 3300028379 | Switchgrass Rhizosphere | MKNQVYQKKTVLSLFLSNLSKNFIALFESGDKKEFQRLKDFISS |
| Ga0311334_119732591 | 3300029987 | Fen | MKNQVYQKKTAFSVFFHTLSKNFVALFESGNKKEFQRL |
| Ga0170820_164950311 | 3300031446 | Forest Soil | KNQDHQKKTVLSLFLSTLSKNLIALFESGEKKEFQRLKDFISS |
| Ga0310811_107773021 | 3300033475 | Soil | MKNDAYESKSALTVFFKNVAKNFVALFESGNKREFQRLKDFITS |
| ⦗Top⦘ |