Basic Information | |
---|---|
Family ID | F070270 |
Family Type | Metagenome |
Number of Sequences | 123 |
Average Sequence Length | 42 residues |
Representative Sequence | FTELGVDLDTAKKFGPIVIDYVAHHGGEDLVDKIRAALKL |
Number of Associated Samples | 87 |
Number of Associated Scaffolds | 123 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.81 % |
% of genes near scaffold ends (potentially truncated) | 98.37 % |
% of genes from short scaffolds (< 2000 bps) | 95.12 % |
Associated GOLD sequencing projects | 81 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.60 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (95.122 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil (21.951 % of family members) |
Environment Ontology (ENVO) | Unclassified (32.520 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Unclassified (34.146 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 39.71% β-sheet: 0.00% Coil/Unstructured: 60.29% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.60 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 123 Family Scaffolds |
---|---|---|
PF04461 | DUF520 | 13.82 |
PF00578 | AhpC-TSA | 5.69 |
PF08534 | Redoxin | 4.07 |
PF00106 | adh_short | 2.44 |
PF11075 | DUF2780 | 2.44 |
PF07883 | Cupin_2 | 0.81 |
PF02627 | CMD | 0.81 |
PF01769 | MgtE | 0.81 |
PF03982 | DAGAT | 0.81 |
PF07715 | Plug | 0.81 |
PF00392 | GntR | 0.81 |
PF00498 | FHA | 0.81 |
PF01425 | Amidase | 0.81 |
COG ID | Name | Functional Category | % Frequency in 123 Family Scaffolds |
---|---|---|---|
COG1666 | Cyclic di-GMP-binding protein YajQ, UPF0234 family | Signal transduction mechanisms [T] | 13.82 |
COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.81 |
COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.81 |
COG1824 | Permease, similar to cation transporters | Inorganic ion transport and metabolism [P] | 0.81 |
COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.81 |
COG2239 | Mg/Co/Ni transporter MgtE (contains CBS domain) | Inorganic ion transport and metabolism [P] | 0.81 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 95.12 % |
Unclassified | root | N/A | 4.88 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2088090014|GPIPI_17228840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1131 | Open in IMG/M |
3300000241|BS_KBA_SWE21_205mDRAFT_10076034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 743 | Open in IMG/M |
3300003861|Ga0031654_10135719 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 694 | Open in IMG/M |
3300004013|Ga0055465_10318349 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
3300004073|Ga0055516_10089735 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
3300004114|Ga0062593_102027866 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 640 | Open in IMG/M |
3300005353|Ga0070669_100176332 | All Organisms → cellular organisms → Bacteria | 1669 | Open in IMG/M |
3300005660|Ga0073904_10237742 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1052 | Open in IMG/M |
3300005718|Ga0068866_10906827 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 620 | Open in IMG/M |
3300005844|Ga0068862_100756465 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 946 | Open in IMG/M |
3300005956|Ga0073920_1035090 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
3300006224|Ga0079037_100495309 | All Organisms → cellular organisms → Bacteria | 1172 | Open in IMG/M |
3300006224|Ga0079037_101219145 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
3300006224|Ga0079037_101983902 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
3300006845|Ga0075421_101278846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 813 | Open in IMG/M |
3300006846|Ga0075430_100584432 | Not Available | 921 | Open in IMG/M |
3300006847|Ga0075431_100459827 | All Organisms → cellular organisms → Bacteria | 1267 | Open in IMG/M |
3300006930|Ga0079303_10213283 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
3300006969|Ga0075419_10869733 | Not Available | 649 | Open in IMG/M |
3300009075|Ga0105090_10892031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 541 | Open in IMG/M |
3300009078|Ga0105106_11288867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 518 | Open in IMG/M |
3300009081|Ga0105098_10602976 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 572 | Open in IMG/M |
3300009081|Ga0105098_10752283 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 522 | Open in IMG/M |
3300009082|Ga0105099_10378916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 841 | Open in IMG/M |
3300009085|Ga0105103_10935154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 510 | Open in IMG/M |
3300009091|Ga0102851_10550255 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1196 | Open in IMG/M |
3300009091|Ga0102851_10635039 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1121 | Open in IMG/M |
3300009091|Ga0102851_10879751 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 965 | Open in IMG/M |
3300009091|Ga0102851_10932437 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 939 | Open in IMG/M |
3300009091|Ga0102851_11895290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 673 | Open in IMG/M |
3300009091|Ga0102851_13231823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 523 | Open in IMG/M |
3300009111|Ga0115026_10037155 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2576 | Open in IMG/M |
3300009111|Ga0115026_10140796 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1539 | Open in IMG/M |
3300009111|Ga0115026_11052153 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 654 | Open in IMG/M |
3300009167|Ga0113563_12177700 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 665 | Open in IMG/M |
3300009169|Ga0105097_10055423 | All Organisms → cellular organisms → Bacteria | 2138 | Open in IMG/M |
3300009169|Ga0105097_10065781 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1963 | Open in IMG/M |
3300009169|Ga0105097_10085027 | All Organisms → cellular organisms → Bacteria | 1722 | Open in IMG/M |
3300009169|Ga0105097_10231350 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1018 | Open in IMG/M |
3300009169|Ga0105097_10810195 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 534 | Open in IMG/M |
3300009170|Ga0105096_10195119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 1023 | Open in IMG/M |
3300009179|Ga0115028_10139886 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1448 | Open in IMG/M |
3300009179|Ga0115028_10251793 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1155 | Open in IMG/M |
3300009455|Ga0114939_10228954 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 788 | Open in IMG/M |
3300009455|Ga0114939_10229207 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 788 | Open in IMG/M |
3300009509|Ga0123573_10703248 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 950 | Open in IMG/M |
3300009527|Ga0114942_1098637 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 964 | Open in IMG/M |
3300014260|Ga0075307_1008637 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1678 | Open in IMG/M |
3300014305|Ga0075349_1150712 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 545 | Open in IMG/M |
3300014306|Ga0075346_1050044 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 825 | Open in IMG/M |
3300020048|Ga0207193_1735693 | Not Available | 646 | Open in IMG/M |
3300021081|Ga0210379_10436007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 580 | Open in IMG/M |
3300022204|Ga0224496_10463536 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 509 | Open in IMG/M |
3300022213|Ga0224500_10085009 | All Organisms → cellular organisms → Bacteria | 1218 | Open in IMG/M |
3300022309|Ga0224510_10222922 | All Organisms → cellular organisms → Bacteria | 1128 | Open in IMG/M |
3300024979|Ga0208115_1074650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 512 | Open in IMG/M |
3300025130|Ga0209594_1212194 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 565 | Open in IMG/M |
3300025539|Ga0210109_1060521 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 603 | Open in IMG/M |
3300025932|Ga0207690_11739894 | Not Available | 521 | Open in IMG/M |
3300025953|Ga0210068_1020090 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 955 | Open in IMG/M |
3300026026|Ga0210129_1025577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 990 | Open in IMG/M |
3300026064|Ga0208146_1027838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 574 | Open in IMG/M |
3300026088|Ga0207641_12120815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 563 | Open in IMG/M |
3300026118|Ga0207675_101443827 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
3300026121|Ga0207683_10191458 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1857 | Open in IMG/M |
3300026357|Ga0256810_1007186 | All Organisms → cellular organisms → Bacteria | 1191 | Open in IMG/M |
3300027543|Ga0209999_1043615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 842 | Open in IMG/M |
3300027552|Ga0209982_1015764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 1148 | Open in IMG/M |
3300027683|Ga0209392_1096360 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 944 | Open in IMG/M |
3300027693|Ga0209704_1128541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 729 | Open in IMG/M |
3300027694|Ga0209170_1168689 | Not Available | 758 | Open in IMG/M |
3300027721|Ga0209492_1053263 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1427 | Open in IMG/M |
3300027805|Ga0209229_10426812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 573 | Open in IMG/M |
3300027818|Ga0209706_10211357 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 939 | Open in IMG/M |
3300027841|Ga0209262_10316926 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 759 | Open in IMG/M |
3300027877|Ga0209293_10266409 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 861 | Open in IMG/M |
3300027877|Ga0209293_10309471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae | 803 | Open in IMG/M |
3300027885|Ga0209450_10352690 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1069 | Open in IMG/M |
3300027899|Ga0209668_10042741 | All Organisms → cellular organisms → Bacteria | 2398 | Open in IMG/M |
3300027899|Ga0209668_10229899 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1167 | Open in IMG/M |
3300027899|Ga0209668_10463142 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 837 | Open in IMG/M |
3300027956|Ga0209820_1067125 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 958 | Open in IMG/M |
3300031665|Ga0316575_10016832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2771 | Open in IMG/M |
3300031911|Ga0307412_10930278 | Not Available | 764 | Open in IMG/M |
3300032164|Ga0315283_10105709 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2951 | Open in IMG/M |
3300032177|Ga0315276_10367177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 1538 | Open in IMG/M |
3300032256|Ga0315271_10273428 | All Organisms → cellular organisms → Bacteria | 1380 | Open in IMG/M |
3300032397|Ga0315287_10787747 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1118 | Open in IMG/M |
3300032516|Ga0315273_10078067 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4504 | Open in IMG/M |
3300032516|Ga0315273_11154759 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 979 | Open in IMG/M |
3300032516|Ga0315273_13061698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 521 | Open in IMG/M |
3300033406|Ga0316604_10721766 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 547 | Open in IMG/M |
3300033408|Ga0316605_11066912 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 777 | Open in IMG/M |
3300033408|Ga0316605_11648499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 623 | Open in IMG/M |
3300033413|Ga0316603_12323317 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 505 | Open in IMG/M |
3300033413|Ga0316603_12343196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 503 | Open in IMG/M |
3300033416|Ga0316622_101986510 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 676 | Open in IMG/M |
3300033419|Ga0316601_100235866 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1633 | Open in IMG/M |
3300033419|Ga0316601_100460971 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1210 | Open in IMG/M |
3300033419|Ga0316601_101132585 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 784 | Open in IMG/M |
3300033419|Ga0316601_101643522 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 647 | Open in IMG/M |
3300033419|Ga0316601_102621610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 506 | Open in IMG/M |
3300033434|Ga0316613_10797478 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 648 | Open in IMG/M |
3300033434|Ga0316613_10802683 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 646 | Open in IMG/M |
3300033481|Ga0316600_10437419 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 901 | Open in IMG/M |
3300033481|Ga0316600_10987744 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 596 | Open in IMG/M |
3300033482|Ga0316627_100418273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 1158 | Open in IMG/M |
3300033482|Ga0316627_102946639 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 506 | Open in IMG/M |
3300033485|Ga0316626_10496058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1038 | Open in IMG/M |
3300033485|Ga0316626_10632612 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 926 | Open in IMG/M |
3300033485|Ga0316626_11190446 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 681 | Open in IMG/M |
3300033485|Ga0316626_11284680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 656 | Open in IMG/M |
3300033487|Ga0316630_11528407 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 603 | Open in IMG/M |
3300033488|Ga0316621_11209802 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 571 | Open in IMG/M |
3300033493|Ga0316631_10471751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 526 | Open in IMG/M |
3300033521|Ga0316616_100479583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 1415 | Open in IMG/M |
3300033557|Ga0316617_100425599 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1180 | Open in IMG/M |
3300033557|Ga0316617_102264065 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 561 | Open in IMG/M |
3300034054|Ga0373891_082200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 537 | Open in IMG/M |
3300034055|Ga0373892_019942 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 822 | Open in IMG/M |
3300034055|Ga0373892_041774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 605 | Open in IMG/M |
3300034055|Ga0373892_043409 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 596 | Open in IMG/M |
3300034075|Ga0373895_056827 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 592 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 21.95% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 13.82% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 8.13% |
Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 5.69% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 5.69% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 4.06% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 4.06% |
Sediment Slurry | Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry | 4.06% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 3.25% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 3.25% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.25% |
Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 2.44% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.44% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.63% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.63% |
Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 1.63% |
Freshwater | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater | 0.81% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.81% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.81% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.81% |
Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment | 0.81% |
Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 0.81% |
Marine | Environmental → Aquatic → Marine → Wetlands → Sediment → Marine | 0.81% |
Mangrove Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment | 0.81% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.81% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.81% |
Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.81% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.81% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.81% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.81% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.81% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.81% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000241 | Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBB sample SWE 21_20.5m | Environmental | Open in IMG/M |
3300003861 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR | Environmental | Open in IMG/M |
3300004013 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 | Environmental | Open in IMG/M |
3300004073 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_CordB_D2 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
3300005660 | Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB14_precipitate | Engineered | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300005956 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_23-Sept-14 | Environmental | Open in IMG/M |
3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006930 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC | Environmental | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300009075 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300009170 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
3300009455 | Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Crystal Spring | Environmental | Open in IMG/M |
3300009509 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_11 | Environmental | Open in IMG/M |
3300009527 | Groundwater microbial communities from Cold Creek, Nevada to study Microbial Dark Matter (Phase II) - Lower Cold Creek | Environmental | Open in IMG/M |
3300014260 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D1_rd | Environmental | Open in IMG/M |
3300014305 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleB_D1 | Environmental | Open in IMG/M |
3300014306 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLB_D1 | Environmental | Open in IMG/M |
3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
3300022204 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_8_1 | Environmental | Open in IMG/M |
3300022213 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_4_1 | Environmental | Open in IMG/M |
3300022309 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_4_1 | Environmental | Open in IMG/M |
3300024979 | Freshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metagenome 4_LOW4 (SPAdes) | Environmental | Open in IMG/M |
3300025130 | Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Crystal Spring (SPAdes) | Environmental | Open in IMG/M |
3300025539 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Bullhead_CordA_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025953 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D2 (SPAdes) | Environmental | Open in IMG/M |
3300026026 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailB_D2 (SPAdes) | Environmental | Open in IMG/M |
3300026064 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D1 (SPAdes) | Environmental | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026357 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 10-16 PU5 | Environmental | Open in IMG/M |
3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) | Host-Associated | Open in IMG/M |
3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) | Host-Associated | Open in IMG/M |
3300027683 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300027694 | Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB14_bulk (SPAdes) | Engineered | Open in IMG/M |
3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
3300027818 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300027841 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11 (SPAdes) | Environmental | Open in IMG/M |
3300027877 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
3300027885 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes) | Environmental | Open in IMG/M |
3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
3300027956 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Host-Associated | Open in IMG/M |
3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
3300033406 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_CT | Environmental | Open in IMG/M |
3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
3300033413 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT | Environmental | Open in IMG/M |
3300033416 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_C | Environmental | Open in IMG/M |
3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
3300033434 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_CT_b | Environmental | Open in IMG/M |
3300033481 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CT | Environmental | Open in IMG/M |
3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
3300033485 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_A | Environmental | Open in IMG/M |
3300033487 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_A | Environmental | Open in IMG/M |
3300033488 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_C | Environmental | Open in IMG/M |
3300033493 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D3_A | Environmental | Open in IMG/M |
3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
3300034054 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A3A4.1 | Engineered | Open in IMG/M |
3300034055 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A3A4.2 | Engineered | Open in IMG/M |
3300034075 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A4A4.2 | Engineered | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
GPIPI_00729250 | 2088090014 | Soil | GLAAAFAALGVDMSTAKKFGPIVIDYVREHGGEDLVEKMRVALKV |
BS_KBA_SWE21_205mDRAFT_100760342 | 3300000241 | Marine | WAGLAASFTELGIPIDTARKFGPIVIDYVEHHGGEDLVDKIKDALGL* |
Ga0031654_101357192 | 3300003861 | Freshwater Lake Sediment | WAGLAASFTELGVDIDTAKKFGPIVIEYVRKHGGENLVDKMRTALRI* |
Ga0055465_103183491 | 3300004013 | Natural And Restored Wetlands | WAGLAASFTELGVDMDTAKKFGPIVMEHVRKHGGEDLLGKLKGALKL* |
Ga0055516_100897351 | 3300004073 | Natural And Restored Wetlands | PGRWAGLAASFTELGVDLDTAKKFGPIVIDYVKHHGGEDIVDKLRTALKL* |
Ga0062593_1020278661 | 3300004114 | Soil | ASFSELGVDLTTAKKFGPIVIDYVREHGGADLVTKMKTALKL* |
Ga0070669_1001763323 | 3300005353 | Switchgrass Rhizosphere | GLAASFAELGVDVETAKKFGPIVMEHVRKHGGEELLGKLKGALKL* |
Ga0073904_102377421 | 3300005660 | Activated Sludge | AELGVDIDTAKKFGPIVIEHVREHGGEDLVDKIRVALNV* |
Ga0068866_109068272 | 3300005718 | Miscanthus Rhizosphere | DLTTAKKFGPIVIDYVREHGGADLVTKMKTALKL* |
Ga0068862_1007564651 | 3300005844 | Switchgrass Rhizosphere | GRWAGLAASFSELGMDLTTAKKFGPIVIDYVREQGGAELVAKLKTALKL* |
Ga0073920_10350901 | 3300005956 | Sand | GRWAGLAASFAELGVDIPTAKKFGPIVIDYVAEHGGEDLVEKIRDALKI* |
Ga0079037_1004953091 | 3300006224 | Freshwater Wetlands | SFTELGVDLDTARKFGPIVIDYVAHHGGENLVQKMRTALKL* |
Ga0079037_1012191452 | 3300006224 | Freshwater Wetlands | LAASFAELGVDLDTAKKFGPIVIDYVKHHGGEDIVDKMKVALKI* |
Ga0079037_1019839021 | 3300006224 | Freshwater Wetlands | ASFAELGVDLDTAKKFGPIVIDYVKHHGGEDIVDKMKVALKL* |
Ga0075421_1012788461 | 3300006845 | Populus Rhizosphere | LGVDVETAKKFGPIVMEHVRKHGGEELLGKLKGALKL* |
Ga0075430_1005844322 | 3300006846 | Populus Rhizosphere | AELGVDVETAKKFGPIVMEHVRKHGGEELLGKLKGALKL* |
Ga0075431_1004598271 | 3300006847 | Populus Rhizosphere | SFAELGVDVETAKKFGPIVMEHVRKHGGEELLGKLKGALKL* |
Ga0079303_102132831 | 3300006930 | Deep Subsurface | LGVDIPTAKKFGPIVIDYVAEHGGEDLVDKIREALKI* |
Ga0075419_108697332 | 3300006969 | Populus Rhizosphere | VDVETAKKFGPIVMEHVRKHGGEELLGKLKGALKL* |
Ga0105090_108920312 | 3300009075 | Freshwater Sediment | PGRWAGLAASFTELGIDLDTAKKFGPIVIDYVRHHGGENLVGKMRSALKL* |
Ga0105106_112888672 | 3300009078 | Freshwater Sediment | VDIDTAKKFGPIIIEHVRQHGGEDLVEKIRVALKV* |
Ga0105098_106029761 | 3300009081 | Freshwater Sediment | LGVDLDTAKKFGPIVIDYVKHHGGEEIVDKMKFALKI* |
Ga0105098_107522831 | 3300009081 | Freshwater Sediment | GVDLDTAKKFGPIVIDYVKHHGGEDIVDKMKAALKL* |
Ga0105099_103789162 | 3300009082 | Freshwater Sediment | VDINTAKKFGPIIIEHVRQHGGEDLVEKIRVALKI* |
Ga0105103_109351541 | 3300009085 | Freshwater Sediment | IDLDTAKKFGPIVIDYVRHHGGENLVGKMRTALKL* |
Ga0102851_105502551 | 3300009091 | Freshwater Wetlands | GLAASFTELGIDLDTAKKFGPIVIDYVRHHGGENLVGKMRSALKL* |
Ga0102851_106350392 | 3300009091 | Freshwater Wetlands | GVDLDTAKKFGPIVIDYVRQHGGEDLVDEIRTALRI* |
Ga0102851_108797512 | 3300009091 | Freshwater Wetlands | FAELGVDIPTAKKFGPIVIDYVAEHGGEDLVEKIRDALKI* |
Ga0102851_109324372 | 3300009091 | Freshwater Wetlands | FTELGVDLDTAKKFGPIVIDYVEHHGGEGIVDQIKAALKI* |
Ga0102851_118952903 | 3300009091 | Freshwater Wetlands | ELGVDIDTAKKFGPIVIDYVRHHGGENLVKQMRAALKL* |
Ga0102851_132318231 | 3300009091 | Freshwater Wetlands | AASFTELGVDLTTAKKFGPIVIDYVAHHGGEDLVDKIKAALKL* |
Ga0115026_100371553 | 3300009111 | Wetland | WAGLAASFTELGVDIDTAKKFGPIVIDYVRHHGGENLVDKIRAALNI* |
Ga0115026_101407962 | 3300009111 | Wetland | ELGVDIPTAKKFGPIVIDYVAEHGGEDLVEKIRDALKI* |
Ga0115026_110521531 | 3300009111 | Wetland | LGVDLTTAKKFGPIVIDYVAHHGGEDLVDKIKAALKL* |
Ga0113563_121777002 | 3300009167 | Freshwater Wetlands | GIDLKTAKKFGPIVIDYVAHHGGEDLVDKIKVALKL* |
Ga0105097_100554231 | 3300009169 | Freshwater Sediment | RWAGLAASFAELGVDIDTAKKFGPIVIEHVREHGGEDLVDKIRVALNVNV* |
Ga0105097_100657812 | 3300009169 | Freshwater Sediment | VDLGTAKKFGPIVIDYVAHHGGEDLVEKMKAALKL* |
Ga0105097_100850271 | 3300009169 | Freshwater Sediment | AGLAASFTELGVDIDTAKKFGPIVIDYVRHHGGENLVKQMRTALKL* |
Ga0105097_102313502 | 3300009169 | Freshwater Sediment | AAAVTELGVDLDTAKKFGPIVIDFVSHHGGEDIVDKMKSALKI* |
Ga0105097_108101952 | 3300009169 | Freshwater Sediment | GRWAGLAASFAELGVDLDTAKKFGPIVIDYVKHHGGEEIVDKMKVALKI* |
Ga0105096_101951191 | 3300009170 | Freshwater Sediment | AGRWAGLAASFTELGVDLNTAKKFGPIIIEHVRQHGGEDLVDKIKVALRI* |
Ga0115028_101398861 | 3300009179 | Wetland | LAASFAELGVDIDTAKKFGPIVIEHVREHGGEDLVDKIRVALRI* |
Ga0115028_102517932 | 3300009179 | Wetland | GLAASFTELGIDLDTAKKFGPIVIDYVRHHGGENLVGKMRAALKL* |
Ga0114939_102289541 | 3300009455 | Groundwater | GLAASFTELGVDLTTAKKFGPIVIDYVAHHGGEDLVDKIKAALKL* |
Ga0114939_102292071 | 3300009455 | Groundwater | GLAASFTELGVDLTTAKKFGPIVIDYVAHHGGEDLVDKIKAALRL* |
Ga0123573_107032481 | 3300009509 | Mangrove Sediment | SFTEIGVDLDTAKKFGPIVIDYVKHHGGEDIVDKMKAALKI* |
Ga0114942_10986371 | 3300009527 | Groundwater | LAELGVDIDTAKKFGPIVIEHVRQHGGEDLVDKIRVALKV* |
Ga0075307_10086371 | 3300014260 | Natural And Restored Wetlands | PIDTAKKFGPIVIDYVEHHGGEDLVDKIKDALGL* |
Ga0075349_11507122 | 3300014305 | Natural And Restored Wetlands | SFTELGIPISTAKKFGPIVIDYVEHHGGEDLVDKIKDALGLQA* |
Ga0075346_10500441 | 3300014306 | Natural And Restored Wetlands | FTELGVDIDTAKKFGPIVIDYVRHHGGENLVKQMRAALKV* |
Ga0207193_17356932 | 3300020048 | Freshwater Lake Sediment | XXXLKTAKKFGPIVIDYVAHHGGEDLVDKIKVALKL |
Ga0210379_104360072 | 3300021081 | Groundwater Sediment | TFTELGVDLDTAKKFGPIVMEHVREHGGEDLLDKLKVALKL |
Ga0224496_104635361 | 3300022204 | Sediment | WAGLAASFTELGVDLDTAKKFGPIVIDYVKHHGGEDIVDKLRTALKL |
Ga0224500_100850092 | 3300022213 | Sediment | WAVLAASFAELGVDIDTAKKFGPIVIEHVREHGGEDLVEKIRVALKV |
Ga0224510_102229221 | 3300022309 | Sediment | LAASFAELGVDIDTAKKFGPIVIEHVREHGGEDLVEKIRVALKV |
Ga0208115_10746501 | 3300024979 | Freshwater | GIPIATAKKFGPIVIDYVGHHGGEDLVDKIKEALGL |
Ga0209594_12121941 | 3300025130 | Groundwater | FTELGVDLDTAKKFGPIVIDYVAHHGGEDLVDKIRAALKL |
Ga0210109_10605211 | 3300025539 | Natural And Restored Wetlands | GVDLDTAKKFGPIVIDYVKHHGGEDIVDKLRTALKL |
Ga0207690_117398942 | 3300025932 | Corn Rhizosphere | AASFAELGVDVETAKKFGPIVMEHVRKHGGEELLGKLKGALKL |
Ga0210068_10200902 | 3300025953 | Natural And Restored Wetlands | LGVDLDTAKKFGPIVIDYVKHHGGENLVGKMRAALKL |
Ga0210129_10255771 | 3300026026 | Natural And Restored Wetlands | SFTELGIPIDTAKKFGPIVIDYVEHHGGEDLVDKIKDALGL |
Ga0208146_10278382 | 3300026064 | Natural And Restored Wetlands | SFTELGVDLDTAKKFGPIVIDYVAHHGGEDLVDKIRSALKI |
Ga0207641_121208152 | 3300026088 | Switchgrass Rhizosphere | FTELGVDLATAKKFRPIVIDYVRTHGGEDLVDKIRTALKL |
Ga0207675_1014438272 | 3300026118 | Switchgrass Rhizosphere | AGRWAGLAASFSELGVDLTTAKKFGPIVIDYVREHGGADLVTKMKTALKL |
Ga0207683_101914584 | 3300026121 | Miscanthus Rhizosphere | AASFSELGVDLTTAKKFGPIVIDYVREHGGADLVTKMKTALKL |
Ga0256810_10071863 | 3300026357 | Sediment | SPGRWAGLAASFTELGVPIETAKKFGPIVIDYVAEHGGEDLVDKIRAALKI |
Ga0209999_10436152 | 3300027543 | Arabidopsis Thaliana Rhizosphere | VDVETAKKFGPIVMEHVRKHGGEELLGKLKGALKL |
Ga0209982_10157643 | 3300027552 | Arabidopsis Thaliana Rhizosphere | ELAEQVAELGVDVETAKKFGPIVMEHVRKHGGEELLGKLKGALKL |
Ga0209392_10963601 | 3300027683 | Freshwater Sediment | AGLAASFTELGVDLSTAKKFGPIVIDYVAHHGGEDLVEKMKAALKL |
Ga0209704_11285412 | 3300027693 | Freshwater Sediment | VDINTAKKFGPIIIEHVRQHGGEDLVEKIRVALKV |
Ga0209170_11686892 | 3300027694 | Activated Sludge | RWAGLAASFAELGVDIDTAKKFGPIVIEHVREHGGEDLVDKIRVALNV |
Ga0209492_10532631 | 3300027721 | Freshwater Sediment | SFTELGVDIDTAKKFGPIVIDYVRHHGGENLVKQMRSALKI |
Ga0209229_104268122 | 3300027805 | Freshwater And Sediment | SFAELGVDIDTAKKFGPIVIEHVREHGGEDLVDKIRVALNVNV |
Ga0209706_102113572 | 3300027818 | Freshwater Sediment | SFTELGVDLDTAKKFGPIVIDFVSHHGGEDIVDKMKSALKI |
Ga0209262_103169261 | 3300027841 | Freshwater | PGRWAGLAASFAELGVDIPTAKKFGPIVIDYVAEHGGEDLVEKIRDALKI |
Ga0209293_102664091 | 3300027877 | Wetland | SPGRWAGLAASFAELGVDLDTAKKFGPIVIDYVKHHGGEDIVDKMKVALKI |
Ga0209293_103094711 | 3300027877 | Wetland | ELGVDIPTAKKFGPIVIDYVAEHGGEDLVEKIRDALKI |
Ga0209450_103526902 | 3300027885 | Freshwater Lake Sediment | RWAGLAASFTELGIDLDTAKKFGPIVIDYVRHHGGENLVGKMRAALKL |
Ga0209668_100427411 | 3300027899 | Freshwater Lake Sediment | GRWAGLAATFTELGVDLDTARKFGPIVIDFMKEHGGENLVDKVRTALKV |
Ga0209668_102298991 | 3300027899 | Freshwater Lake Sediment | SPGRWAGLAASFAELGVDIPTAKKFGPIVIDYVAEHGGEDLVEKIRDALKI |
Ga0209668_104631422 | 3300027899 | Freshwater Lake Sediment | TELGVDLDTAKKFGPIVIDYVEHHGGEGIVDQIKAALKI |
Ga0209820_10671252 | 3300027956 | Freshwater Sediment | GRWAGLAASFAELGVDLDTAKKFGPIVIDYVKHHGGEDIVDKMKVALKL |
Ga0316575_100168323 | 3300031665 | Rhizosphere | FSELGIDLATAKKFGPIVIDYVEHHGGEEIVDKMKVALKL |
Ga0307412_109302781 | 3300031911 | Rhizosphere | ASFYELGIDLQTARQFGPIVIDYVREHGGTDLVDKLRAALKP |
Ga0315283_101057094 | 3300032164 | Sediment | AASFAELGVDIDTAKKFGPIVIEHVRQHGGEDLVDKIRVALRI |
Ga0315276_103671773 | 3300032177 | Sediment | GLAASFTELGIPLDTAKKFGPIVIDYVAHHGGEDLVDKIKYALGL |
Ga0315271_102734281 | 3300032256 | Sediment | GVDLDTAKKFGPIVIDFMKEHGGENLVDKVRVALKV |
Ga0315287_107877474 | 3300032397 | Sediment | WAGLAASFTELGIPLDTAKKFGPIVIDYVAHHGGEDLVDKIKDALGL |
Ga0315273_100780675 | 3300032516 | Sediment | AASFAELGVDIDTAKKFGPIVIEHVREHGGEDLVDKIRVALKI |
Ga0315273_111547592 | 3300032516 | Sediment | PGRWAGLAASFAELGVDIPTAKKFGPIVIDYVAEHGGEDLVDKIRDALKI |
Ga0315273_130616982 | 3300032516 | Sediment | GRWAGLAAAFAELGVDIDTAKKFGPIVIEHVREHGGEDLVDKIRVALKV |
Ga0316604_107217661 | 3300033406 | Soil | TELGVDLDTAKKFGPIVIDYVRQHGGEDLVDEIRTALKI |
Ga0316605_110669122 | 3300033408 | Soil | VDLDTAKKFGPIVIDYVEHHGGEGIVDQIKAALKI |
Ga0316605_116484992 | 3300033408 | Soil | AGLAASFTELGVDIETAKKFGPIVIDYVRHHGGENLVKQMRAALKL |
Ga0316603_123233172 | 3300033413 | Soil | SFTELGVDIDTAKKFGPIVIDYVRHHGGENLVKQMRAALKL |
Ga0316603_123431962 | 3300033413 | Soil | ASFTELGVDLTTAKKFGPIVIDYVAHHGGEDLVDKIKAALKL |
Ga0316622_1019865101 | 3300033416 | Soil | AGLAASFTELGVDLNTAKKFGPIIIEHVRQHGGEDLVDKIKVALRI |
Ga0316601_1002358663 | 3300033419 | Soil | GRWAGLAASFTELGVDLDTAKKFGPIVIDYVEHHGGEGIVDQIKAALKI |
Ga0316601_1004609712 | 3300033419 | Soil | ELGIDLDTAKKFGPIVIDYVRHHGGENLVGKMRAALKL |
Ga0316601_1011325852 | 3300033419 | Soil | ELGVDVDTAKKFGPIVIEYVREHGGENLVEKIRAALKL |
Ga0316601_1016435222 | 3300033419 | Soil | GVDLETARKFGPIVIEYVRQHGGEDLVEKMRVALKV |
Ga0316601_1026216102 | 3300033419 | Soil | AGLAASFTELGVDLDTAKKFGPIVIDYVRHHGGEDLVDEIRTALKI |
Ga0316613_107974781 | 3300033434 | Soil | GLAASFTELGVDLTTAKKFGPIVIDYVAHHGGEDLVDKIKAALKL |
Ga0316613_108026831 | 3300033434 | Soil | LGVDLDTAKKFGPIVIDYVEHHGGEGIVDQIKAALKI |
Ga0316600_104374191 | 3300033481 | Soil | VDIPTAKKFGPIVIDYVAEHGGEDLVEKIRDALKI |
Ga0316600_109877441 | 3300033481 | Soil | FTELGVDLNTAKKFGPIVIDYVKHHGGEDLVDKMKVALKL |
Ga0316627_1004182733 | 3300033482 | Soil | FTELGVDLDTARKFGPIVIDYVAHHGGENLVQKMRTALKL |
Ga0316627_1029466392 | 3300033482 | Soil | SFTELGVDLDTAKKFGPIVIEYVKQHGGEDLVDEIRTALKI |
Ga0316626_104960581 | 3300033485 | Soil | GLAASFTELGVDLDTARKFGPIVIDYVAHHGGENLVQKMRTALKL |
Ga0316626_106326121 | 3300033485 | Soil | GVDLDTAKKFGPIVIDYVEHHGGEGIVDQIKAALKI |
Ga0316626_111904462 | 3300033485 | Soil | FTELGVDLDTAKKFGPIVIDYVKQHGGEGLVDEIRTALKI |
Ga0316626_112846801 | 3300033485 | Soil | AELGVDIDTAKKFGPIVIEHVRQHGGEDLVDKIRVALKV |
Ga0316630_115284071 | 3300033487 | Soil | GVDLDTARQFGPIVIDYVKHHGGEDIVDKMKAALKI |
Ga0316621_112098022 | 3300033488 | Soil | VDLDTAKKFGPIVIDYVRHHGGENLVDKMRTALKL |
Ga0316631_104717512 | 3300033493 | Soil | WASLAASFTELGVDIDTAKKFGPIVIDYVKHHGGEDIVDKMKAALKI |
Ga0316616_1004795831 | 3300033521 | Soil | SFTELGVDLDTARKFGPIVIDYVAHHGGENLVQKMRTALKL |
Ga0316617_1004255992 | 3300033557 | Soil | RWAGLAASFTELGVDLDTAKKFGPIVIDYVEHHGGEGIVDQIKAALKI |
Ga0316617_1022640652 | 3300033557 | Soil | PGRWAGLAASFTELGIDLKTAKKFGPIVIDYVAHHGGEDLVDKIKVALKL |
Ga0373891_082200_379_537 | 3300034054 | Sediment Slurry | NSPVRWAGLAASFTELGVDLSTAKKFGPIVIDYVAHHGGEDLVEKMKAALKL |
Ga0373892_019942_673_822 | 3300034055 | Sediment Slurry | GRWAGLAASFTELGVDLKTAKKFGPIVIDYVAHHGGEDLVDKIKAALKL |
Ga0373892_041774_460_603 | 3300034055 | Sediment Slurry | WAGLAASFTELGVDLDTARKFGPIVIEHVRQHGGEDLVEKIKVALKI |
Ga0373892_043409_2_115 | 3300034055 | Sediment Slurry | LGVDIPTAKKFGPIVIDYVAEHGGEDLVEKIRDALKI |
Ga0373895_056827_1_138 | 3300034075 | Sediment Slurry | GLAASFTELGVDLTPAKKFGPIVIDYVAHHGGEDLVDKIKAALKL |
⦗Top⦘ |