| Basic Information | |
|---|---|
| Family ID | F073508 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 120 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MFIGQVEETGVIEPLVFPRALPADEPVTPQTEPDEPVLEPAAAR |
| Number of Associated Samples | 101 |
| Number of Associated Scaffolds | 120 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 73.33 % |
| % of genes near scaffold ends (potentially truncated) | 31.67 % |
| % of genes from short scaffolds (< 2000 bps) | 84.17 % |
| Associated GOLD sequencing projects | 96 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.18 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (90.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (19.167 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.333 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (34.167 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.18 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 120 Family Scaffolds |
|---|---|---|
| PF01814 | Hemerythrin | 40.00 |
| PF05532 | CsbD | 15.00 |
| PF01028 | Topoisom_I | 5.83 |
| PF00149 | Metallophos | 1.67 |
| PF04545 | Sigma70_r4 | 1.67 |
| PF01566 | Nramp | 1.67 |
| PF13466 | STAS_2 | 0.83 |
| PF14907 | NTP_transf_5 | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
|---|---|---|---|
| COG3237 | Uncharacterized conserved protein YjbJ, UPF0337 family | Function unknown [S] | 15.00 |
| COG3569 | DNA topoisomerase IB | Replication, recombination and repair [L] | 5.83 |
| COG1914 | Mn2+ or Fe2+ transporter, NRAMP family | Inorganic ion transport and metabolism [P] | 1.67 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 90.00 % |
| Unclassified | root | N/A | 10.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090015|GPICI_8773747 | All Organisms → cellular organisms → Bacteria | 1531 | Open in IMG/M |
| 2140918013|NODE_4801_length_1319_cov_10.363153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1351 | Open in IMG/M |
| 2199352025|deepsgr__Contig_137048 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 2228664021|ICCgaii200_c0895273 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 743 | Open in IMG/M |
| 3300000363|ICChiseqgaiiFebDRAFT_11095918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1198 | Open in IMG/M |
| 3300002155|JGI24033J26618_1042721 | Not Available | 636 | Open in IMG/M |
| 3300002459|JGI24751J29686_10049758 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300003213|JGI26313J46564_100242 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2065 | Open in IMG/M |
| 3300004157|Ga0062590_102148953 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 583 | Open in IMG/M |
| 3300004479|Ga0062595_100686526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 819 | Open in IMG/M |
| 3300004479|Ga0062595_100698203 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 814 | Open in IMG/M |
| 3300004480|Ga0062592_100857209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 813 | Open in IMG/M |
| 3300004480|Ga0062592_100865617 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
| 3300004480|Ga0062592_102178970 | Not Available | 552 | Open in IMG/M |
| 3300005093|Ga0062594_102627473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 556 | Open in IMG/M |
| 3300005168|Ga0066809_10009987 | Not Available | 1764 | Open in IMG/M |
| 3300005294|Ga0065705_10179126 | All Organisms → cellular organisms → Bacteria | 1596 | Open in IMG/M |
| 3300005294|Ga0065705_10185898 | All Organisms → cellular organisms → Bacteria | 1538 | Open in IMG/M |
| 3300005294|Ga0065705_10938103 | Not Available | 564 | Open in IMG/M |
| 3300005345|Ga0070692_10872728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 620 | Open in IMG/M |
| 3300005441|Ga0070700_100045987 | All Organisms → cellular organisms → Bacteria | 2695 | Open in IMG/M |
| 3300005444|Ga0070694_100135241 | All Organisms → cellular organisms → Bacteria | 1785 | Open in IMG/M |
| 3300005444|Ga0070694_100157480 | All Organisms → cellular organisms → Bacteria | 1664 | Open in IMG/M |
| 3300005444|Ga0070694_101396331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 591 | Open in IMG/M |
| 3300005471|Ga0070698_100725326 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
| 3300005545|Ga0070695_101736317 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300005841|Ga0068863_100013956 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 7744 | Open in IMG/M |
| 3300006581|Ga0074048_10724220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 568 | Open in IMG/M |
| 3300006880|Ga0075429_100355982 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1282 | Open in IMG/M |
| 3300009011|Ga0105251_10061638 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1763 | Open in IMG/M |
| 3300009094|Ga0111539_10079014 | All Organisms → cellular organisms → Bacteria | 3869 | Open in IMG/M |
| 3300009100|Ga0075418_11226715 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 813 | Open in IMG/M |
| 3300009148|Ga0105243_10563211 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1091 | Open in IMG/M |
| 3300009811|Ga0105084_1003895 | All Organisms → cellular organisms → Bacteria | 2008 | Open in IMG/M |
| 3300009818|Ga0105072_1070441 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 680 | Open in IMG/M |
| 3300010147|Ga0126319_1312471 | All Organisms → cellular organisms → Bacteria | 2312 | Open in IMG/M |
| 3300010399|Ga0134127_10183162 | All Organisms → cellular organisms → Bacteria | 1933 | Open in IMG/M |
| 3300010400|Ga0134122_10296153 | All Organisms → cellular organisms → Bacteria | 1387 | Open in IMG/M |
| 3300010999|Ga0138505_100006551 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1244 | Open in IMG/M |
| 3300011119|Ga0105246_10270302 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1359 | Open in IMG/M |
| 3300011119|Ga0105246_12010403 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 558 | Open in IMG/M |
| 3300012204|Ga0137374_10430699 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
| 3300012355|Ga0137369_10138637 | All Organisms → cellular organisms → Bacteria | 1944 | Open in IMG/M |
| 3300012938|Ga0162651_100003461 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1601 | Open in IMG/M |
| 3300013306|Ga0163162_12527142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 591 | Open in IMG/M |
| 3300014325|Ga0163163_10019310 | All Organisms → cellular organisms → Bacteria | 6399 | Open in IMG/M |
| 3300014745|Ga0157377_10320661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1029 | Open in IMG/M |
| 3300015077|Ga0173483_10476004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 660 | Open in IMG/M |
| 3300015201|Ga0173478_10552356 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
| 3300015372|Ga0132256_102171123 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 660 | Open in IMG/M |
| 3300015374|Ga0132255_100133920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3429 | Open in IMG/M |
| 3300017965|Ga0190266_11366925 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 502 | Open in IMG/M |
| 3300017997|Ga0184610_1032227 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1477 | Open in IMG/M |
| 3300017997|Ga0184610_1172327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 716 | Open in IMG/M |
| 3300018027|Ga0184605_10117184 | All Organisms → cellular organisms → Bacteria | 1184 | Open in IMG/M |
| 3300018028|Ga0184608_10096872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1227 | Open in IMG/M |
| 3300018028|Ga0184608_10461448 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 546 | Open in IMG/M |
| 3300018031|Ga0184634_10300496 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 737 | Open in IMG/M |
| 3300018031|Ga0184634_10442538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 587 | Open in IMG/M |
| 3300018031|Ga0184634_10444730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 585 | Open in IMG/M |
| 3300018054|Ga0184621_10045915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1444 | Open in IMG/M |
| 3300018072|Ga0184635_10174506 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 858 | Open in IMG/M |
| 3300018073|Ga0184624_10019557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2507 | Open in IMG/M |
| 3300018075|Ga0184632_10479635 | Not Available | 512 | Open in IMG/M |
| 3300018078|Ga0184612_10068687 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1848 | Open in IMG/M |
| 3300018465|Ga0190269_10100415 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1417 | Open in IMG/M |
| 3300018469|Ga0190270_10031116 | All Organisms → cellular organisms → Bacteria | 3471 | Open in IMG/M |
| 3300018469|Ga0190270_11195170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 798 | Open in IMG/M |
| 3300019259|Ga0184646_1305775 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 870 | Open in IMG/M |
| 3300019263|Ga0184647_1085675 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 551 | Open in IMG/M |
| 3300019269|Ga0184644_1688809 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1130 | Open in IMG/M |
| 3300019269|Ga0184644_1778192 | Not Available | 501 | Open in IMG/M |
| 3300019767|Ga0190267_10063290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1326 | Open in IMG/M |
| 3300020005|Ga0193697_1008141 | All Organisms → cellular organisms → Bacteria | 2550 | Open in IMG/M |
| 3300020016|Ga0193696_1014272 | All Organisms → cellular organisms → Bacteria | 2150 | Open in IMG/M |
| 3300020080|Ga0206350_10105488 | Not Available | 879 | Open in IMG/M |
| 3300021082|Ga0210380_10373652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 651 | Open in IMG/M |
| 3300021082|Ga0210380_10580539 | Not Available | 514 | Open in IMG/M |
| 3300022195|Ga0222625_1546156 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1041 | Open in IMG/M |
| 3300022195|Ga0222625_1639365 | Not Available | 564 | Open in IMG/M |
| 3300022756|Ga0222622_10218107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1276 | Open in IMG/M |
| 3300025735|Ga0207713_1047288 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1742 | Open in IMG/M |
| 3300025908|Ga0207643_10007419 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 5882 | Open in IMG/M |
| 3300025920|Ga0207649_10777212 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 746 | Open in IMG/M |
| 3300025925|Ga0207650_10024966 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4254 | Open in IMG/M |
| 3300025926|Ga0207659_10123268 | All Organisms → cellular organisms → Bacteria | 1989 | Open in IMG/M |
| 3300025972|Ga0207668_10742138 | Not Available | 866 | Open in IMG/M |
| 3300026075|Ga0207708_10073373 | All Organisms → cellular organisms → Bacteria | 2622 | Open in IMG/M |
| 3300026088|Ga0207641_10285642 | All Organisms → cellular organisms → Bacteria | 1553 | Open in IMG/M |
| 3300026758|Ga0207559_100564 | All Organisms → cellular organisms → Bacteria | 1235 | Open in IMG/M |
| 3300027454|Ga0207623_101340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 896 | Open in IMG/M |
| 3300028589|Ga0247818_10665512 | Not Available | 720 | Open in IMG/M |
| 3300028711|Ga0307293_10039044 | All Organisms → cellular organisms → Bacteria | 1455 | Open in IMG/M |
| 3300028717|Ga0307298_10157214 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300028722|Ga0307319_10019737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2064 | Open in IMG/M |
| 3300028784|Ga0307282_10042249 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2010 | Open in IMG/M |
| 3300028796|Ga0307287_10132666 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
| 3300028803|Ga0307281_10112968 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 924 | Open in IMG/M |
| 3300028812|Ga0247825_10479778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 884 | Open in IMG/M |
| 3300028814|Ga0307302_10297255 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 794 | Open in IMG/M |
| 3300028828|Ga0307312_10284963 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1074 | Open in IMG/M |
| 3300028889|Ga0247827_10793674 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 626 | Open in IMG/M |
| 3300030829|Ga0308203_1047000 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 645 | Open in IMG/M |
| 3300030830|Ga0308205_1035158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 627 | Open in IMG/M |
| 3300030902|Ga0308202_1012586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1212 | Open in IMG/M |
| 3300030902|Ga0308202_1076575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 658 | Open in IMG/M |
| 3300030903|Ga0308206_1085608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 686 | Open in IMG/M |
| 3300031091|Ga0308201_10160657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 712 | Open in IMG/M |
| 3300031547|Ga0310887_10033546 | All Organisms → cellular organisms → Bacteria | 2172 | Open in IMG/M |
| 3300031547|Ga0310887_10277602 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 946 | Open in IMG/M |
| 3300031847|Ga0310907_10041999 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1724 | Open in IMG/M |
| 3300031847|Ga0310907_10867898 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 509 | Open in IMG/M |
| 3300031854|Ga0310904_10108570 | Not Available | 1540 | Open in IMG/M |
| 3300031858|Ga0310892_10141896 | All Organisms → cellular organisms → Bacteria | 1381 | Open in IMG/M |
| 3300031892|Ga0310893_10091009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1102 | Open in IMG/M |
| 3300032003|Ga0310897_10125009 | All Organisms → cellular organisms → Bacteria | 1053 | Open in IMG/M |
| 3300032013|Ga0310906_10026592 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2572 | Open in IMG/M |
| 3300032017|Ga0310899_10035536 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1735 | Open in IMG/M |
| 3300032075|Ga0310890_11079359 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300032211|Ga0310896_10530358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 649 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 19.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 12.50% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 10.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 8.33% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 6.67% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.50% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.50% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.50% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.50% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.67% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.67% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.67% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 1.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.67% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.67% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.83% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.83% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.83% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.83% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090015 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 2140918013 | Soil microbial communities from Great Prairies - Iowa soil (MSU Assemblies) | Environmental | Open in IMG/M |
| 2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
| 2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Host-Associated | Open in IMG/M |
| 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Host-Associated | Open in IMG/M |
| 3300003213 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10K4-12 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009811 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 | Environmental | Open in IMG/M |
| 3300009818 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 | Environmental | Open in IMG/M |
| 3300010147 | Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010999 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t3i015 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012938 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t2i015 | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019263 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019269 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300020005 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2 | Environmental | Open in IMG/M |
| 3300020016 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1 | Environmental | Open in IMG/M |
| 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300022195 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026758 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06K4-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027454 | Soil microbial communities from Kellog Biological Station, Michigan, USA - Nitrogen cycling UWRJ-G09K2-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300030829 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_357 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030830 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_368 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030902 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030903 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031091 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
| 3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPICI_02447460 | 2088090015 | Soil | MFIGEVEETGVIEPVVFPQVLADEPLPSTTETEDPVLEPAAI |
| Iowa-Corn-GraphCirc_03587700 | 2140918013 | Soil | MFIGRVEETGVIEPLVLPRIVFPRATPADEPVPPTTGSDEPVPEPAAAM |
| deepsgr_02224790 | 2199352025 | Soil | MFIGQVEETGVIEPLVFPRVVPVDEPVTQESEPDEPVLDPAAAR |
| ICCgaii200_08952731 | 2228664021 | Soil | MFIGEVEETGVIEPVVFPQVLADXPLPSXXETXDPVLXPAAT |
| ICChiseqgaiiFebDRAFT_110959182 | 3300000363 | Soil | MFIGRVEETGVIEPLVLPRIVFPRATPADEPVPPTTGSDEPVPEPAAAM* |
| JGI24033J26618_10427212 | 3300002155 | Corn, Switchgrass And Miscanthus Rhizosphere | MFIGQVEETGVIEPLVFPRALPADEPVTPQTEPDEPV |
| JGI24751J29686_100497583 | 3300002459 | Corn, Switchgrass And Miscanthus Rhizosphere | MFIGQVEETGVIEPLVFPRALPADEPVTPQTEPDEPVLEP |
| JGI26313J46564_1002424 | 3300003213 | Soil | MFIGQVEETGVIEPLVFPRALPADEPVTPQTEPDEPVLEPXAAR* |
| Ga0062590_1021489532 | 3300004157 | Soil | MFIGQVEETGVIEPVVFPRVVPADEPMVPSTEPEEPVLEPAAAM* |
| Ga0062595_1006865262 | 3300004479 | Soil | MFIGEVEETGVIEPVVFPQVLADEPLPSASETVDPVLEPAAT* |
| Ga0062595_1006982032 | 3300004479 | Soil | MFIGQVEETGVIEPLVFPRALPADEPVTPQTEPDEPVLEPVAAR* |
| Ga0062592_1008572093 | 3300004480 | Soil | KEAVMFIGQVEETGVIEPILFPRTVPADEPKVPSTEPDESVLEPAAAM* |
| Ga0062592_1008656173 | 3300004480 | Soil | FIGEVEETGVIEPVVFPQVLADEPLPSASETEDPVLEPAAT* |
| Ga0062592_1021789702 | 3300004480 | Soil | MFIGQVEETGVIEPLVFPRALPADEPVTPQTEPDEPVLEPAAAR* |
| Ga0062594_1026274732 | 3300005093 | Soil | MFMGQVEETGVIEPPVFPRVVAAAEPVAPQAEPDEPVMEPAAAR* |
| Ga0066809_100099871 | 3300005168 | Soil | MAVGIDTTALEEALMFIGEVEDTGVIEPVVFPRVVPADELVYSAETDDPILEPAAAV* |
| Ga0065705_101791263 | 3300005294 | Switchgrass Rhizosphere | VDPTWWVNHTAYAKEAVMFIGQVEETGVLEPLVFPRVVPADEPVTQETKPEEPVLEPAAAR* |
| Ga0065705_101858983 | 3300005294 | Switchgrass Rhizosphere | MFIGEVEETGVIEPVVFPQVLADEPLPSTTETEDPVLEPAAT* |
| Ga0065705_109381032 | 3300005294 | Switchgrass Rhizosphere | MIFIGQVEETGVIEPVVFPSVVPADEPRVPSTEPDEPAPEPAAAM* |
| Ga0070692_108727282 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MFIGQVEETGVIEPLVFPRALPADEPVTPQTEPDEPVLEPAAAM* |
| Ga0070700_1000459876 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MFIGQVEETGVIEPILFPRTVPADEPKVPSTEPDESVLEPAAAM* |
| Ga0070694_1001352411 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MFIGEVEETGVIEPVVFPQVLADEPLPSATETEDPVLEPAAT* |
| Ga0070694_1001574801 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MFIGQVEETGVIEPILFPRTVPADEPKVPSTEPDESVLEPA |
| Ga0070694_1013963311 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | FIGQVEETGVIEPLVFPRALPADEPVAPQTEPDEPVLEPAAAR* |
| Ga0070698_1007253262 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MFIGQVEETGVIEPLRFPLVAPADQPVSPQTESGEPILEPAAAR* |
| Ga0070695_1017363172 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MFIGQVEETGVIEPVVFPQVLADEPLPSATETEDPVLEPAAT* |
| Ga0068863_1000139567 | 3300005841 | Switchgrass Rhizosphere | MFIGQVEETGVIEPLVFPRALPADEPVTPQTEPDEAVLEPAAAR* |
| Ga0074048_107242202 | 3300006581 | Soil | ALEEALMFIGEVEDTGVIEPVVFPQVVPADELVYSAETDDPILEPAAAV* |
| Ga0075429_1003559823 | 3300006880 | Populus Rhizosphere | MFIGEVEETGVIEPVVFPQVLADEPLPSTTETEDPVPEPAAT* |
| Ga0105251_100616385 | 3300009011 | Switchgrass Rhizosphere | GRCDPTVVGNHTADAKEAVMFIGQVEETGVIEPLVFPRALPADEPVTPQTEPDEPVLEPVAAR* |
| Ga0111539_100790142 | 3300009094 | Populus Rhizosphere | MFIGQVEEIGLIEPLVFPRVVPADEPVSPPTESDEPILEPTAAG* |
| Ga0075418_112267152 | 3300009100 | Populus Rhizosphere | MFIGEVEETGVIEPVVFPQVLADEPLPSTTETEVRIPEPAAAT* |
| Ga0105243_105632113 | 3300009148 | Miscanthus Rhizosphere | MFIGQVEETGVIEPILFPRTVPADEPKVPSTEPDESVLE |
| Ga0105084_10038953 | 3300009811 | Groundwater Sand | MFIGEVEETGVIEPVVFPQVLADEPLPSASETEDPVLEPAAT* |
| Ga0105072_10704411 | 3300009818 | Groundwater Sand | STPQTEEAVMFIGEVEETGFIEPVVFPQVVADEPVPSTTETEDPVLEPAAT* |
| Ga0126319_13124714 | 3300010147 | Soil | MFIGQVEETGVIEPVVFPRAVPADEPVTPPTEPDDPLLEPAAAM* |
| Ga0134127_101831623 | 3300010399 | Terrestrial Soil | MFIGQVEETGVIEPLVFPLVAPADQPVSPQTESGEPILEPAAAR* |
| Ga0134122_102961531 | 3300010400 | Terrestrial Soil | MFIGQVEETGIIEPVVFPRVVLADEPIVPSTEPDELAPEPAAAM* |
| Ga0138505_1000065512 | 3300010999 | Soil | MFIGEVEETGVIEPVVFPQVLADELLPSATETEDPVLEPAAT* |
| Ga0105246_102703023 | 3300011119 | Miscanthus Rhizosphere | VVGNHTADAKEAVMFIGQVEETGVIEPLVFPRALPADEPVTPQTEPDEPVLEPVAAR* |
| Ga0105246_120104032 | 3300011119 | Miscanthus Rhizosphere | MFIGQVEETGVIEPLVFPRVVPADEPVSPQTESDEPILEPAAAR* |
| Ga0137374_104306993 | 3300012204 | Vadose Zone Soil | MFIGEVEETGVIEPVVFPQILADEPRPSTTETEDPVLEPAAT* |
| Ga0137369_101386375 | 3300012355 | Vadose Zone Soil | VVFIGEVEETGVIEPVVFPQILADEPRPSTTETEDPVLEPAAT* |
| Ga0162651_1000034614 | 3300012938 | Soil | TGVIEPVVFPQILADEPLPSATETEDPVLEPAAT* |
| Ga0163162_125271422 | 3300013306 | Switchgrass Rhizosphere | VVGNHTADAKEAVMFIGQVEETGVIEPLVFPRALPADEPVTPQTEPDEPVLEPAAAR* |
| Ga0163163_100193101 | 3300014325 | Switchgrass Rhizosphere | AKEAVMFIGQVEETGVIEPLVFPRALPADEPVTPHTEPDEPILEPAAAR* |
| Ga0157377_103206611 | 3300014745 | Miscanthus Rhizosphere | VEETGVIEPVVFPQVLADEPLPSTTETEDPVLEPAAT* |
| Ga0173483_104760041 | 3300015077 | Soil | MFIGQVEETGVIEPILFPRTVPADEPKVPSTEPDES |
| Ga0173478_105523562 | 3300015201 | Soil | MLIGRVEETGVIEPLVFPRALPADEPVTPQTEPDEPVLEPVAAR* |
| Ga0132256_1021711231 | 3300015372 | Arabidopsis Rhizosphere | KEAVMFIGQVEETGVIEPLVFPRALPADEPVTPQTEPDEPVLEPVAAR* |
| Ga0132255_1001339208 | 3300015374 | Arabidopsis Rhizosphere | VDPTWWGNHTADAKEAVMFIGQVEETGVLEPLVFPRVVPADEPVTQETKPEEPVLEPAAAR* |
| Ga0190266_113669252 | 3300017965 | Soil | MFIGEVEETGVIEPVVFPQVLADDPLHSTTETEDPVLEPAAT |
| Ga0184610_10322271 | 3300017997 | Groundwater Sediment | GYRHRRPEEAVMFIGEVEETGVIEPVVFPQVVADEPDPSRTETEDPVPDPRQPCDV |
| Ga0184610_11723272 | 3300017997 | Groundwater Sediment | MFIGEVEETGIIEPVVFPRVEPADEPVPSRTEAEDPVPEPAAAV |
| Ga0184605_101171842 | 3300018027 | Groundwater Sediment | MLIGEVEETGVIEPVVFPRVVPADEPSVPSTEPDEPVLEPAAAM |
| Ga0184608_100968724 | 3300018028 | Groundwater Sediment | MFIGEVEETGVIEPVVFPQVVADEPVPSRTETEDPVPDPRQPCDV |
| Ga0184608_104614481 | 3300018028 | Groundwater Sediment | MLIGEVEETGVIEPVVFPRVVPADEPAHAATEIEDPVLEPAAAM |
| Ga0184634_103004961 | 3300018031 | Groundwater Sediment | MFIGQVEETGVIEPLVFPRAVLADEPVTPTTGSGEPAPEPAVAK |
| Ga0184634_104425381 | 3300018031 | Groundwater Sediment | MFIGEVEETGVIEPVVFPQVLADEPLPSASATEDPVLEPAAT |
| Ga0184634_104447302 | 3300018031 | Groundwater Sediment | GYRHRRPEETVMFIGEVEETGVIEPVVFPQVLADEPVPSRTETEDPVPDPRQPCDV |
| Ga0184621_100459152 | 3300018054 | Groundwater Sediment | MFIGEVEQTGIIEPVVFPRVEPADEPVPSRTEAEDPVPEPAAAV |
| Ga0184635_101745061 | 3300018072 | Groundwater Sediment | AVMFIGEVEETGVIEPVVFPQVVADEPDPSRTETEDPVPDPRQPCDV |
| Ga0184624_100195573 | 3300018073 | Groundwater Sediment | MFIGEVEETGVIEPVVFPQVVADEPDPSRTETEDPVPDPRQPCDV |
| Ga0184632_104796351 | 3300018075 | Groundwater Sediment | MFIGEVEETGVIEPVVFPQVLADEPVPSRTETEDPVPDPRQPCDV |
| Ga0184612_100686871 | 3300018078 | Groundwater Sediment | IGEVEETGVIEPVVFPQVLADEPLPSASATEDPVLEPAAT |
| Ga0190269_101004153 | 3300018465 | Soil | MFIGEVEETGVIEPVVFPQVLADDPLPSTTETEDPVLEPAAT |
| Ga0190270_100311165 | 3300018469 | Soil | MFIGEVVETGVIEPVVFPQVLADEPLPCTTETEVPVPESAAAT |
| Ga0190270_111951701 | 3300018469 | Soil | MFIGQVEDTGVIEPLVFPRVVAADEPMTPQTEPDGPVLEPAAAR |
| Ga0184646_13057751 | 3300019259 | Groundwater Sediment | VMFIGEVEETGIIEPVVFPRVEPADEPVPSRTEAEDPVPEPAAAV |
| Ga0184647_10856751 | 3300019263 | Groundwater Sediment | MFIGQVEETGVIEPVVFPRVVLADEPMVPSTEPDEPAPEPAAAM |
| Ga0184644_16888092 | 3300019269 | Groundwater Sediment | MFIGEVEETGVIEPVVFPQVVADEPVPSRTETEDPVPDPRQPCDA |
| Ga0184644_17781922 | 3300019269 | Groundwater Sediment | GYRHRRPEEAVMFIGEVEETGIIEPVVFPRVEPADEPVPSRTEAEDPVPEPAAAV |
| Ga0190267_100632902 | 3300019767 | Soil | MFIGEVEETGVIEPVVFPQVLADEPLPSTTETEDSVLEPAAT |
| Ga0193697_10081414 | 3300020005 | Soil | MEPKEAVMFIGQVEETGVIEPVVFPRVVPADEPRVPSTEPDEPVLEPAAAM |
| Ga0193696_10142727 | 3300020016 | Soil | HTMEPKEAVMFIGQVEETGVIEPVVFPRVVPADEPRVPSTEPDEPVLEPAAAM |
| Ga0206350_101054882 | 3300020080 | Corn, Switchgrass And Miscanthus Rhizosphere | MFIGQVEETGVIEPLVFPRALPADEPVTPQTEPDEPVLEPAAAR |
| Ga0210380_103736522 | 3300021082 | Groundwater Sediment | VDPKEAVMFIGEVEETGVIEPVVFPRVVPADEPADAATGIEDPVLEPAAAM |
| Ga0210380_105805391 | 3300021082 | Groundwater Sediment | GRPESGVVDPTVVGSPHRDAKEAVMFIGQVEETGVIEPLLFPRVVPADEPVTPATEPDEPVLEPAAAR |
| Ga0222625_15461562 | 3300022195 | Groundwater Sediment | MFIGEVEETGVIEPVVFPRVVPADEPAHAATEIEDPVLEPAAAM |
| Ga0222625_16393652 | 3300022195 | Groundwater Sediment | MFIGEVVETGVIEPVVFPQVLADEPLPCTTETEVPVPEPAAAT |
| Ga0222622_102181072 | 3300022756 | Groundwater Sediment | MFIGQVEETGVIEPVVFPRVVPADEPRVPSTEPDEPVLEPAAAM |
| Ga0207713_10472881 | 3300025735 | Switchgrass Rhizosphere | TVVGNHTADAKEAVMFIGQVEETGVIEPLVFPRALPADEPVTPQTEPDEPVLEPVAAR |
| Ga0207643_100074194 | 3300025908 | Miscanthus Rhizosphere | MFIGQVEETGVIEPLVFPRALPADEPVTPQTEPDEPVLEPVAAR |
| Ga0207649_107772122 | 3300025920 | Corn Rhizosphere | MFIGQVEETGVIEPLVFPRALPADEPVTPQTKPDEPVLEPAAAR |
| Ga0207650_100249664 | 3300025925 | Switchgrass Rhizosphere | MFIGEVEETGVIEPVVFPQVLADEPLPSTTETEDPVLEPAAT |
| Ga0207659_101232684 | 3300025926 | Miscanthus Rhizosphere | VVGNHTADAKEAVMFIGQVEETGVIEPLVFPRALPADEPVTPQTEPDEPVLEPAAAR |
| Ga0207668_107421382 | 3300025972 | Switchgrass Rhizosphere | VDPTARVNHTADAKEAVMFMGQVEETGVIEPPVFPRVVGAAEPVAPQAEPDEPVMESAAA |
| Ga0207708_100733732 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MFIGQVEETGVIEPILFPRTVPADEPKVPSTEPDESVLEPAAAM |
| Ga0207641_102856423 | 3300026088 | Switchgrass Rhizosphere | MFIGQVEETGVIEPLVFPRALPADEPVTPQTEPDEAVLEPAAAR |
| Ga0207559_1005643 | 3300026758 | Soil | MFIGQVEETGVIEPLVFPRALPADEPVTPQTEPDE |
| Ga0207623_1013402 | 3300027454 | Soil | MFIGEVEETGVIEPLVFPRALPADEPVTPQTEPDEPVLEPAAAR |
| Ga0247818_106655122 | 3300028589 | Soil | MIFIGQVEETGVIEPVVFPSVVPADEPRVPSTEPDEPAPEPAAAR |
| Ga0307293_100390443 | 3300028711 | Soil | MFIGEVEETGVIEPVVFPQVLADEPLPSATETEDPVLEPAAT |
| Ga0307298_101572141 | 3300028717 | Soil | MFIGEVEETGVIEPVVFPRVVPADEPAHAATEIEDPVLE |
| Ga0307319_100197374 | 3300028722 | Soil | MFIGEVEETGVIEPVVFPQVVADEPVPSRTETEDPVPDPRQPCD |
| Ga0307282_100422493 | 3300028784 | Soil | MFIGEVVETGVIEPVVFPRAVPADEPVPSRTEAEDPIPQPAAAT |
| Ga0307287_101326662 | 3300028796 | Soil | VGIHHTMDPKEAVMFIGQVEETGVIEPVVFPRVVPADEPRVPSTEPDEPVLEPAAAM |
| Ga0307281_101129683 | 3300028803 | Soil | VDPKEAVMFIGEVEETGVIEPVVFPRVVPADEPAHAATEIEDPVLEPAAAM |
| Ga0247825_104797782 | 3300028812 | Soil | VDPTWWVNHTADAKEAVMFIGQVEETGVLEPLVFPRVVPADEPVTQETEPEEPVLEPAAA |
| Ga0307302_102972552 | 3300028814 | Soil | MDPKEAVMFIGQVEETGVIEPVVFPRVVPADEPRVPSTEPDEPVLEPAAAM |
| Ga0307312_102849633 | 3300028828 | Soil | QGGVMFIGEVVETGVIEPVVFPRAVPADEPVPSRTEAEDPIPQPAAAT |
| Ga0247827_107936742 | 3300028889 | Soil | MFMEQVEETGVIEPPVFPRVVAAAEPVAPQAEPDEPVMEPAAAR |
| Ga0308203_10470001 | 3300030829 | Soil | DGTGYRHRRPEEAVMFIGEVEETGVIEPVVFPQVLADEPLPSATETEDPVLEPAAT |
| Ga0308205_10351582 | 3300030830 | Soil | VMFIGEVEETGVIEPVVFPQVVADEPVPSRTETEDPVPDPRQPCDV |
| Ga0308202_10125861 | 3300030902 | Soil | VMFIGEVEETGIIEPVVFPRVEPADEPVPSRTEAEDPVPEPEAAV |
| Ga0308202_10765752 | 3300030902 | Soil | VMFIGEVEETGVIEPVVFPQVLADEPLPSATETEDPVLEPAAT |
| Ga0308206_10856082 | 3300030903 | Soil | VDPKEAVMFIGQVEETGVIEPVVFPRVVPADEPRVPSTEPDEPVLEPAAAM |
| Ga0308201_101606571 | 3300031091 | Soil | MFIGEVEETGVIEPGVFPRVEPADEPVPSSTEAEVPILGPAAAR |
| Ga0310887_100335464 | 3300031547 | Soil | VDPTWWVNHTAYAKEAVMFIGQVEETGVLEPLVFPRVVPADEPVTQETKPEEPVLEPAAA |
| Ga0310887_102776021 | 3300031547 | Soil | VEETGVLEPLVFPRVVPADEPVTQETEPDEPVLEPAAAR |
| Ga0310907_100419991 | 3300031847 | Soil | NHTAYAKEAVMFIGQVEETGVLEPLVFPRVVPADEPVTQETEPEEPVLEPAAAR |
| Ga0310907_108678981 | 3300031847 | Soil | MFIGQVEETGVLEPLVFPRVVPADEPVTQETEPEEP |
| Ga0310904_101085703 | 3300031854 | Soil | VDPTWWVNHTADAKEAVMFIGQVEETGVLEPLVFPRVVPADEPVTQETEPDEPVLEPAAA |
| Ga0310892_101418962 | 3300031858 | Soil | VDPTWWVNHTAYAKEAVMFIGQVEETGVLEPLVFPRVVPADEPVTQETEPEEPALEPAAA |
| Ga0310893_100910092 | 3300031892 | Soil | MFIGQVEETGVLEPLVFPRVVPADEPVTQETEPEEPVLEPAAAR |
| Ga0310897_101250091 | 3300032003 | Soil | MFIGQVEETGVIEPLVFPRALPADEPVTPHTEPDEPILEPAAAR |
| Ga0310906_100265924 | 3300032013 | Soil | MFIGQVEETGVLEPLVFPRVVPADEPVTQETEPDEPVLEPAAAR |
| Ga0310899_100355362 | 3300032017 | Soil | VDPTWWVNHTAYAKEAVMFIGQVEETGVIEPLVFPRVVPANEPVTPQTEPDEPVLEPAAA |
| Ga0310890_110793591 | 3300032075 | Soil | MFIGKVEETGVIEPVVFPRVVPADEPMVPTTEPQEPVLEPAAAM |
| Ga0310896_105303582 | 3300032211 | Soil | VMFIGQVEETGVIEPLVFPRALPADEPVTPQTEPDEPVLEPAAAR |
| ⦗Top⦘ |