| Basic Information | |
|---|---|
| Family ID | F072803 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 121 |
| Average Sequence Length | 44 residues |
| Representative Sequence | VATAPKFRIDVDIHNLLMNSAPGPVRVPAPQGLTLPEPVFPQYPE |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 121 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 97.46 % |
| % of genes near scaffold ends (potentially truncated) | 92.56 % |
| % of genes from short scaffolds (< 2000 bps) | 85.12 % |
| Associated GOLD sequencing projects | 92 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.27 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (79.339 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (23.967 % of family members) |
| Environment Ontology (ENVO) | Unclassified (40.496 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (66.942 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 13.70% β-sheet: 0.00% Coil/Unstructured: 86.30% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.27 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 121 Family Scaffolds |
|---|---|---|
| PF09989 | DUF2229 | 23.14 |
| PF13620 | CarboxypepD_reg | 4.96 |
| PF00587 | tRNA-synt_2b | 2.48 |
| PF00005 | ABC_tran | 1.65 |
| PF08281 | Sigma70_r4_2 | 1.65 |
| PF09411 | PagL | 1.65 |
| PF01464 | SLT | 0.83 |
| PF04140 | ICMT | 0.83 |
| PF13590 | DUF4136 | 0.83 |
| PF07228 | SpoIIE | 0.83 |
| PF00326 | Peptidase_S9 | 0.83 |
| PF08308 | PEGA | 0.83 |
| PF04055 | Radical_SAM | 0.83 |
| PF03928 | HbpS-like | 0.83 |
| PF04073 | tRNA_edit | 0.83 |
| PF00664 | ABC_membrane | 0.83 |
| PF00072 | Response_reg | 0.83 |
| PF09594 | GT87 | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 79.34 % |
| Unclassified | root | N/A | 20.66 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000789|JGI1027J11758_11820509 | Not Available | 507 | Open in IMG/M |
| 3300000955|JGI1027J12803_102539886 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300000955|JGI1027J12803_105740165 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300001141|JGI12638J13249_100644 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 1182 | Open in IMG/M |
| 3300001143|JGI12687J13287_103026 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 536 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100690445 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 899 | Open in IMG/M |
| 3300003368|JGI26340J50214_10027308 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 1717 | Open in IMG/M |
| 3300005167|Ga0066672_10016606 | Not Available | 3747 | Open in IMG/M |
| 3300005332|Ga0066388_100000925 | All Organisms → cellular organisms → Bacteria | 15392 | Open in IMG/M |
| 3300005332|Ga0066388_104025132 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300005434|Ga0070709_10401897 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1023 | Open in IMG/M |
| 3300005563|Ga0068855_101747044 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 633 | Open in IMG/M |
| 3300005586|Ga0066691_10512152 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 716 | Open in IMG/M |
| 3300005602|Ga0070762_10317540 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 986 | Open in IMG/M |
| 3300005713|Ga0066905_100324643 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 1219 | Open in IMG/M |
| 3300005921|Ga0070766_10085323 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1845 | Open in IMG/M |
| 3300005921|Ga0070766_10158825 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 1390 | Open in IMG/M |
| 3300006052|Ga0075029_100273440 | All Organisms → cellular organisms → Bacteria | 1072 | Open in IMG/M |
| 3300006163|Ga0070715_10036195 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2035 | Open in IMG/M |
| 3300006163|Ga0070715_10209200 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 996 | Open in IMG/M |
| 3300006176|Ga0070765_101797584 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 575 | Open in IMG/M |
| 3300006806|Ga0079220_11510054 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300006903|Ga0075426_10230227 | All Organisms → cellular organisms → Bacteria | 1347 | Open in IMG/M |
| 3300009623|Ga0116133_1075135 | Not Available | 846 | Open in IMG/M |
| 3300010047|Ga0126382_11244413 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 669 | Open in IMG/M |
| 3300010048|Ga0126373_10907957 | Not Available | 945 | Open in IMG/M |
| 3300010048|Ga0126373_11805522 | Not Available | 675 | Open in IMG/M |
| 3300010358|Ga0126370_11013527 | Not Available | 759 | Open in IMG/M |
| 3300010358|Ga0126370_12147446 | Not Available | 549 | Open in IMG/M |
| 3300010359|Ga0126376_10226295 | Not Available | 1572 | Open in IMG/M |
| 3300010360|Ga0126372_11136874 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 802 | Open in IMG/M |
| 3300010360|Ga0126372_12954355 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 527 | Open in IMG/M |
| 3300010361|Ga0126378_10503615 | Not Available | 1326 | Open in IMG/M |
| 3300010362|Ga0126377_11410136 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 770 | Open in IMG/M |
| 3300010376|Ga0126381_100324519 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2118 | Open in IMG/M |
| 3300010376|Ga0126381_100864715 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 1300 | Open in IMG/M |
| 3300010376|Ga0126381_104995216 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
| 3300010397|Ga0134124_13063481 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300010398|Ga0126383_11202469 | Not Available | 848 | Open in IMG/M |
| 3300011120|Ga0150983_11583025 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 594 | Open in IMG/M |
| 3300012363|Ga0137390_11725251 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300012944|Ga0137410_11827071 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300012971|Ga0126369_10580356 | Not Available | 1189 | Open in IMG/M |
| 3300012971|Ga0126369_10830767 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
| 3300012971|Ga0126369_12054132 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 659 | Open in IMG/M |
| 3300012971|Ga0126369_13544594 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 511 | Open in IMG/M |
| 3300015373|Ga0132257_100675482 | All Organisms → cellular organisms → Bacteria | 1282 | Open in IMG/M |
| 3300016387|Ga0182040_10933891 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 721 | Open in IMG/M |
| 3300016387|Ga0182040_11740834 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300017948|Ga0187847_10012695 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5481 | Open in IMG/M |
| 3300017972|Ga0187781_11332635 | Not Available | 530 | Open in IMG/M |
| 3300018007|Ga0187805_10640663 | Not Available | 503 | Open in IMG/M |
| 3300018012|Ga0187810_10410218 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 570 | Open in IMG/M |
| 3300018062|Ga0187784_11690117 | Not Available | 501 | Open in IMG/M |
| 3300018085|Ga0187772_10585207 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300018090|Ga0187770_11793891 | Not Available | 502 | Open in IMG/M |
| 3300020583|Ga0210401_10198296 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1865 | Open in IMG/M |
| 3300020583|Ga0210401_10517689 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 1055 | Open in IMG/M |
| 3300020583|Ga0210401_10850768 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 771 | Open in IMG/M |
| 3300020583|Ga0210401_11609036 | Not Available | 507 | Open in IMG/M |
| 3300021170|Ga0210400_10000524 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 42681 | Open in IMG/M |
| 3300021180|Ga0210396_11012324 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300021180|Ga0210396_11122405 | Not Available | 661 | Open in IMG/M |
| 3300021384|Ga0213876_10043921 | Not Available | 2362 | Open in IMG/M |
| 3300021404|Ga0210389_11033858 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300021405|Ga0210387_10293603 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 1429 | Open in IMG/M |
| 3300021406|Ga0210386_11223149 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 634 | Open in IMG/M |
| 3300021420|Ga0210394_10730068 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 867 | Open in IMG/M |
| 3300021420|Ga0210394_11003001 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300021420|Ga0210394_11280079 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 627 | Open in IMG/M |
| 3300021475|Ga0210392_10741139 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 732 | Open in IMG/M |
| 3300022525|Ga0242656_1136621 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 508 | Open in IMG/M |
| 3300022709|Ga0222756_1004884 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 1364 | Open in IMG/M |
| 3300022716|Ga0242673_1132345 | Not Available | 510 | Open in IMG/M |
| 3300022717|Ga0242661_1000038 | All Organisms → cellular organisms → Bacteria | 6495 | Open in IMG/M |
| 3300022724|Ga0242665_10147589 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 740 | Open in IMG/M |
| 3300025916|Ga0207663_10865084 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300025928|Ga0207700_10502443 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 1073 | Open in IMG/M |
| 3300025929|Ga0207664_11161772 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300025939|Ga0207665_10858582 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 719 | Open in IMG/M |
| 3300025939|Ga0207665_10905482 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 700 | Open in IMG/M |
| 3300026309|Ga0209055_1002698 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 11074 | Open in IMG/M |
| 3300026333|Ga0209158_1055436 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1605 | Open in IMG/M |
| 3300026334|Ga0209377_1293216 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
| 3300026508|Ga0257161_1051400 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 833 | Open in IMG/M |
| 3300026552|Ga0209577_10772824 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
| 3300027050|Ga0209325_1007957 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 1159 | Open in IMG/M |
| 3300027795|Ga0209139_10063997 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 1289 | Open in IMG/M |
| 3300027824|Ga0209040_10218186 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 977 | Open in IMG/M |
| 3300027869|Ga0209579_10400746 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 744 | Open in IMG/M |
| 3300027889|Ga0209380_10002590 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 11512 | Open in IMG/M |
| 3300028906|Ga0308309_11410395 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 597 | Open in IMG/M |
| 3300029636|Ga0222749_10470553 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300030862|Ga0265753_1049319 | Not Available | 743 | Open in IMG/M |
| 3300031564|Ga0318573_10620739 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 582 | Open in IMG/M |
| 3300031680|Ga0318574_10168213 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 1251 | Open in IMG/M |
| 3300031718|Ga0307474_10401970 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 1066 | Open in IMG/M |
| 3300031753|Ga0307477_10117097 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1856 | Open in IMG/M |
| 3300031754|Ga0307475_10096239 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2304 | Open in IMG/M |
| 3300031792|Ga0318529_10460628 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 592 | Open in IMG/M |
| 3300031833|Ga0310917_11035306 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
| 3300031910|Ga0306923_10296684 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui | 1847 | Open in IMG/M |
| 3300031942|Ga0310916_10061396 | Not Available | 2910 | Open in IMG/M |
| 3300031954|Ga0306926_10451533 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 1583 | Open in IMG/M |
| 3300031962|Ga0307479_11754440 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300031962|Ga0307479_11878733 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
| 3300031981|Ga0318531_10562638 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300032055|Ga0318575_10455572 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 650 | Open in IMG/M |
| 3300032076|Ga0306924_11097871 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 867 | Open in IMG/M |
| 3300032180|Ga0307471_100086831 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2779 | Open in IMG/M |
| 3300032180|Ga0307471_100492644 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 1372 | Open in IMG/M |
| 3300032180|Ga0307471_102731229 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300032261|Ga0306920_100382372 | Not Available | 2093 | Open in IMG/M |
| 3300032783|Ga0335079_10020061 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7662 | Open in IMG/M |
| 3300032828|Ga0335080_10818510 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 961 | Open in IMG/M |
| 3300032829|Ga0335070_10715162 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
| 3300032893|Ga0335069_10317017 | All Organisms → cellular organisms → Bacteria | 1851 | Open in IMG/M |
| 3300032893|Ga0335069_10468610 | All Organisms → cellular organisms → Bacteria | 1466 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 23.97% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 15.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.44% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.61% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.96% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.96% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.13% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.13% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.31% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.48% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.48% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.65% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.65% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.65% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.83% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.83% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.83% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.83% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.83% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.83% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.83% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.83% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001141 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 | Environmental | Open in IMG/M |
| 3300001143 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003368 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300022525 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022709 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022716 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022717 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027050 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030862 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J11758_118205092 | 3300000789 | Soil | MATAPKFRIDVDIHNLLMHSSPEPVKRPVPMGITLPEPIFPQYPAKLADAGAEAP |
| JGI1027J12803_1025398862 | 3300000955 | Soil | MATAPKFRIDVDIHNLLMNSSREPVRPAAFNGLTLPEPVFPQYPEKL |
| JGI1027J12803_1057401652 | 3300000955 | Soil | MATAPKFRIDVDIHNLLMNSNPGPVVVPQPKGAILPEPVFPRFPE |
| JGI12638J13249_1006441 | 3300001141 | Forest Soil | MATAPKFRIDVDIHNLLMNTAQTPAKPVLVKGRKLPDPVFPRFP |
| JGI12687J13287_1030262 | 3300001143 | Forest Soil | MATAPKFRIDVDIHNLLMNTAQAPAKPALVKGKRLPDPVFPRF |
| JGIcombinedJ26739_1006904452 | 3300002245 | Forest Soil | MASAPKFRIDIDIHNLLMNSAPGPVAVPPPKGMKLPEPVFPRFP |
| JGI26340J50214_100273081 | 3300003368 | Bog Forest Soil | VATAPKFRIDVDIHNLLMNSAPGPVRVPAPQGLTLPEPVFPQYPE |
| Ga0066672_100166062 | 3300005167 | Soil | MATAPKFRIDVDIHNPLVNTAQTPAKPGLVMGRKLPDPVG* |
| Ga0066388_1000009251 | 3300005332 | Tropical Forest Soil | MASAPKFRIDVDIHNLLMDSSRKPVRPAAVRGMTLPEPVFPRYPEKLTDPGPEIAP |
| Ga0066388_1040251322 | 3300005332 | Tropical Forest Soil | MATSAPAKFRIDVSIHNLLMNSPTGTSTPPKPKGMTLPEPVFPQHP |
| Ga0070709_104018972 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MASAPKFRIDVDIHNLLMDSSRQVVKPAAAKGLTLPEPVFPQYPEKL |
| Ga0070735_100493513 | 3300005534 | Surface Soil | VATAPKFRIDVDIHNLLMNSAGPVPVPSPLGWKLPDPIYPLHPERVNDPGPEVIP |
| Ga0068855_1017470442 | 3300005563 | Corn Rhizosphere | MATVPKFRIDVDIHNLLMQPAPGPVPVPANGLNLPEPVFPQYPEK |
| Ga0066691_105121522 | 3300005586 | Soil | MATAPKFRIDVDIHDLLMDSSREPARPAAVKGLTLPEPVFPQYPEKLVDPG |
| Ga0070762_103175402 | 3300005602 | Soil | MASVPKFRIDVDIHNLLMNSAPGPVVVPPPKGMKLPE |
| Ga0066905_1003246432 | 3300005713 | Tropical Forest Soil | VATAPKFRIDVDIHNLLMHSAPGPVAVPPPKGLKLPDPVFPRFPEKLAD |
| Ga0070766_100853231 | 3300005921 | Soil | MATAPKFRIDVDIHDLLMDSSRQTVRPAAVKGLTLPEPVFPQCPDQLVDPGPEI |
| Ga0070766_101588251 | 3300005921 | Soil | VATAPKFRIDVDIHNLLMHSAPGPVAVPAAKGMKLPDPVFPRFPEKLLDPGP |
| Ga0075029_1002734402 | 3300006052 | Watersheds | MAVAPKFRIDVDIHNLLMHSAPGPVALPEPRGFSLPE |
| Ga0070715_100361951 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MASAPKFRIDVDIHNLLMDSSRQVVKPAAAKGLTLPEPVFPQYPEKLA |
| Ga0070715_102092001 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | VATVPKFRIDVDIHNLLMHSAPGPVAVPAAKGMELPDPVFPRFPEKLLDPGPD |
| Ga0070765_1017975841 | 3300006176 | Soil | VATAPKFRIDVDIHNLLMNSAPGPVVAPPPKGWKLPDAVYP |
| Ga0079220_115100542 | 3300006806 | Agricultural Soil | MATAPKFRIDVDIHNLLMNSSREPVRPAAPKGLTLPE |
| Ga0075426_102302273 | 3300006903 | Populus Rhizosphere | MATAPKFRIDVDIHDLLMHSSPEPVKLPTPMGMTLPEPVF |
| Ga0116133_10751352 | 3300009623 | Peatland | VATAPKFRIDVDIHNLLMHSAPGPVAVPVARGMKL |
| Ga0126382_112444131 | 3300010047 | Tropical Forest Soil | VATAPKFRIDIDVHDLLTHSAAGPVAAPAGKGMKLPDPVFPRFPEKLL |
| Ga0126373_109079572 | 3300010048 | Tropical Forest Soil | MATAPKFRIDVDIHNLLMDSSREPVRPAAVKGMTLPEPLFPQY |
| Ga0126373_118055221 | 3300010048 | Tropical Forest Soil | MAAAPKFRIDVDIHNLLMDSSREPVRPAAVKGMTLPEPLFPQY |
| Ga0126370_110135272 | 3300010358 | Tropical Forest Soil | MATAPKFRIDVDIHNLLMHASPEPVKPPAPKGVTLPEPVFP |
| Ga0126370_121474461 | 3300010358 | Tropical Forest Soil | MATAPKFRIDVDIHNLLMDSSRQPVKPAAAKGLKFPEPVFP |
| Ga0126376_102262953 | 3300010359 | Tropical Forest Soil | MATAPKFRIDVDIHNLLMHASPEPVKPPAPKGMTLPEPVFPQYP |
| Ga0126372_111368741 | 3300010360 | Tropical Forest Soil | VATAPKFRIDVDIHNLLMHSPPAPVRVPGGKGAKLPN |
| Ga0126372_129543551 | 3300010360 | Tropical Forest Soil | MATAPKFRIDVDIHNLLMHSAPGPVPVPAPRGMPLPDP |
| Ga0126378_103040021 | 3300010361 | Tropical Forest Soil | MAAPQFRIDVDIHNLLMNRGSGPAKPAAHKGMVLPEPI |
| Ga0126378_105036153 | 3300010361 | Tropical Forest Soil | MATVPKFRIDVDIHNLLMNTASGPAKLPADKAMLLPNPVFP |
| Ga0126377_114101361 | 3300010362 | Tropical Forest Soil | VATAPKFRIDVDVHNLLMHSAPGPVRVPEGKGAKLPNPVFP |
| Ga0126381_1003245191 | 3300010376 | Tropical Forest Soil | MATAPKFRIDVDIHTLLMDSSREPVKPVAAKGLTLPEAVFPQYPEKLAE |
| Ga0126381_1008647152 | 3300010376 | Tropical Forest Soil | VATAPKFRIDVDIHNLLMHSAPGPVALPAAKNLKLPQPVFPRFPEKLADPGP |
| Ga0126381_1049952162 | 3300010376 | Tropical Forest Soil | VATVPKFRIDVDIHNLLMHSAAGPGALPVPRGMKLPDPVFPRFPKK |
| Ga0134124_130634812 | 3300010397 | Terrestrial Soil | MATAPKFRIDVDIHNLLMDSSRKPVKAAAARGLTLPE |
| Ga0126383_112024691 | 3300010398 | Tropical Forest Soil | MATVPKFRIDVDIHNLLMHSSPAPVKIPEPKGLTLPEPVFPQFPDKL |
| Ga0150983_115830251 | 3300011120 | Forest Soil | MATAPKFRIDVDIHNLLMNTAQTPAKPVLVKGRKL |
| Ga0137390_117252512 | 3300012363 | Vadose Zone Soil | MATAPKFRIDVDIHYLLMDSSRRPVEPVAAKGLTLPEPVFPQYPEKLADPGPE |
| Ga0137410_118270712 | 3300012944 | Vadose Zone Soil | MATAPKFRIDVDIHNLLMDSSRQSVQPAAAKGLTLPEPLFPQYPEKL |
| Ga0126369_105803561 | 3300012971 | Tropical Forest Soil | MATAPKFRIDVDIHNLLMNSNPGPVLVPKPQGATLP |
| Ga0126369_108307672 | 3300012971 | Tropical Forest Soil | MATAPKFRIDVDIHNLLMHTSPEPVKPPRTKGMSLPEPIFPRFPEKLADPG |
| Ga0126369_120541321 | 3300012971 | Tropical Forest Soil | MATAPKFRIDVDIHNLLMRSKPDPVLVPKPKGLTLPEPV |
| Ga0126369_135445942 | 3300012971 | Tropical Forest Soil | MAAAPKFRIDVDIHNLLMHSAQGPVLAPSPQGATLPEPVFPQDPEK |
| Ga0132257_1006754821 | 3300015373 | Arabidopsis Rhizosphere | MATAPKFRIDVDIHNLLMNSNPGPVLVPKPKGASLPEPVFPRFPEKLADPG |
| Ga0182040_109338912 | 3300016387 | Soil | VATAPKFRIDVDIHNLLMHSAPGPVAVPAAKGMKLP |
| Ga0182040_117408342 | 3300016387 | Soil | VATAPKFRIDVDIHNLLMHSAPGPVALPAAKGLKLPDPVFPRYP |
| Ga0187847_100126956 | 3300017948 | Peatland | MATVPKFRIDVDIHNLLTQVPTGPALVPKSKGMTLPQPVFPQYPE |
| Ga0187781_113326351 | 3300017972 | Tropical Peatland | MATVPKFRIDVDIHNLLMNTGSGSAKLPADKGMALPDPVFPQYPELLS |
| Ga0187805_106406631 | 3300018007 | Freshwater Sediment | MATAPKFRIDVDIHNLLMHKAPAPALVPIAKGMKLPEPVFPLFPEKLEDPGPA |
| Ga0187810_104102182 | 3300018012 | Freshwater Sediment | VATAPKFRIDVDIHNLLMNSAPGPVAVPPPKGKKLPDPVFPRFPEKLRDPG |
| Ga0187784_116901172 | 3300018062 | Tropical Peatland | MASAPKFRIDVDFHNLLMNTGSGSAKLPADRGMALPDPVFPQ |
| Ga0187772_105852071 | 3300018085 | Tropical Peatland | MAAAPKFRIDVDIHNLLMSSATAPVALPEPKGLTLPEPVF |
| Ga0187770_117938911 | 3300018090 | Tropical Peatland | METRGLMSTVPKFRIDVDIHNLLIDSHSRGPVPAAAMGLDLPTPPFPLHP |
| Ga0210401_101982963 | 3300020583 | Soil | MATTPKFRIDVDIHSLLMDSSRQPVKPPAAKGLTLPEPV |
| Ga0210401_105176892 | 3300020583 | Soil | MASVPKFRIDVDIHNLLMNSAPGPVVVPPPKGMKLPEPVF |
| Ga0210401_108507682 | 3300020583 | Soil | MATAPKFRIDVDIHNLLMHSAPEPAKPAAIKGLTLPEPVFPQYPKKL |
| Ga0210401_116090362 | 3300020583 | Soil | MASAPKFRIDVDIHNLLMNSAPGPVVVPPPMGMKLPEPVFPRFPE |
| Ga0210404_103325872 | 3300021088 | Soil | MASVPKFRIDVDIHNLLMNSAPGPIMVPPPKGMKLPEPVFPRFPEKLSDPGPAVIP |
| Ga0210400_1000052432 | 3300021170 | Soil | MATAPKFRIDVDIHNLLMNTAQTPAKPVLVKGRKLP |
| Ga0210396_110123242 | 3300021180 | Soil | MATAPKFRIDVDIHNLLMDSSRQPVKPAAAKGLTLPEPVFPQYPEK |
| Ga0210396_111224051 | 3300021180 | Soil | MATAPKFRIDVDIHNLLMHSAPEPAKPAAIKGLTLPEPVLP |
| Ga0213876_100439211 | 3300021384 | Plant Roots | VATAPKFRIDVDIHNLLMKSAPGPVVVPPPKGWTLPEAEYPLHPERVNDPGP |
| Ga0210389_110338581 | 3300021404 | Soil | MATAPKFRIDVDIHDLLMDSSREPVRPVTVKGLTLPEPVFPQY |
| Ga0210387_102936031 | 3300021405 | Soil | VATAPKFRIDVDIHNLLTRSAAGPVVIPAPKGMTLPDPVFPRFPEKL |
| Ga0210386_112231491 | 3300021406 | Soil | MATAPKFRIDVDIHNLLMHSAPGPVAVPAAKGMKL |
| Ga0210394_107300682 | 3300021420 | Soil | VATAPKFRIDVDIHNLLMHSAPVAVPAAKGMKLPDPVFPLF |
| Ga0210394_110030012 | 3300021420 | Soil | MATAPKFRIDVDIHDLLMDSSRQPVRPAAVKGLTLPEPVFPQYPDKLVDPGP |
| Ga0210394_112800791 | 3300021420 | Soil | MAPRFRTDVDSHNLLMHFAPGPVAVPAVKATKLPDPAFPRFPE |
| Ga0210392_107411392 | 3300021475 | Soil | MASVPKFRIDVDIHNLLMNSAPGPVAVPPPKGMKL |
| Ga0242656_11366212 | 3300022525 | Soil | VATVPKFRIDVDIHNLLMNSAPGPVPVPLPKGMTLPEPVFPRFPEKLKDP |
| Ga0222756_10048841 | 3300022709 | Soil | MASAPKFRIDVDIHNLLMNSAPGPVAVPPPRGMKLPEPVFPRFPEKLSDP |
| Ga0242673_11323451 | 3300022716 | Soil | MASAPKFRIDVDIHNLLMNSAPGPVAVPPPKGMKL |
| Ga0242661_10000384 | 3300022717 | Soil | MATAPKFRIDVDIHNLLMNTAQTPAKPVLVKGRKLPEPVFPRFPEKLLD |
| Ga0242665_101475891 | 3300022724 | Soil | MATAPKFRIDVDIHNLLMNTAQAPAKPALVKGKRLPDPVFPRFPEKLLDP |
| Ga0207663_108650842 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MATVPKFRIDVDIHNLLMDSSRQPVKPADAKGLTLPEPVFP |
| Ga0207700_105024432 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MATAPKFRIDVDIHNLLMNSAPGPVLVPKPKGLALPEPV |
| Ga0207664_111617722 | 3300025929 | Agricultural Soil | MATAPKFRIDVDIHNLLMDSSKRPVRPAAVNGMTPPEPVF |
| Ga0207665_108585821 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MATAPKFRIDVDVHNLLMQSPEPVRIPAPKGLTLPE |
| Ga0207665_109054822 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MATAPKFRIDVDIHNLLMNSAPAPVPMPPSKGLILPEP |
| Ga0209055_10026985 | 3300026309 | Soil | MATAPKFRIDVDIHNPLVNTAQTPAKPGLVMGRKLPDPVG |
| Ga0209158_10554361 | 3300026333 | Soil | MATAPKFRIDVDIHDLLMDSSREPARPAAVKGLTLPEPVFPQYP |
| Ga0209377_12932162 | 3300026334 | Soil | MATAPKFRIDVDIHDLLMDSSREPARPAAVKGLTL |
| Ga0257161_10514001 | 3300026508 | Soil | VATAPKFRIDVDIHNLLMHSARGPIEVPTARGMKLPDPVFPQFPEKLSD |
| Ga0209577_107728242 | 3300026552 | Soil | MATAPKFRIDVDIHNLLMNTAQIPAKPVLVMGRKLPDPVGKH |
| Ga0209325_10079572 | 3300027050 | Forest Soil | MASAPKFRIDVDIHNLLMNSAPGPIAVPAPKGMKLPEPVFPRFPEK |
| Ga0209139_100639972 | 3300027795 | Bog Forest Soil | MATVPKFRIDVDIHSLLMQPSQGPPNIPAPKGLTLPEPVFPR |
| Ga0209040_102181861 | 3300027824 | Bog Forest Soil | VATAPKFRIDVDIHNLLMNSAPGPVRVPAPKGLTLPEP |
| Ga0209579_104007462 | 3300027869 | Surface Soil | MASAPKFRIDVDIHNLLMNSAPGPVAVPLPRGMKLPEPVFPRFPEK |
| Ga0209380_100025908 | 3300027889 | Soil | MASAPKFRIDVDIHNLLMNSAPGPVAVPPPRGMKLPEPVFPRFPEKLSD |
| Ga0308309_114103952 | 3300028906 | Soil | VATAPKFRIDVDIHNLLMNSAPGPVVAPPPKGWKLPDAVYPQHPERVN |
| Ga0222749_104705532 | 3300029636 | Soil | MATTPKFRIDVDIHSLLMDSSRQPVKPAAAKGLTLPE |
| Ga0265753_10493192 | 3300030862 | Soil | MATAPKFRIDVDIHNLLMDSWRKPVKPAVAKGLTLPEPTI |
| Ga0318573_106207391 | 3300031564 | Soil | VATAPKFRIDVDIHNLLMHSAAGVPAPAPKGMQLPDPVF |
| Ga0318574_101682131 | 3300031680 | Soil | VATAPKFRIDVDIHNLLMHSAAGVPAPAPKGMKLPDPVFPRFPRKLADPG |
| Ga0307474_104019701 | 3300031718 | Hardwood Forest Soil | VATAPKFRIDVDIHNLLMKSAPGPVAVPSPLGWKLPEAVYPQHPERVNDPGPEVP |
| Ga0307477_101170971 | 3300031753 | Hardwood Forest Soil | MATAPKFRIDIDIHNLLMRSGPVEVPKPKGMALPEPVFPR |
| Ga0307475_100962392 | 3300031754 | Hardwood Forest Soil | MATAPKFRIDVDIHNLLMDSSRQPVKPAAAKGLTLPEPVFPQY |
| Ga0318529_104606282 | 3300031792 | Soil | MATAPKFRIDVDIHNLLMNTAQAPAKPALVKGKRLPN |
| Ga0310917_110353062 | 3300031833 | Soil | VATAPKFRIDVDIHNLLMHSAAGVPAPAPKGMQLPDPVFPRFPRKLAD |
| Ga0306923_102966843 | 3300031910 | Soil | MATAPKFRIDVDIHNLLMHTSPEPVKPPLTKGMSLPEPIFPRFPEKLADPGPDQV |
| Ga0310916_100613962 | 3300031942 | Soil | MASVPKFRIDVDIHNLLMNSAPGPVVVPPPKGMKLPEPVFPRFPEKLSDP |
| Ga0306926_104515332 | 3300031954 | Soil | VATAPKFRIDVDIHNLLMRSAPGPVPLPAAKGMRLPDPVFPRFPEKLSDPGPTT |
| Ga0307479_117544402 | 3300031962 | Hardwood Forest Soil | MATAPKFRIDVDIHNLLMDSSRQPVKPAAAQGLTLPEPVFPQFP |
| Ga0307479_118787332 | 3300031962 | Hardwood Forest Soil | MASAPKFRIDVDIHNLLMNSAPGPMAVPAPKGMKLPEPVFPRFPEKLSDPGP |
| Ga0318531_105626382 | 3300031981 | Soil | VATAPKFRIDVDIHNLLMHSAPGPVRVPEGKGAKLPNPVFPRFPQK |
| Ga0318575_104555721 | 3300032055 | Soil | VATAPKFRIDVDIHNLLMHSAPGPVAVPRPMGKKLPEPVFPRFPEKLLDPG |
| Ga0306924_110978712 | 3300032076 | Soil | MATAPKFRIDVDIHNLLMNSNPGPVLVPTPKGEILPEPVFPQFPEKLADPGPEK |
| Ga0307471_1000868311 | 3300032180 | Hardwood Forest Soil | MATTPKFRIDVDIHSLLMDSSRQPVKPAAVKGLTLPEPVFPQYPEKLADPGPEL |
| Ga0307471_1004926441 | 3300032180 | Hardwood Forest Soil | VATAPKFRIDVDIHNLLMHSAPAPVAVPAAKGMKHPDPVF |
| Ga0307471_1027312292 | 3300032180 | Hardwood Forest Soil | MATAPKFRIDVDIHNLLMDSSRQPVKPAAAQGLTLPEP |
| Ga0306920_1003823722 | 3300032261 | Soil | VATAPKFRIDVDIHNLLMHSAPGPVAVPRPMGKKLPEP |
| Ga0335079_100200613 | 3300032783 | Soil | MATAPRFRIDVDIHNLLMNSNPGLVLVPKPKGSTKGFNSS |
| Ga0335080_108185101 | 3300032828 | Soil | MTTTPKFRIDVDIHNLLTHAAQAPVKPALVMGKTLPDPVFPRFCEKLLDP |
| Ga0335070_107151621 | 3300032829 | Soil | MAAAAPKFRIDVDIHNLLMNSAPGPVLVPEPKGFTLPDPVFPQYP |
| Ga0335069_103170171 | 3300032893 | Soil | MAAAAPKFRIDVDIHNLLMNSAPGPVLVPEPKGFTLPDPV |
| Ga0335069_104686102 | 3300032893 | Soil | MAAAAPKFRIDVDIHNLLMNSAPGPVLVPEPKGFTLP |
| ⦗Top⦘ |