NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F072513

Metagenome / Metatranscriptome Family F072513

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F072513
Family Type Metagenome / Metatranscriptome
Number of Sequences 121
Average Sequence Length 54 residues
Representative Sequence VIPNRRWGLDAVGVVVNHIMTAGIAAHAIIVNIISHTAVIFSAIGYGFSCRYINFQIPSL
Number of Associated Samples 112
Number of Associated Scaffolds 121

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Archaea
% of genes with valid RBS motifs 57.85 %
% of genes near scaffold ends (potentially truncated) 39.67 %
% of genes from short scaffolds (< 2000 bps) 65.29 %
Associated GOLD sequencing projects 105
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Archaea (98.347 % of family members)
NCBI Taxonomy ID 2157
Taxonomy All Organisms → cellular organisms → Archaea

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(13.223 % of family members)
Environment Ontology (ENVO) Unclassified
(30.579 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(47.107 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 66.67%    β-sheet: 0.00%    Coil/Unstructured: 33.33%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 121 Family Scaffolds
PF08442ATP-grasp_2 42.15
PF13589HATPase_c_3 33.88
PF02629CoA_binding 8.26
PF00227Proteasome 3.31
PF03745DUF309 1.65
PF01472PUA 0.83
PF02934GatB_N 0.83
PF01467CTP_transf_like 0.83
PF00150Cellulase 0.83

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 121 Family Scaffolds
COG0458Carbamoylphosphate synthase large subunitAmino acid transport and metabolism [E] 84.30
COG0026Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase)Nucleotide transport and metabolism [F] 42.15
COG0045Succinyl-CoA synthetase, beta subunitEnergy production and conversion [C] 42.15
COG0151Phosphoribosylamine-glycine ligaseNucleotide transport and metabolism [F] 42.15
COG1042Acyl-CoA synthetase (NDP forming)Energy production and conversion [C] 42.15
COG063820S proteasome, alpha and beta subunitsPosttranslational modification, protein turnover, chaperones [O] 3.31
COG3484Predicted proteasome-type proteasePosttranslational modification, protein turnover, chaperones [O] 3.31
COG5405ATP-dependent protease HslVU (ClpYQ), peptidase subunitPosttranslational modification, protein turnover, chaperones [O] 3.31
COG1547Predicted metal-dependent hydrolaseFunction unknown [S] 1.65
COG0064Asp-tRNAAsn/Glu-tRNAGln amidotransferase B subunitTranslation, ribosomal structure and biogenesis [J] 0.83
COG2511Archaeal Glu-tRNAGln amidotransferase subunit E, contains GAD domainTranslation, ribosomal structure and biogenesis [J] 0.83
COG2730Aryl-phospho-beta-D-glucosidase BglC, GH1 familyCarbohydrate transport and metabolism [G] 0.83
COG3934Endo-1,4-beta-mannosidaseCarbohydrate transport and metabolism [G] 0.83


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.35 %
UnclassifiedrootN/A1.65 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2162886007|SwRhRL2b_contig_3212659All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis4871Open in IMG/M
2209111006|2214600493All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis5437Open in IMG/M
3300001431|F14TB_100548714All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon560Open in IMG/M
3300002099|JGI24808J26613_1006530All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera2770Open in IMG/M
3300003398|JGI26130J50248_100080All Organisms → cellular organisms → Archaea4781Open in IMG/M
3300004463|Ga0063356_103734626All Organisms → cellular organisms → Archaea656Open in IMG/M
3300004480|Ga0062592_102133491All Organisms → cellular organisms → Archaea557Open in IMG/M
3300005441|Ga0070700_100460738All Organisms → cellular organisms → Archaea969Open in IMG/M
3300005471|Ga0070698_100607711All Organisms → cellular organisms → Archaea1034Open in IMG/M
3300005507|Ga0074259_11988747All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon682Open in IMG/M
3300005543|Ga0070672_100044527All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis3428Open in IMG/M
3300005558|Ga0066698_10026720All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis3453Open in IMG/M
3300005558|Ga0066698_10293753All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera1125Open in IMG/M
3300005577|Ga0068857_100462396All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera1187Open in IMG/M
3300005616|Ga0068852_102589410Not Available527Open in IMG/M
3300005618|Ga0068864_100005005All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis10857Open in IMG/M
3300005841|Ga0068863_101186001All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon769Open in IMG/M
3300005844|Ga0068862_100755280All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera946Open in IMG/M
3300005937|Ga0081455_10006260All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis12806Open in IMG/M
3300005937|Ga0081455_10837516All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon575Open in IMG/M
3300006049|Ga0075417_10276010All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon810Open in IMG/M
3300006194|Ga0075427_10007281All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon1624Open in IMG/M
3300006572|Ga0074051_10919778All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon538Open in IMG/M
3300006845|Ga0075421_100655162All Organisms → cellular organisms → Archaea1226Open in IMG/M
3300006853|Ga0075420_101547386All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon568Open in IMG/M
3300006880|Ga0075429_101922922All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon512Open in IMG/M
3300006881|Ga0068865_102212980All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon501Open in IMG/M
3300006969|Ga0075419_10005799All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis7776Open in IMG/M
3300009094|Ga0111539_10730226All Organisms → cellular organisms → Archaea1153Open in IMG/M
3300009156|Ga0111538_12326770All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon673Open in IMG/M
3300009553|Ga0105249_11580588All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera728Open in IMG/M
3300009809|Ga0105089_1007508All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera1292Open in IMG/M
3300009814|Ga0105082_1018408All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera1043Open in IMG/M
3300009819|Ga0105087_1005284All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera1610Open in IMG/M
3300009820|Ga0105085_1018541All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon1202Open in IMG/M
3300010029|Ga0105074_1001709All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera2948Open in IMG/M
3300011119|Ga0105246_10111417All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon2011Open in IMG/M
3300012204|Ga0137374_10007899All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis12626Open in IMG/M
3300012481|Ga0157320_1031163All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon539Open in IMG/M
3300012494|Ga0157341_1000081All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis3959Open in IMG/M
3300012884|Ga0157300_1007222All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera1251Open in IMG/M
3300012891|Ga0157305_10008552All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera1563Open in IMG/M
3300012891|Ga0157305_10230661All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon547Open in IMG/M
3300012896|Ga0157303_10029339All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon999Open in IMG/M
3300013100|Ga0157373_10148126All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis1651Open in IMG/M
3300013306|Ga0163162_10295970All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis1750Open in IMG/M
3300013308|Ga0157375_10934480All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis1010Open in IMG/M
3300014255|Ga0075320_1000139All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis7297Open in IMG/M
3300014271|Ga0075326_1014237All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis1906Open in IMG/M
3300014325|Ga0163163_11393089All Organisms → cellular organisms → Archaea763Open in IMG/M
3300015201|Ga0173478_10507233All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon606Open in IMG/M
3300015358|Ga0134089_10432981All Organisms → cellular organisms → Archaea566Open in IMG/M
3300015371|Ga0132258_10163467All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis5355Open in IMG/M
3300015372|Ga0132256_100609654All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon1206Open in IMG/M
3300015373|Ga0132257_100038222All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis5270Open in IMG/M
3300017656|Ga0134112_10118042All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis1006Open in IMG/M
3300017997|Ga0184610_1007828All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis2603Open in IMG/M
3300018027|Ga0184605_10165429All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis999Open in IMG/M
3300018028|Ga0184608_10027989All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis2103Open in IMG/M
3300018028|Ga0184608_10041643All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis1776Open in IMG/M
3300018031|Ga0184634_10212697All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon882Open in IMG/M
3300018051|Ga0184620_10000818All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis5853Open in IMG/M
3300018054|Ga0184621_10189955All Organisms → cellular organisms → Archaea737Open in IMG/M
3300018071|Ga0184618_10077817All Organisms → cellular organisms → Archaea1262Open in IMG/M
3300018073|Ga0184624_10246199All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon801Open in IMG/M
3300018076|Ga0184609_10015098All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis2966Open in IMG/M
3300018076|Ga0184609_10584439All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon502Open in IMG/M
3300018465|Ga0190269_11064709All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon619Open in IMG/M
3300019361|Ga0173482_10481996All Organisms → cellular organisms → Archaea597Open in IMG/M
3300019362|Ga0173479_10000687All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis6763Open in IMG/M
3300019884|Ga0193741_1007825All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae2828Open in IMG/M
3300020018|Ga0193721_1002293All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis5030Open in IMG/M
3300022737|Ga0247747_1000276All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis5677Open in IMG/M
3300022737|Ga0247747_1012205All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon883Open in IMG/M
3300022883|Ga0247786_1001779All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis4003Open in IMG/M
3300023274|Ga0247763_1157309All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon638Open in IMG/M
3300025164|Ga0209521_10368106All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon794Open in IMG/M
3300025290|Ga0207673_1001550All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera2529Open in IMG/M
3300025324|Ga0209640_10945962All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon667Open in IMG/M
3300025559|Ga0210087_1013152All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera1726Open in IMG/M
3300025893|Ga0207682_10022607All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis2479Open in IMG/M
3300025904|Ga0207647_10043339All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis2817Open in IMG/M
3300025907|Ga0207645_10032258All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae3367Open in IMG/M
3300025908|Ga0207643_10002263All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis10489Open in IMG/M
3300025911|Ga0207654_10473534All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon881Open in IMG/M
3300025912|Ga0207707_10512721All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis1022Open in IMG/M
3300025917|Ga0207660_10025433All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis4018Open in IMG/M
3300025917|Ga0207660_10266048All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon1357Open in IMG/M
3300025920|Ga0207649_11465845All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon540Open in IMG/M
3300025934|Ga0207686_10190079All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis1463Open in IMG/M
3300025938|Ga0207704_10706255All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon835Open in IMG/M
3300025940|Ga0207691_10703018All Organisms → cellular organisms → Archaea852Open in IMG/M
3300025960|Ga0207651_10093523All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis2208Open in IMG/M
3300025981|Ga0207640_10555535All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis965Open in IMG/M
3300026041|Ga0207639_10514742All Organisms → cellular organisms → Archaea1095Open in IMG/M
3300026142|Ga0207698_12468568All Organisms → cellular organisms → Archaea530Open in IMG/M
3300026759|Ga0207527_103342All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon579Open in IMG/M
3300026936|Ga0207585_101296All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon647Open in IMG/M
3300026938|Ga0207610_100205All Organisms → cellular organisms → Archaea972Open in IMG/M
3300027018|Ga0208475_1000360All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis3488Open in IMG/M
3300027163|Ga0209878_1000555All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis5212Open in IMG/M
3300027324|Ga0209845_1004318All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis2449Open in IMG/M
3300027379|Ga0209842_1031101All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon1005Open in IMG/M
3300027433|Ga0207618_100176All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon1011Open in IMG/M
3300027637|Ga0209818_1002794All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis3387Open in IMG/M
3300027722|Ga0209819_10012495All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae2758Open in IMG/M
3300027876|Ga0209974_10364397Not Available562Open in IMG/M
3300028380|Ga0268265_10085101All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis2508Open in IMG/M
3300028381|Ga0268264_10050408All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae3466Open in IMG/M
3300028771|Ga0307320_10366290All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon576Open in IMG/M
3300028799|Ga0307284_10335040All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon611Open in IMG/M
3300028807|Ga0307305_10021226All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae2924Open in IMG/M
3300028807|Ga0307305_10475264All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon561Open in IMG/M
3300028819|Ga0307296_10000803All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis15414Open in IMG/M
3300028819|Ga0307296_10200685All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon1082Open in IMG/M
3300031547|Ga0310887_11007645All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon531Open in IMG/M
3300031847|Ga0310907_10080022All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon1358Open in IMG/M
3300032000|Ga0310903_10009265All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis2977Open in IMG/M
3300032003|Ga0310897_10058573All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis1415Open in IMG/M
3300032017|Ga0310899_10071956All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon1328Open in IMG/M
3300032180|Ga0307471_100581913All Organisms → cellular organisms → Archaea1277Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil13.22%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment9.09%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand6.61%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere6.61%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere4.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil4.13%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil4.13%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere4.13%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere3.31%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere3.31%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.48%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.48%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere2.48%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.48%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.65%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.65%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.65%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.65%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere1.65%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere1.65%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.65%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.83%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.83%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.83%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.83%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.83%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.83%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere0.83%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.83%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.83%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.83%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.83%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.83%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.83%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2162886007Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
2209111006Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0Host-AssociatedOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300002099Soil microbial communities from Manhattan, Kansas, USA - Sample 400um MDAEnvironmentalOpen in IMG/M
3300003398Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AMHost-AssociatedOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005507Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5Host-AssociatedOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006194Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1Host-AssociatedOpen in IMG/M
3300006572Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009809Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_30_40EnvironmentalOpen in IMG/M
3300009814Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60EnvironmentalOpen in IMG/M
3300009819Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_40_50EnvironmentalOpen in IMG/M
3300009820Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60EnvironmentalOpen in IMG/M
3300010029Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_10_20EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012481Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610Host-AssociatedOpen in IMG/M
3300012494Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610Host-AssociatedOpen in IMG/M
3300012884Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2EnvironmentalOpen in IMG/M
3300012891Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2EnvironmentalOpen in IMG/M
3300012896Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2EnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014255Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleC_D2EnvironmentalOpen in IMG/M
3300014271Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D2EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015358Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017656Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015EnvironmentalOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018051Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1EnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300019884Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2EnvironmentalOpen in IMG/M
3300020018Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2EnvironmentalOpen in IMG/M
3300022737Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S094-311B-5EnvironmentalOpen in IMG/M
3300022883Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S066-202C-4EnvironmentalOpen in IMG/M
3300023274Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L141-409B-4EnvironmentalOpen in IMG/M
3300025164Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 4EnvironmentalOpen in IMG/M
3300025290Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5Host-AssociatedOpen in IMG/M
3300025324Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025559Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025893Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026759Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10A3w-12 (SPAdes)EnvironmentalOpen in IMG/M
3300026936Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10A2-12 (SPAdes)EnvironmentalOpen in IMG/M
3300026938Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10A4-12 (SPAdes)EnvironmentalOpen in IMG/M
3300027018Grasslands soil microbial communities from Kansas, USA, that are Nitrogen fertilized - NN575 (SPAdes)EnvironmentalOpen in IMG/M
3300027163Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_40_50 (SPAdes)EnvironmentalOpen in IMG/M
3300027324Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 (SPAdes)EnvironmentalOpen in IMG/M
3300027379Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 (SPAdes)EnvironmentalOpen in IMG/M
3300027433Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10A3w-11 (SPAdes)EnvironmentalOpen in IMG/M
3300027637Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027722Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027876Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028771Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369EnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300032000Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3EnvironmentalOpen in IMG/M
3300032003Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1EnvironmentalOpen in IMG/M
3300032017Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
SwRhRL2b_0332.000041502162886007Switchgrass RhizosphereVIPNRRWGLDAVGVVVNHIMTAGIAAHAIIVNIISHTAVIFSAIGYGFSCRYINFQIPSL
22136379002209111006Arabidopsis RhizosphereMIAGMAAHAIIVRIISQTAVIFSAIGYGFMSRYINFQTDSLA
F14TB_10054871413300001431SoilVIPNRRWGLDAVGVVVSHIMTAGIAAHAIIVNIISHTAVIFSAIEYGFRSRYINFQNDS
JGI24808J26613_100653013300002099SoilVGVVVNHIMTAGIVAXAIIVKMISXTAVIFSAIEYGFRSRYINFQNDSFA*
JGI26130J50248_10008013300003398Arabidopsis Thaliana RhizosphereFKRLIPEGRNSVIPNRRWGLDAVGVVVNHIMTAGIAAHAIIVNIMSHTAVIFSAIGYGFSCRYINFQIPPLK*
Ga0063356_10373462613300004463Arabidopsis Thaliana RhizosphereVVVNHIMTAGIAAHAIIVNNISHTAVIFSAIGYGFNCRYINFQIPSLK*
Ga0062592_10213349113300004480SoilNHIMTAGIAAHAIIVNIISHTAVIFSAIRYGISCRYINFQIPSLK*
Ga0070700_10046073813300005441Corn, Switchgrass And Miscanthus RhizosphereGLDAVGVVVNHIMTAGIAAHAIIVNIMSHTAVIFSAIGYGFNCRYINFQIPPLK*
Ga0070698_10060771113300005471Corn, Switchgrass And Miscanthus RhizosphereVVVNHIMTAGIAAHAIIVNIMSHTAVIFSAIGYGFSCRYINFQIPPLK*
Ga0074259_1198874723300005507Arabidopsis RhizosphereVGVVVNHIMIAGMAAHAIIVRIISQTAVIFSAIGYGFMSRYINFQTDSLA*
Ga0070672_10004452733300005543Miscanthus RhizosphereVIPNRRWGLDAVGVVVNHIMTAGIAAHAIIVNIMSHTAVIFSAIGYGFSCRYINFQIPPLK*
Ga0066698_1002672023300005558SoilVGVVVNHIMIAGTAAHAIMVKMISHTAVIFSAIKYEFRSRYINFQD*
Ga0066698_1029375323300005558SoilLGAVGVVVNHIMTAGIVAHAIIVKMISQTAVIVSAIEYGFRSRYINFQNDSFA*
Ga0068857_10046239623300005577Corn RhizosphereVIPNRRWGLDAVGVVVNHIMTAGIAAHAIIVNIMSHTAVIFSAIGYEFSCRYINFQIPPLK*
Ga0068852_10258941023300005616Corn RhizosphereVIPNRRWGLDAVGVVVNHIMTAGIAAHAIIVNIISHTAVIFSAIGYGFSCRYINFQIPSLK*
Ga0068864_10000500563300005618Switchgrass RhizosphereVIPNRRWGLDAVGVVVNHIMTAGIAAHAIIVNIMSHTAVIFSAIGYGFNCRYINFQIPPLK*
Ga0068863_10118600113300005841Switchgrass RhizosphereVIPNRRWGLDAVGVVVNHIMTAGIAAHAIIVNIISHTAVIFSAIRYGISCRYINFQIPSLK*
Ga0068862_10075528023300005844Switchgrass RhizosphereVIPNRRWGLDAVGVVVSHIMTAGIAAHAIIVNIISHTAVIFSAIEYGFSCRYINFQIPSLK*
Ga0081455_10006260103300005937Tabebuia Heterophylla RhizosphereVGVVVNHIMTAGIVAHAIIVKMISQTAVIFSAIEYGFRSRYINFLNDSFA*
Ga0081455_1083751623300005937Tabebuia Heterophylla RhizosphereVNHIMIAGIVAHAIIVKMISQTAVIFSAIEYGFKSRYINFQNDSFA*
Ga0075417_1027601023300006049Populus RhizosphereAGVVVNHIMTAGIVAHAIIVNMISQTAVIFSAIQYGIRSRYINFQNDSFA*
Ga0075427_1000728113300006194Populus RhizosphereVGVVVNHIMTAGIVAHAIIVKMISHTAVIFSAIEYGFRSRYINFQNDSFA*
Ga0074051_1091977813300006572SoilLGAVGVVVNHIMTAGIVAHAIIVKMISQTAVIVSAIEYGFKSRYINFQNDSFA*
Ga0075421_10065516223300006845Populus RhizosphereQIMTAGTAAQATIVNIMSHTAVIFSAIAYGFKRRYINFQTGILV*
Ga0075420_10154738613300006853Populus RhizosphereMTAGTAAHATIVNIMSHTAVIFSAIAYGFKRRYINFQTGLLV*
Ga0075429_10192292223300006880Populus RhizosphereMTAGTAAQATIVNIMSHTAVIFSAIAYGFKRRYINFQTG
Ga0068865_10221298013300006881Miscanthus RhizosphereVGSVVNHIIIAGMAAHAIIVRIISQTAVIFSAIGYGFMSRYINFQTD
Ga0075419_1000579963300006969Populus RhizosphereVIPNRRWGLDAVGVVVSHIMTAGIAAHAIIVNIMSHTAVIFSAIGYGFSCRYINFQIPPLK*
Ga0111539_1073022623300009094Populus RhizosphereIPNRRWGLDAVGVVVSHIMTAGIAAHAIIVNIISHTAVIFSAIGYGFSCRYINFQIPSLK
Ga0111538_1232677013300009156Populus RhizosphereLGAVGVVVNHIITAGIVAHAIIVKMISQTAVIVSAIEYGFKSRYINFQNDSFA*
Ga0105249_1158058823300009553Switchgrass RhizosphereVIPNRRWGLDAVGAVVNHIMTAGIAAHAIIVNIISHTAVIFSAIRYGISCRYINFQIPSLK*
Ga0105089_100750823300009809Groundwater SandMIPSIKCGFDEVGVVVNHIMTAGTAAQATMVKMISHTAVIFSAIKYGFRSRYINFQIGFFA*
Ga0105082_101840823300009814Groundwater SandMIPSIKCGFDEVGVVVNHIMTAGTAAQATMVKMISHTAVIFSAIKYEFRSRYINFQIGFFA*
Ga0105087_100528423300009819Groundwater SandMIPSIKCGFDEVGVVVNHIMTAGTAAQATMVKMISHTAVVFSAIKYEFRSRYINFQIGFFA*
Ga0105085_101854123300009820Groundwater SandVIPSIKCGFDEVGVVVNHIMTAGTAAQATMVKMISHTAVVFSAIKYGFRSRYINFQIGFFA*
Ga0105074_100170923300010029Groundwater SandMIPSIKCGFDEVGVVVNHIMTAVTAAQETMVKIISHTAVVFSAIKYGFRSRYINFQIGFFA*
Ga0105246_1011141723300011119Miscanthus RhizosphereVIPNRRWGLDAVGVVVNHIMTAGIAAHAIIVNIISHTAVIFSAIRYGISCR
Ga0137374_10007899123300012204Vadose Zone SoilLGAVGVVVNHIMTAGIVAHAIIVKMISQTAVIVSAIEYGFNSRYINFQNDSFA*
Ga0157320_103116313300012481Arabidopsis RhizosphereVGVVVNHIMIAGIAAHAIIVRIISQTAVIFSAIGYGFMSRYINFQTD
Ga0157341_100008123300012494Arabidopsis RhizosphereVGVVVNHIMIAGMAAHAIIVRIISQTAVIFSAIRYGFMSRYINFQTDSLA*
Ga0157300_100722223300012884SoilVIPNRRWGLDAVGVVVSHIMTAGIAAHAIIVNIMSHTAVIFSAIGYEFSCRYINFQIPPLK*
Ga0157305_1000855233300012891SoilVIPNRRWGLDAVGVVVNHIMTAGIAAHAIIVNIMSHTAVIFSAIGYGLGGRYINFQIPPLK*
Ga0157305_1023066113300012891SoilVIPNRRWGLDAVGVVVNHIMTAGIAAHAIIVNIISHTAVIFSAIEYGFSCRYINFQIPSLK*
Ga0157303_1002933923300012896SoilVIPNRRWGLDAVGVVVNHIMTAGIAAHAIIVNIMSHTAVIFSAIGYGFSCRYINFQIPSLK*
Ga0157373_1014812623300013100Corn RhizosphereVIPNRRWGLEAVGVVVNHIMTAGIAAHAIIVNIISHTAVIFSAIRYGISCRYINFQIPSLK*
Ga0163162_1029597023300013306Switchgrass RhizosphereVIPNRRWGLDAVGVVVSHIMTAGIAAHAIIVNIMSHTAVIFSAIGYGFSCRYINFQIPQLK*
Ga0157375_1093448023300013308Miscanthus RhizosphereVIPNRRWGLEAVGVVVNHIMTAGIAAHAIIVNIMSHTAVIFSAIGYGFSCRYINFQIPPLK*
Ga0075320_100013973300014255Natural And Restored WetlandsVIPNRRCGLDAVGVVVNHIMTVGIAAHAIIVNIISHTAVLFSTIGYGFSCRYINFQIPSVK*
Ga0075326_101423733300014271Natural And Restored WetlandsVVVNQIITAGTAAHAIIVNKISHTAVIFSAIAYGFNRRYINFQIW*
Ga0163163_1139308923300014325Switchgrass RhizosphereVIPNRRWGLEAVGVVVNHIMTAGIAAHAIIVNIMSHTAVIFSAIGYGFNCRYINFQIPPLK*
Ga0173478_1050723323300015201SoilGVVVNHIMTAGIAAHAIIVNIMSHTAVIFSAIGYGLGGRYINFQIPPLK*
Ga0134089_1043298123300015358Grasslands SoilMIAGTAAHAIMVKMISHTAVIFSAIKYEFRSRYINFQD*
Ga0132258_1016346733300015371Arabidopsis RhizosphereVIPNRRWGLDAVGVVVNHIMTAGIAAHAIIVNIMSHTAVIFSAIGYGFSCRYINFQIPQLK*
Ga0132256_10060965413300015372Arabidopsis RhizosphereLDAAGVVVNHIMTAGIVAHAIIVNMISQTAVIFSAIEYGIRSRYINFQNVFIRLNRII
Ga0132257_10003822213300015373Arabidopsis RhizosphereIIIAGMAAHAIIVRIISQTAVIFSAIGYGFMSRYINFQTDLLAK*
Ga0134112_1011804223300017656Grasslands SoilLDAVGVVVSHIMTAGIVAHAIIVKMISQTAVIFSAIEYGFKRRYINFKNDSFA
Ga0184610_100782823300017997Groundwater SedimentVGVVVNHIMTAGIVAHAIIVKMISQTAVVVSAIEYGFRSRYINFQNDSFA
Ga0184605_1016542923300018027Groundwater SedimentLGAVGVVVNHIMTAGIVAHAIIVKMISQTAVIVSAIEYGFRSRYINFQNDSFA
Ga0184608_1002798923300018028Groundwater SedimentVIPNRRWGLDAVGVVVNHIMTAGIAAHAIIVNIISHTAVIFSAIGYGFSCRYINFQIP
Ga0184608_1004164323300018028Groundwater SedimentVGVVVNHIMTAGIVAHAIIVKMISQTAVIVSAIEYGFRSRYINFQNDSFA
Ga0184634_1021269733300018031Groundwater SedimentVIPNRRWGLDAVGVVVNHIMTAGIAAHAIIVNIISHTAVIFSAIRYGFSCRYINFQIP
Ga0184620_1000081853300018051Groundwater SedimentLGAVGVVVNHIMTAGIVAHAIIVKMISQTAVVVSAIEYGFRSRYINFQNDSFA
Ga0184621_1018995523300018054Groundwater SedimentVIPNRRWGLDAVGVVVNHIMTAGIAAHATIVNIISHTAVIFSAIEYGFS
Ga0184618_1007781723300018071Groundwater SedimentLGAVGVVVNHIMTAGIVAHAIIVKMISQTAVIFSAIEYGFKSRYINFQNDSFA
Ga0184624_1024619913300018073Groundwater SedimentLDAAGVVVSHIMTAGIVAHAIIVKMISQTAVIVSAIEYGFRSRYINFQNDSFA
Ga0184609_1001509833300018076Groundwater SedimentVIPNRRWGLDAVGVVVNHIMTAGIAAHAIIVNIISHTAVIFSAIRYGFSCRYINFQIPSL
Ga0184609_1058443913300018076Groundwater SedimentVIPNRRWGLDAVGVVVNHIMTAGIAAHATIVNIISHTAVIFSAIGYGFSCRYINFQIPSL
Ga0190269_1106470913300018465SoilLGAVGVVVNHIMTAGIVAHAIIVKMISQTAVIFSAIEYGFRSRYINFQNDSFA
Ga0173482_1048199613300019361SoilPNRRWGLDAVGVVVNHIMTAGIAAHAIIVNIMSHTAVIFSAIGYGFNCRYINFQIPPLK
Ga0173479_1000068753300019362SoilVIPNRRWGLDAVGVVVNHIMTAGIAAHAIIVNIMSHTAVIFSAIGYEFSCRYINFQIPPL
Ga0193741_100782533300019884SoilMMSRLLYMLSKLFPDGRNSPMPSSRSGFGALGVVVNQIMTAGTAAHATIVNIMSHTAVIFSAIAYGFKRRYINFQTGLLV
Ga0193721_100229363300020018SoilVIPNRRWGLDAVGVVVNHIMTAGIAAHAIIVNNISHTAVIFSAIGYGFSCRYINFQIP
Ga0247747_100027673300022737SoilRWGLDAVGVVVNHIMTAGIAAHAIIVNIMSHTAVIFSAIGYGFSCRYINFQIPPLK
Ga0247747_101220523300022737SoilVIPNRRWGLDAVGVVVNHIMTAGIAAHAIIVNIMSHTAVIFSAIGYEFSCRYINFQIP
Ga0247786_100177923300022883SoilVIPNRRWGLDAVGVVVNHIMTAGIAAHAIIVNIMSHTAVIFSAIGYGFSCRYINFQIPPL
Ga0247763_115730923300023274Plant LitterVIPNRRWGLDAVGVVVNHIMTAGIAAHAIIVNIMSHTAVIFSAIGYEFSCRYINFQIPP
Ga0209521_1036810633300025164SoilITAGTAAHAIIVNKISHTAVIFSAIAYGFNRRYINFQIW
Ga0207673_100155023300025290Corn, Switchgrass And Miscanthus RhizosphereVGVVVNHIMIAGMAAHAIIVRIISQTAVIFSAIGYGFMSRYINFQTDSLA
Ga0209640_1094596213300025324SoilNQIMTAGIAAHAIIVNIMSHTAVIFSAIAYGFKRRYINFQIW
Ga0210087_101315223300025559Natural And Restored WetlandsVIPNRRCGLDAVGVVVNHIMTVGIAAHAIIVNIISHTAVLFSTIGYGFSCRYINFQIPSV
Ga0207682_1002260723300025893Miscanthus RhizosphereVIPNRRWGLDAVGVVVNHIMTAGIAAHAIIVNIISHTAVIFSAIRYEISCRYINFQIPPL
Ga0207647_1004333923300025904Corn RhizosphereVIPNRRWGLDTVGVVVNHIMTAGIAAHAIIVNIMSHTAVIFSAIGYGFSCRYINFQIPPL
Ga0207645_1003225843300025907Miscanthus RhizosphereVIPNRRWGLEAVGVVVNHIMTAGIAAHAIIVNIISHTAVIFSAIRYGISCRYINFQIPSL
Ga0207643_1000226383300025908Miscanthus RhizosphereVIPNRRWGLDAVGVVVNHIMTAGIAAHAIIVNIMSHTAVIFSAIGYGFNCRYINFQIPPL
Ga0207654_1047353413300025911Corn RhizosphereRNSVIPNRRWGLDAVGVVVNHIMTAGIAAHAIIVNIMSHTAVIFSAIGYGFSCRYINFQIPPLK
Ga0207707_1051272123300025912Corn RhizosphereVIPNRRWGLDAVGVVVNHIMTAGIAAHAIIVNIMSHTAVIFSAIGYGFSCRYINFQIPSL
Ga0207660_1002543313300025917Corn RhizosphereRWGLDAVGVVVNHIMTAGIAAHAIIVNIMSHTAVIFSAIGYGFNCRYINFQIPPLK
Ga0207660_1026604813300025917Corn RhizosphereVIPNRRWGLDAVGVVVNHIMTAGIAAHAIIVNIMSHTAVIFSAIGYEFS
Ga0207649_1146584513300025920Corn RhizosphereVIPNRRWGLDAVGVVVNHIMTAGIAAHAIIVNIMSHTAVIFSAIGYEFSCS
Ga0207686_1019007923300025934Miscanthus RhizosphereVIPNRRWGLDAVGVVVNHIMTAGIAAHAIIVNIISHTAVIFSAIRYGISCRYINFQIPSL
Ga0207704_1070625513300025938Miscanthus RhizosphereVIPNRRWGLDAVGVVVNHIMTAGIAAHAIIVNIMSHTAVIFSAIGYGFSCRYIN
Ga0207691_1070301823300025940Miscanthus RhizosphereHIIIAGMAAHAIIVRIISQTAVIFSAIGYGFMSRYINFQTDLLAK
Ga0207651_1009352333300025960Switchgrass RhizosphereVGSVVNHIIIAGMAAHAIIVRIISQTAVIFSAIGYGFMSRYINFQTDLLAK
Ga0207640_1055553523300025981Corn RhizosphereVIPNRRWGLDAEGVVVNHIMTAGIAAHAIIVNIMSHTAVIFSAIGYGFNCRYINFQIPPL
Ga0207639_1051474213300026041Corn RhizosphereVIPNRRWGLDAVGVVVNHIMTAGIAAHAIIVNIISHTAVIFSAIGYGFSCRYINFQIPPL
Ga0207698_1246856813300026142Corn RhizosphereGVGVVVNHIMIAGMAAHAIIVRIISQTAVIFSAIGYGFMSRYINFQTDSLA
Ga0207527_10334223300026759SoilVIPNRRWGLDAVGVVVNHIMTAGIAAHAIIVNIMSHTAVIFSAIGYEFSCRYINFQI
Ga0207585_10129623300026936SoilVIPNRRWGLDAVGVVVNHIMTAGIAAHAIIVNIMSHTAVIFSAIGYGLGGRYINFQIPPL
Ga0207610_10020513300026938SoilAAHAIIVNIMSHTAVIFSAIGYGLGGRYINFQIPPLK
Ga0208475_100036023300027018SoilVGVVVNHIMTAGIVAHAIIVKMISQTAVIFSAIEYGFRSRYINFQNDSFA
Ga0209878_100055543300027163Groundwater SandVGVVVNQIITAGTAAHAIIVNKISHTAVIFSAIAYGFNRRYINFQI
Ga0209845_100431823300027324Groundwater SandMIPSIKCGFDEVGVVVNHIMTAGTAAQATMVKMISHTAVIFSAIKYGFRSRYINFQIGFF
Ga0209842_103110123300027379Groundwater SandVVNHIMTAGTAAQATMVKMISHTAVVFSTIKYGFRSRYINFQIG
Ga0207618_10017613300027433SoilVIPNRRWGLDAVGVVVNHIMTAGIAAHAIIVNIMSHTAVIFSAIGYGFSCRYINFQIPP
Ga0209818_100279433300027637Agricultural SoilVGVVVNQIITAGTAAHAIIVNKISHTAVIFSAIAYGFNRRYINFQIW
Ga0209819_1001249523300027722Freshwater SedimentMPSSRSGFGALGVVVNQIMTAGTAAHATIVNIMSHTAVIFSAIAYGFKRRYINFQTGLLV
Ga0209974_1036439713300027876Arabidopsis Thaliana RhizosphereVGVVVNHIMTAGIVAHAIIVKMISQTAVIFSAIEYGFRSRYINFQDDSFA
Ga0268265_1008510123300028380Switchgrass RhizosphereVIPNRRWGLDAVGVVVSHIMTAGIAAHAIIVNIISHTAVIFSAIEYGFSCRYINFQIPSL
Ga0268264_1005040813300028381Switchgrass RhizosphereVIPNRRWGLDAVGVVVNHIMTAGIAAHAIIVNIMSHTAVIFSAIGYGFNCRYIN
Ga0307320_1036629013300028771SoilVGVVVSHIMTAGTAAQAIMVKMISHTAVVFSAIKYGFTSRYI
Ga0307284_1033504023300028799SoilIMTAGIVAHAIIVKMISQTAVIVSAIEYGFRSRYINFQNDSFA
Ga0307305_1002122613300028807SoilVGVVVNHIMTAGIVAHAIIVKMISQTAVIVSAIEYGFRSRYINFQNDS
Ga0307305_1047526423300028807SoilVGVVVNRIMTAGIVAHAIIVKMISQTAVIVSAIEYGFRSRYINFQNDSFA
Ga0307296_1000080313300028819SoilGLGAVGVVVNHIMTAGIVAHAIIVKMISQTAVIVSAIEYGFNSRYINFQNDSFA
Ga0307296_1020068513300028819SoilVGVVVNHIMTAGIVAHAIIVKMISQTAVIVSAIEYGFRSRYINF
Ga0310887_1100764523300031547SoilVIPNRRWGLDAVGVVVNHIMTAGIAAHAIIVNIMSHTAVIFSAIGYGFSCRYINFQIPQL
Ga0310907_1008002223300031847SoilVIPNRRWGLDAVGVVVSHIMTAGIAAHAIIVNIISHTAVIFSAIGYGFSCRYINFQIPSL
Ga0310903_1000926543300032000SoilVIPNRRWGLDAVGVVVSHIMTAGIAAHAIIVNIMSHTAVIFSAIGYGFSCRYINFQIP
Ga0310897_1005857313300032003SoilGLDAVGVVVNHIMTAGIAAHAIIVNIMSHTAVIFSAIGYGFNCRYINFQIPPLK
Ga0310899_1007195623300032017SoilVIPNRRWGLDAVGVVVSHIMTAGIAAHAIIVNIMSHTAVIFSAIGYEFSCRYINFQI
Ga0307471_10058191323300032180Hardwood Forest SoilIPEGKNSVIPNRRWGLDAVGVVVNHIMTAGIAAHAIIVNIISHTAVIFSAIGYGFSCRYINFQIPSLK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.