| Basic Information | |
|---|---|
| Family ID | F071910 |
| Family Type | Metagenome |
| Number of Sequences | 121 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MRRIVIAALVVALLGAFGLTLGLSAADAVERAVERHAAGVERALSL |
| Number of Associated Samples | 74 |
| Number of Associated Scaffolds | 121 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 88.89 % |
| % of genes near scaffold ends (potentially truncated) | 14.88 % |
| % of genes from short scaffolds (< 2000 bps) | 86.78 % |
| Associated GOLD sequencing projects | 70 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (71.901 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands (14.050 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.884 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (46.281 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 59.46% β-sheet: 0.00% Coil/Unstructured: 40.54% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 121 Family Scaffolds |
|---|---|---|
| PF00436 | SSB | 70.25 |
| PF03837 | RecT | 1.65 |
| PF13479 | AAA_24 | 1.65 |
| PF09588 | YqaJ | 1.65 |
| PF01609 | DDE_Tnp_1 | 0.83 |
| PF00483 | NTP_transferase | 0.83 |
| PF01618 | MotA_ExbB | 0.83 |
| COG ID | Name | Functional Category | % Frequency in 121 Family Scaffolds |
|---|---|---|---|
| COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 70.25 |
| COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 70.25 |
| COG3723 | Recombinational DNA repair protein RecT | Replication, recombination and repair [L] | 1.65 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.83 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.83 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.83 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.83 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.83 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 71.90 % |
| All Organisms | root | All Organisms | 28.10 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002495|BRMGV_1038803 | Not Available | 619 | Open in IMG/M |
| 3300004000|Ga0055458_10140393 | Not Available | 699 | Open in IMG/M |
| 3300004000|Ga0055458_10146446 | Not Available | 687 | Open in IMG/M |
| 3300004000|Ga0055458_10163092 | Not Available | 657 | Open in IMG/M |
| 3300004001|Ga0055450_10356421 | Not Available | 544 | Open in IMG/M |
| 3300004005|Ga0055448_10339091 | Not Available | 597 | Open in IMG/M |
| 3300004011|Ga0055460_10300987 | Not Available | 519 | Open in IMG/M |
| 3300004018|Ga0055452_10248424 | Not Available | 598 | Open in IMG/M |
| 3300004027|Ga0055459_10202044 | Not Available | 555 | Open in IMG/M |
| 3300004050|Ga0055491_10059890 | Not Available | 873 | Open in IMG/M |
| 3300004113|Ga0065183_10656360 | Not Available | 544 | Open in IMG/M |
| 3300004481|Ga0069718_16072553 | Not Available | 556 | Open in IMG/M |
| 3300005601|Ga0070722_10164751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiococcus → Thiococcus pfennigii | 896 | Open in IMG/M |
| 3300005609|Ga0070724_10555595 | Not Available | 515 | Open in IMG/M |
| 3300009078|Ga0105106_10939277 | Not Available | 615 | Open in IMG/M |
| 3300009131|Ga0115027_10168272 | Not Available | 1362 | Open in IMG/M |
| 3300009179|Ga0115028_11104502 | Not Available | 645 | Open in IMG/M |
| 3300009430|Ga0114938_1001422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 16240 | Open in IMG/M |
| 3300009430|Ga0114938_1054429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 1498 | Open in IMG/M |
| 3300009430|Ga0114938_1118259 | Not Available | 961 | Open in IMG/M |
| 3300009506|Ga0118657_10460741 | Not Available | 1655 | Open in IMG/M |
| 3300009506|Ga0118657_10788374 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiococcus → Thiococcus pfennigii | 2086 | Open in IMG/M |
| 3300009509|Ga0123573_10037225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 5285 | Open in IMG/M |
| 3300009509|Ga0123573_10101074 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2947 | Open in IMG/M |
| 3300009509|Ga0123573_10153128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2542 | Open in IMG/M |
| 3300009509|Ga0123573_10278186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiohalocapsa → Thiohalocapsa halophila | 1627 | Open in IMG/M |
| 3300010392|Ga0118731_104008580 | Not Available | 1070 | Open in IMG/M |
| 3300010392|Ga0118731_111361606 | Not Available | 894 | Open in IMG/M |
| 3300010392|Ga0118731_114862839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiococcus → Thiococcus pfennigii | 1355 | Open in IMG/M |
| 3300010392|Ga0118731_115345089 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiococcus → Thiococcus pfennigii | 1002 | Open in IMG/M |
| 3300010412|Ga0136852_10687112 | Not Available | 982 | Open in IMG/M |
| 3300010430|Ga0118733_100501604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 2409 | Open in IMG/M |
| 3300010430|Ga0118733_101838129 | Not Available | 1205 | Open in IMG/M |
| 3300010430|Ga0118733_107987458 | Not Available | 547 | Open in IMG/M |
| 3300010997|Ga0139324_1073384 | Not Available | 803 | Open in IMG/M |
| 3300014304|Ga0075340_1079116 | Not Available | 627 | Open in IMG/M |
| 3300014324|Ga0075352_1142901 | Not Available | 666 | Open in IMG/M |
| 3300019703|Ga0194021_1051208 | Not Available | 508 | Open in IMG/M |
| 3300019715|Ga0193966_1039920 | Not Available | 574 | Open in IMG/M |
| 3300019727|Ga0193976_1060962 | Not Available | 523 | Open in IMG/M |
| 3300019728|Ga0193996_1040050 | Not Available | 608 | Open in IMG/M |
| 3300019728|Ga0193996_1040468 | Not Available | 606 | Open in IMG/M |
| 3300019732|Ga0194014_1006036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiococcus → Thiococcus pfennigii | 1340 | Open in IMG/M |
| 3300019734|Ga0193970_1038356 | Not Available | 626 | Open in IMG/M |
| 3300019743|Ga0193992_1062135 | Not Available | 550 | Open in IMG/M |
| 3300019747|Ga0193978_1083732 | Not Available | 508 | Open in IMG/M |
| (restricted) 3300024059|Ga0255040_10184758 | Not Available | 850 | Open in IMG/M |
| (restricted) 3300024338|Ga0255043_10115358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiococcus → Thiococcus pfennigii | 891 | Open in IMG/M |
| 3300025106|Ga0209398_1059594 | Not Available | 968 | Open in IMG/M |
| 3300025106|Ga0209398_1135708 | Not Available | 577 | Open in IMG/M |
| 3300025550|Ga0210098_1036098 | Not Available | 780 | Open in IMG/M |
| 3300025554|Ga0210060_1002004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 4140 | Open in IMG/M |
| 3300025554|Ga0210060_1003437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 2925 | Open in IMG/M |
| 3300025554|Ga0210060_1075146 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 595 | Open in IMG/M |
| 3300025563|Ga0210112_1065969 | Not Available | 752 | Open in IMG/M |
| 3300025573|Ga0210133_1024190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiococcus → Thiococcus pfennigii | 1296 | Open in IMG/M |
| 3300025817|Ga0210144_1194348 | Not Available | 571 | Open in IMG/M |
| 3300025895|Ga0209567_10047089 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiohalocapsa → Thiohalocapsa halophila | 1994 | Open in IMG/M |
| 3300025895|Ga0209567_10533712 | Not Available | 569 | Open in IMG/M |
| 3300025984|Ga0210082_1033244 | Not Available | 830 | Open in IMG/M |
| 3300027739|Ga0209575_10070347 | Not Available | 1279 | Open in IMG/M |
| (restricted) 3300027837|Ga0255041_10231318 | Not Available | 657 | Open in IMG/M |
| 3300027841|Ga0209262_10308596 | Not Available | 770 | Open in IMG/M |
| 3300027841|Ga0209262_10390481 | Not Available | 678 | Open in IMG/M |
| 3300027887|Ga0208980_10277529 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiococcus → Thiococcus pfennigii | 973 | Open in IMG/M |
| 3300027897|Ga0209254_10144651 | All Organisms → cellular organisms → Bacteria | 1953 | Open in IMG/M |
| 3300027897|Ga0209254_10395373 | Not Available | 1027 | Open in IMG/M |
| 3300027917|Ga0209536_100334355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiococcus → Thiococcus pfennigii | 1895 | Open in IMG/M |
| 3300027917|Ga0209536_100559672 | Not Available | 1425 | Open in IMG/M |
| 3300027917|Ga0209536_101011249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiococcus → Thiococcus pfennigii | 1024 | Open in IMG/M |
| 3300031256|Ga0315556_1001681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 13127 | Open in IMG/M |
| 3300031256|Ga0315556_1053922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 1643 | Open in IMG/M |
| 3300031367|Ga0307440_1009400 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 3624 | Open in IMG/M |
| 3300031371|Ga0307423_1103509 | Not Available | 854 | Open in IMG/M |
| 3300031665|Ga0316575_10091133 | Not Available | 1235 | Open in IMG/M |
| 3300031665|Ga0316575_10110733 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1120 | Open in IMG/M |
| 3300031691|Ga0316579_10015300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 3329 | Open in IMG/M |
| 3300031691|Ga0316579_10105093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | 1354 | Open in IMG/M |
| 3300031691|Ga0316579_10149603 | Not Available | 1126 | Open in IMG/M |
| 3300031691|Ga0316579_10190495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiococcus → Thiococcus pfennigii | 991 | Open in IMG/M |
| 3300031691|Ga0316579_10277245 | Not Available | 810 | Open in IMG/M |
| 3300031727|Ga0316576_10609867 | Not Available | 796 | Open in IMG/M |
| 3300031727|Ga0316576_11010559 | Not Available | 592 | Open in IMG/M |
| 3300031728|Ga0316578_10207499 | Not Available | 1179 | Open in IMG/M |
| 3300031728|Ga0316578_10784034 | Not Available | 553 | Open in IMG/M |
| 3300031733|Ga0316577_10774029 | Not Available | 545 | Open in IMG/M |
| 3300032136|Ga0316201_10578207 | Not Available | 961 | Open in IMG/M |
| 3300032231|Ga0316187_10663503 | Not Available | 774 | Open in IMG/M |
| 3300032231|Ga0316187_10823132 | Not Available | 684 | Open in IMG/M |
| 3300032231|Ga0316187_10873242 | Not Available | 662 | Open in IMG/M |
| 3300032251|Ga0316198_10015752 | All Organisms → cellular organisms → Bacteria | 4682 | Open in IMG/M |
| 3300032251|Ga0316198_10192743 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiococcus → Thiococcus pfennigii | 1181 | Open in IMG/M |
| 3300032251|Ga0316198_10406995 | Not Available | 757 | Open in IMG/M |
| 3300032252|Ga0316196_10318481 | Not Available | 673 | Open in IMG/M |
| 3300032252|Ga0316196_10363573 | Not Available | 623 | Open in IMG/M |
| 3300032258|Ga0316191_10203793 | Not Available | 1443 | Open in IMG/M |
| 3300032258|Ga0316191_10299191 | Not Available | 1171 | Open in IMG/M |
| 3300032258|Ga0316191_10470693 | Not Available | 914 | Open in IMG/M |
| 3300032258|Ga0316191_10745381 | Not Available | 710 | Open in IMG/M |
| 3300032259|Ga0316190_10288971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiococcus → Thiococcus pfennigii | 1124 | Open in IMG/M |
| 3300032260|Ga0316192_10472900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiococcus → Thiococcus pfennigii | 854 | Open in IMG/M |
| 3300032260|Ga0316192_10775916 | Not Available | 645 | Open in IMG/M |
| 3300032262|Ga0316194_10324222 | Not Available | 977 | Open in IMG/M |
| 3300032262|Ga0316194_10672302 | Not Available | 652 | Open in IMG/M |
| 3300032262|Ga0316194_10685906 | Not Available | 645 | Open in IMG/M |
| 3300032262|Ga0316194_10826318 | Not Available | 583 | Open in IMG/M |
| 3300032272|Ga0316189_10836698 | Not Available | 699 | Open in IMG/M |
| 3300032272|Ga0316189_10902251 | Not Available | 670 | Open in IMG/M |
| 3300032276|Ga0316188_10460329 | Not Available | 675 | Open in IMG/M |
| 3300032277|Ga0316202_10448865 | Not Available | 605 | Open in IMG/M |
| 3300033416|Ga0316622_102169355 | Not Available | 644 | Open in IMG/M |
| 3300033418|Ga0316625_101271883 | Not Available | 680 | Open in IMG/M |
| 3300033419|Ga0316601_102513501 | Not Available | 518 | Open in IMG/M |
| 3300033429|Ga0316193_10941596 | Not Available | 687 | Open in IMG/M |
| 3300033483|Ga0316629_10233048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiococcus → Thiococcus pfennigii | 1196 | Open in IMG/M |
| 3300033521|Ga0316616_102343193 | Not Available | 713 | Open in IMG/M |
| 3300033557|Ga0316617_102318929 | Not Available | 555 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 14.05% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 12.40% |
| Worm Burrow | Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow | 11.57% |
| Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Sediment | 9.09% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 8.26% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.96% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 4.13% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 4.13% |
| Mangrove Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment | 4.13% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 3.31% |
| Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 2.48% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 2.48% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 2.48% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 2.48% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 1.65% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.65% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.65% |
| Salt Marsh Sediment | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment | 1.65% |
| Mangrove Sediment | Environmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment | 1.65% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.65% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.83% |
| Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment | 0.83% |
| Mangrove Soil | Environmental → Aquatic → Marine → Oceanic → Oil-Contaminated Sediment → Mangrove Soil | 0.83% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 0.83% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.83% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002495 | 454 Fosmid Sequence | Environmental | Open in IMG/M |
| 3300004000 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLB_D2 | Environmental | Open in IMG/M |
| 3300004001 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWC_D1 | Environmental | Open in IMG/M |
| 3300004005 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWA_D2 | Environmental | Open in IMG/M |
| 3300004011 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300004018 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWC_D2 | Environmental | Open in IMG/M |
| 3300004027 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLC_D2 | Environmental | Open in IMG/M |
| 3300004050 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D2 | Environmental | Open in IMG/M |
| 3300004113 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - COGITO 998_met_12 (version 2) | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300005601 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.1 | Environmental | Open in IMG/M |
| 3300005609 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.1 | Environmental | Open in IMG/M |
| 3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
| 3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
| 3300009430 | Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Big Spring | Environmental | Open in IMG/M |
| 3300009506 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8 | Environmental | Open in IMG/M |
| 3300009509 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_11 | Environmental | Open in IMG/M |
| 3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
| 3300010412 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_10 | Environmental | Open in IMG/M |
| 3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
| 3300010997 | ECM15MPS05_Aassembled -- Sediment microbial communities from coastal marsh in Port Sulphur, LA sequencing method A (2X250bp) | Environmental | Open in IMG/M |
| 3300014304 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D1 | Environmental | Open in IMG/M |
| 3300014324 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1 | Environmental | Open in IMG/M |
| 3300019703 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_7-8_MG | Environmental | Open in IMG/M |
| 3300019715 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRT_2-3_MG | Environmental | Open in IMG/M |
| 3300019727 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FRT_3-4_MG | Environmental | Open in IMG/M |
| 3300019728 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_2-3_MG | Environmental | Open in IMG/M |
| 3300019732 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_0-1_MG | Environmental | Open in IMG/M |
| 3300019734 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRT_6-7_MG | Environmental | Open in IMG/M |
| 3300019743 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BLC_3-4_MG | Environmental | Open in IMG/M |
| 3300019747 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FRT_5-6_MG | Environmental | Open in IMG/M |
| 3300024059 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_2 | Environmental | Open in IMG/M |
| 3300024338 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_9 | Environmental | Open in IMG/M |
| 3300025106 | Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Big Spring (SPAdes) | Environmental | Open in IMG/M |
| 3300025550 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025554 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025563 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025573 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025817 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025895 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - COGITO 998_met_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025984 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_ThreeSqA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027739 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Medium cellulose week 11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027837 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_3 | Environmental | Open in IMG/M |
| 3300027841 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027887 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 Bulk | Environmental | Open in IMG/M |
| 3300027897 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes) | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300031256 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1603-10 | Environmental | Open in IMG/M |
| 3300031367 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1604-10 | Environmental | Open in IMG/M |
| 3300031371 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-10 | Environmental | Open in IMG/M |
| 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Host-Associated | Open in IMG/M |
| 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Host-Associated | Open in IMG/M |
| 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Host-Associated | Open in IMG/M |
| 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Host-Associated | Open in IMG/M |
| 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Host-Associated | Open in IMG/M |
| 3300032136 | Coastal sediment microbial communities from Delaware Bay, Delaware, United States - CS-6 worm burrow | Environmental | Open in IMG/M |
| 3300032231 | Coastal sediment microbial communities from Maine, United States - Cross River worm burrow 1 | Environmental | Open in IMG/M |
| 3300032251 | Coastal sediment microbial communities from Oude Bieten Haven, Netherlands - site A anoxic | Environmental | Open in IMG/M |
| 3300032252 | Coastal sediment microbial communities from Maine, United States - Eddy sediment 2 cm | Environmental | Open in IMG/M |
| 3300032258 | Coastal sediment microbial communities from Maine, United States - Eddy worm burrow 2 cm | Environmental | Open in IMG/M |
| 3300032259 | Coastal sediment microbial communities from Maine, United States - Eddy worm burrow 2 | Environmental | Open in IMG/M |
| 3300032260 | Coastal sediment microbial communities from Maine, United States - Merrow Island worm burrow | Environmental | Open in IMG/M |
| 3300032262 | Coastal sediment microbial communities from Maine, United States - Cross River sediment 1 | Environmental | Open in IMG/M |
| 3300032272 | Coastal sediment microbial communities from Maine, United States - Lowes Cove worm burrow | Environmental | Open in IMG/M |
| 3300032276 | Coastal sediment microbial communities from Maine, United States - Phippsburg worm burrow 1 | Environmental | Open in IMG/M |
| 3300032277 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite | Environmental | Open in IMG/M |
| 3300033416 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
| 3300033429 | Coastal sediment microbial communities from Maine, United States - Merrow Island sediment 2 | Environmental | Open in IMG/M |
| 3300033483 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| BRMGV_10388032 | 3300002495 | Mangrove Soil | MRRIVVAALIAALLGAFGLALGRSAANAVERAVERHASSVERALSL* |
| Ga0055458_101403932 | 3300004000 | Natural And Restored Wetlands | MRRIAIAALVVALLGAFGLSLGLSAADAVDRAVERHSAGVEHTLSL* |
| Ga0055458_101464462 | 3300004000 | Natural And Restored Wetlands | MRRILIAALVVALGAFALEVGLSAADAVERAIEQRAAAVERALSL* |
| Ga0055458_101630922 | 3300004000 | Natural And Restored Wetlands | MRHIVVAALIAALPGAFGLALGRSAANAVERAVERHAAGVERALSVQDAANPTNP* |
| Ga0055450_103564212 | 3300004001 | Natural And Restored Wetlands | TMRRIVIAALVVALLGAFALSLGLSAADAVERAVERHAVGVERALSL* |
| Ga0055448_103390912 | 3300004005 | Natural And Restored Wetlands | MRRIVIAALVVALLGAFGLALGLSAADAVERAVERRTASVERALSL* |
| Ga0055460_103009871 | 3300004011 | Natural And Restored Wetlands | MRRIVIATLVVALLGAFGLSLGLSAADAVERAVERRTASVERALSL* |
| Ga0055452_102484242 | 3300004018 | Natural And Restored Wetlands | MRRIAIAALVVAILGAFGLSLGLSAADAVERAVERHTAGVERALSL* |
| Ga0055459_102020442 | 3300004027 | Natural And Restored Wetlands | MRRIVIAALVVAILGAFGLSLGLSAADAVDRAVERHSAGVEHTLSL* |
| Ga0055491_100598902 | 3300004050 | Natural And Restored Wetlands | MRPVVLAALVAAFLGACGLALGLSAADAVEQAVVRHAAGIEHPVSW* |
| Ga0065183_106563601 | 3300004113 | Pelagic Marine | MRRIVIAALVVAVLGAFGLALGLSAADAVQRAVAHRTAGVERSLSL* |
| Ga0069718_160725531 | 3300004481 | Sediment | MRRIVIAARVVALSACGVVLGLSAADAVELAEERHSAGVENPASW* |
| Ga0070722_101647511 | 3300005601 | Marine Sediment | MRRIVIAALVVALLGAFGLALGLSAADAVERAVAQRAVGVEHALSL* |
| Ga0070724_105555951 | 3300005609 | Marine Sediment | ALVVALLGAFGLALGLSAADAVERAVAQRAVGVERALSL* |
| Ga0105106_109392772 | 3300009078 | Freshwater Sediment | VLVALVAGFLGACGLALGLSAADAVALAVARHSAGVENPVSW* |
| Ga0115027_101682722 | 3300009131 | Wetland | MRPIVLAALVAAFLGACALALGLSTTDAVERAAERHAAGIEHPVSG* |
| Ga0115028_111045021 | 3300009179 | Wetland | MRPIVLAALVTALLGACGLALGLSAADAVEQAVARQAAGIEHPVSR* |
| Ga0114938_10014223 | 3300009430 | Groundwater | MRPIVIAALVVALLGAFGLSLGLSAADAVERAVERHAAGVERALSS* |
| Ga0114938_10544293 | 3300009430 | Groundwater | MRRIVVAALIAALLGAFGLALGRSAANAVERAVERHASGVERALSL* |
| Ga0114938_11182592 | 3300009430 | Groundwater | MRRIALAALVAAFLGAFGLAVGRSAADVVERAVERQTAGVERAVSL* |
| Ga0118657_104607414 | 3300009506 | Mangrove Sediment | MRPIVLAVLVAALLGAFGLAIGRSAADAVERAVERHTAGVEQAVSL* |
| Ga0118657_107883744 | 3300009506 | Mangrove Sediment | MRRISLAVLVAALLGAFGLTVGRSAADAVERAVERHTAGVEQAVSP* |
| Ga0123573_100372254 | 3300009509 | Mangrove Sediment | MRPIVVAALIAALLGAFGLALGRFAADAVERAVERHAAGVDRALSL* |
| Ga0123573_101010744 | 3300009509 | Mangrove Sediment | MRRIVLAVLVAALLGAFGLAVGLSAADAMERAIERHTAGVEQAVSL* |
| Ga0123573_101531284 | 3300009509 | Mangrove Sediment | MRPIVLAVLVAALLGAVGLAVGRSAADAVERAVERHTAGVEQAVSL* |
| Ga0123573_102781861 | 3300009509 | Mangrove Sediment | STAHRLWRNVMRRIVLAVLVAALLGAFGLAVGRSAADAVERALERHTAGVERAVSL* |
| Ga0118731_1040085802 | 3300010392 | Marine | MRRIVIAALVVALLGAFGLALGLSAADAVERAVERHTTGVERAVSG* |
| Ga0118731_1113616062 | 3300010392 | Marine | MRCILIAALVAALLGALGLALGLSAADAVERAVAQRTAGVERAVSF* |
| Ga0118731_1148628393 | 3300010392 | Marine | MRRIVIAALVAALLGAFGLALSLSAADAVERAVAQRAVGVERALSL* |
| Ga0118731_1153450893 | 3300010392 | Marine | MRRIVFAALVVALLGAFGLALGLSAADAVERAVAQRTVGVERALSL* |
| Ga0136852_106871122 | 3300010412 | Mangrove Sediment | MRRIVLAVLVAALLGAFGLAVGRSAADAVERAVERHTAVIERAVSL* |
| Ga0118733_1005016041 | 3300010430 | Marine Sediment | IVIAALVVALLSAFGLALGLSAADAVEQAVAQRTAGVERAVSF* |
| Ga0118733_1018381294 | 3300010430 | Marine Sediment | MRRILIAALVVALLGTFGLALGLSAADAVERAVAQRAVGVERALSL* |
| Ga0118733_1079874581 | 3300010430 | Marine Sediment | MRRIVIAALVAALLGAFGLALGLSAADAVERAVAQRAVGVERALSL* |
| Ga0139324_10733841 | 3300010997 | Sediment | MRPIVVAALIAALLGAFGLALGRSAANAVERTVAQHAAGVERALSL* |
| Ga0075340_10791162 | 3300014304 | Natural And Restored Wetlands | RASHRHGKSTMRPIVLAVLVAALGACGLAVGLSAAGAVERAVERHAAGIEHAVSW* |
| Ga0075352_11429011 | 3300014324 | Natural And Restored Wetlands | MRPIVVAALVAAFLGACGLALGLSAADAVGRAVERHTASIEHAVSW* |
| Ga0194021_10512082 | 3300019703 | Sediment | MRRIVIAALVVAVLGAFGLALGLSAADAVERAVAHRTAGVERALSL |
| Ga0193966_10399201 | 3300019715 | Sediment | MRPIVVAALIAALLGAFGLALGRSAANAVERAVERHAAGVDRALSL |
| Ga0193976_10609621 | 3300019727 | Sediment | MRPIVVAALIAALLGAFGLALGRSAANAVERAVTRHATGVERALSL |
| Ga0193996_10400501 | 3300019728 | Sediment | MRPIVVAALIAALLGAFGLALGRSAANAVERAVERHVVGVESALSL |
| Ga0193996_10404681 | 3300019728 | Sediment | MRRIVFAALVVALLGALGLALGLSAADAVNRAVEQRTASVERALSL |
| Ga0194014_10060362 | 3300019732 | Sediment | MRRIVIAALVVALLAAFGLALGLSAADAVERAVAHRAVGVERALSW |
| Ga0193970_10383561 | 3300019734 | Sediment | MRRIVIAALVVALLGAFGLALGLSAADAVDRAVAQRAAGVERALS |
| Ga0193992_10621352 | 3300019743 | Sediment | MRRIVIATLVVAVLGAFGLALGLSAADAVKRAVEQRTAGVERALSL |
| Ga0193978_10837321 | 3300019747 | Sediment | MRRIVIAALVVALLSAFGLALGLSAADAVERAVAQRAVGVERALSL |
| (restricted) Ga0255040_101847583 | 3300024059 | Seawater | MRRIVIAALVVALLGAFGLALGLSAADAVERAVAQRAVGVERALSL |
| (restricted) Ga0255043_101153583 | 3300024338 | Seawater | MRRILIAALVVAVLGAFGLALGLSAADAVERAVAQRAVGVE |
| Ga0209398_10595942 | 3300025106 | Groundwater | MRRIALAALVAAFLGAFGLAVGRSAADVVERAVERQTAGVERAVSL |
| Ga0209398_11357082 | 3300025106 | Groundwater | MRRIVVAALIAALLGAFGLALGRSAANAVERAVERHASGVERALSL |
| Ga0210098_10360981 | 3300025550 | Natural And Restored Wetlands | MRRIVIAALVVALLGAFALSLGLSAADAVERAVERHAAGVERALSL |
| Ga0210060_10020046 | 3300025554 | Natural And Restored Wetlands | MRRIAIAALVVALLGAFGLSLGLSAADAVDRAVERHSAGVEHTLSL |
| Ga0210060_10034374 | 3300025554 | Natural And Restored Wetlands | MRRILIAALVVALGAFALEVGLSAADAVERAIEQRAAAVERALSL |
| Ga0210060_10751461 | 3300025554 | Natural And Restored Wetlands | MRHIVVAALIAALPGAFGLALGRSAANAVERAVERHAAGVERALSVQDAANPTNP |
| Ga0210112_10659692 | 3300025563 | Natural And Restored Wetlands | MRRIVIAALVVALLGTFALSLGLSAADAVERAVERHAVGVERALSL |
| Ga0210133_10241902 | 3300025573 | Natural And Restored Wetlands | MRRIVIATLVVALLGAFGLSLGLSAADAVERAVERRAAGVERALSL |
| Ga0210144_11943481 | 3300025817 | Natural And Restored Wetlands | IAALVAALLGAFGLSLGLSAADAVERAVERHSAGVERALSL |
| Ga0209567_100470891 | 3300025895 | Pelagic Marine | MRRIVIATLVVALLGAFGLALGLSAADAVERAVAQRTAGVERAVSF |
| Ga0209567_105337121 | 3300025895 | Pelagic Marine | MRRIVIAALVVAVLGAFGLALGLSAADAVQRAVAHRTAGVERSLSL |
| Ga0210082_10332442 | 3300025984 | Natural And Restored Wetlands | MRRIVIAALVVALLGAFALSLGLSAADAVEQAVERHATGVERALSL |
| Ga0209575_100703472 | 3300027739 | Freshwater | MRRIVIAARVVALSACGVALGLSAADAEELAAERHAVGIEHPVSG |
| (restricted) Ga0255041_102313182 | 3300027837 | Seawater | MRRIVIAALVVAVLGAFGLALGLSAADAVERAVAQRAVGVERAVFF |
| Ga0209262_103085962 | 3300027841 | Freshwater | MRRIVIAARVVALSACGVALGLSAADAEELAAERHAAGIEPAVSR |
| Ga0209262_103904812 | 3300027841 | Freshwater | MRYLVFAALVTALLGACGLALGLSAADAVEQAVAPHSAGVERVVSW |
| Ga0208980_102775293 | 3300027887 | Wetland | MRRIVIAARVVALLGACGLALGLSAADAVELAEERHSAG |
| Ga0209254_101446513 | 3300027897 | Freshwater Lake Sediment | MRPIVVAALIAALLGAFGLALGRSAANAVERAVERHAAGVERALSR |
| Ga0209254_103953732 | 3300027897 | Freshwater Lake Sediment | MRRIVIAARVVAVLGACGLALGLSAADAMELAEERHSAGVENPASW |
| Ga0209536_1003343553 | 3300027917 | Marine Sediment | VRPIVVAALIAALLGAFGLALGRSAAEAVERAVERHAAGVDRALSL |
| Ga0209536_1005596722 | 3300027917 | Marine Sediment | MRRIVIAALVVALLGAAGLALGLSAADAVERAVAHRTAGVERALSF |
| Ga0209536_1010112493 | 3300027917 | Marine Sediment | MRRIVIAALVVAILGAFGLALGLSAADAVDRAVAQRAAGVERALSL |
| Ga0315556_10016814 | 3300031256 | Salt Marsh Sediment | MRRIVIAALVVAILGAFGLSLGLSAADAVERAVERHAAGVERALSL |
| Ga0315556_10539223 | 3300031256 | Salt Marsh Sediment | MRRIVIAALIAALLGAFGLALGRSAANAVERAVEQHAAGVEQDVSL |
| Ga0307440_10094004 | 3300031367 | Salt Marsh | MRRIVIAALIAALLRAFGLALGRSAANAVERAVEQHAAGVEQDVSL |
| Ga0307423_11035092 | 3300031371 | Salt Marsh | AAQGHWRNTMRRIVIAALVVALLGAFALSLGLSAADAVERAVERHAAGVERALSL |
| Ga0316575_100911332 | 3300031665 | Rhizosphere | MRRIAIAALVVALLGAFGLSLGLSAADAVERAVERHAAGVERALSL |
| Ga0316575_101107332 | 3300031665 | Rhizosphere | MRPIVVAALIAALLGAFGLALGRSAANAVERAVERHATGVERALSP |
| Ga0316575_103489432 | 3300031665 | Rhizosphere | LLVAQSAGGLVLGLSAANAVERAVARHTAGVERAVSL |
| Ga0316579_100153005 | 3300031691 | Rhizosphere | MRRIVIAALVVALLSAFGRALGLSAADAVERAVERRAAGVERALSL |
| Ga0316579_101050933 | 3300031691 | Rhizosphere | MRRIVIAALIAAFLGAFALALGLSAADAVERAVERRTASVERALSL |
| Ga0316579_101496033 | 3300031691 | Rhizosphere | MRRIVIAALVVALLDAFGLALGLSAADAVERAVERHAAGVERALSL |
| Ga0316579_101904953 | 3300031691 | Rhizosphere | MRRIVIAALVVALMGAFGLALGLSAADAVERAVERHAAGVEHALSL |
| Ga0316579_102772452 | 3300031691 | Rhizosphere | MRRIVIAALVVALLGAFGLTLGLSAADAVERAVERHAAGVERALSL |
| Ga0316576_106098671 | 3300031727 | Rhizosphere | MRPIVVAALIAALLGAFGLALGRSAANAVERAVERHAAGVERALSL |
| Ga0316576_107297211 | 3300031727 | Rhizosphere | MTRIVIAALLVAQSAGGLVLGLSAANAVERAVARHTAGVERAVSL |
| Ga0316576_110105592 | 3300031727 | Rhizosphere | ALLGAFGLALGRSAANAVERAVERHAAGVERALSL |
| Ga0316578_102074993 | 3300031728 | Rhizosphere | MMRIAIAALVVAILGAFGLSLGLSAADAVERAVERHAAGVERALSL |
| Ga0316578_107840342 | 3300031728 | Rhizosphere | MRRIVIAAMVVALLGAFALALGLSAADAVERAVERRAAGVERALSW |
| Ga0316578_107976552 | 3300031728 | Rhizosphere | MRRIVFAALVVAQSAGGLALGLSTANAVAQAAGPHTAGVECAVSL |
| Ga0316577_107740291 | 3300031733 | Rhizosphere | STMRRITIAALVVALLGAFGLSLGLSAADAVERAVERHAAGVERALSL |
| Ga0316201_105782072 | 3300032136 | Worm Burrow | MRRIVIAALVVAVLGAFGLALGLSAADAVERAVAQRAVGVERALSL |
| Ga0316187_106635032 | 3300032231 | Worm Burrow | MRRILIAALVAALLGALGLALGLSAADAVERAVAQRTAGVERAVSF |
| Ga0316187_108231322 | 3300032231 | Worm Burrow | MRRIVIAALVVALLGAFGLALGLSAADAVERAVAQRTAGVERAVSF |
| Ga0316187_108732422 | 3300032231 | Worm Burrow | MRRIVFAALVVALLGALGLALGLSAADAVNRAVAQRAVGVERALSL |
| Ga0316198_100157522 | 3300032251 | Sediment | MRRIVIAALVVAFPGALGLALGQSATDAVDLAVERHATGAERAPSL |
| Ga0316198_101927432 | 3300032251 | Sediment | MRRIVIAALVAALLGAFGLALGLSAADAVERAVAQRTAGVERALSL |
| Ga0316198_104069951 | 3300032251 | Sediment | MRRIVIATLVVALLGAFGLALGLSAADAVERAVAQRAVGVERAL |
| Ga0316196_103184812 | 3300032252 | Sediment | MRRIVIAALVVALLAAFGLALGLSAADAVERAVAHRVAGVERAVSF |
| Ga0316196_103635731 | 3300032252 | Sediment | VAALLGAFGLALGLSAADAVERAVAQRTAGVERALSL |
| Ga0316191_102037932 | 3300032258 | Worm Burrow | MRRILIAALVVALLGAFGLALGLSAADAVERAVAHRAAGVERALSL |
| Ga0316191_102991912 | 3300032258 | Worm Burrow | MRRIVIAALVAALLGAFGLALSLSAADAVERAVAQRAVGVERALSL |
| Ga0316191_104706932 | 3300032258 | Worm Burrow | MRRIVIAALVVAILGAFGLALGLSAADAVERAVAQRTAGVERALSL |
| Ga0316191_107453812 | 3300032258 | Worm Burrow | MRRIVIAALVVAILGAFGLALGLSAADAVQRAVAHRTAGVERALSF |
| Ga0316190_102889712 | 3300032259 | Worm Burrow | MRRIVIAALVVALVGAIGLALGLSAADAVERAAAHRTAGVERALSL |
| Ga0316192_104729003 | 3300032260 | Worm Burrow | MRRIVIAALVVALLGAFGLALGLSAADAVERAVAHRVAGVERAVSF |
| Ga0316192_107759162 | 3300032260 | Worm Burrow | MRRILFAVLDAALLGAFGLALGLSAADAVNRAIEQRTAGVERAVSF |
| Ga0316194_103242222 | 3300032262 | Sediment | MTRIVIAALLVVRGAGGLALGLSAANAVERAVARHTAGVERAVSL |
| Ga0316194_106723022 | 3300032262 | Sediment | MRRILLAVLVAAILGAFGLAVGRSAADAVERAVERHTAGVERAVSL |
| Ga0316194_106859061 | 3300032262 | Sediment | MRRIVFAALVVALLGAFGLALGLSAADAVERAVAHRVAGVERAVSF |
| Ga0316194_108263182 | 3300032262 | Sediment | MRRIVFAALVVALLGAFGLALGLSAADAVERAVAHRAVGVERALSL |
| Ga0316189_108366981 | 3300032272 | Worm Burrow | MSRIVIAALVVALLGAIGLALGLSAADAVERAVAHRTTGVARALSLEDAAIQSIRKP |
| Ga0316189_109022512 | 3300032272 | Worm Burrow | MRRIVIATLVVALLGAFGLALGLSAADAVERAVAQRAVGVERALSL |
| Ga0316188_104603291 | 3300032276 | Worm Burrow | MRPIVLAALVAALGACALAPGLSTTDAVEQAVARHAADIEHAVSW |
| Ga0316202_104488652 | 3300032277 | Microbial Mat | MRRIVIAALVVVLLGAFGPALGLSAPDAVERAVERHTTGVERAVSG |
| Ga0316622_1021693552 | 3300033416 | Soil | MRYLVFAALVTALLGACGLALGLSADAVEQAVARHSAGVERVVSW |
| Ga0316625_1012718832 | 3300033418 | Soil | MRPIVLVALVAGFLGACALALGLSAADAVEQAAERHAAGIDYAVSR |
| Ga0316601_1025135012 | 3300033419 | Soil | MRPIVLAALVAAFLGACGLALGLSAADAVEQAVARHSAGVEHAV |
| Ga0316193_108939472 | 3300033429 | Sediment | MTRIVIAALLVAQSAGGLALGLSAANAVERAVARHTAGVERAVSL |
| Ga0316193_109415962 | 3300033429 | Sediment | MRRIVFAALVVALLGAFGLALGLSAADAVERAVAQRAVGVERAVSF |
| Ga0316629_102330481 | 3300033483 | Soil | MRPIVLVALVAGFLGACGLALGLSAADAMERAVERHSAGVEHAVSG |
| Ga0316616_1023431932 | 3300033521 | Soil | MRPIVLAALVAALLGACGLALGLSTTDAVEQAVARHAASIEHAVSW |
| Ga0316617_1023189292 | 3300033557 | Soil | MRPIVLVALVAGFLGACSLALGLSAADAVDLAVARYSAGVDNPVSG |
| ⦗Top⦘ |