| Basic Information | |
|---|---|
| Family ID | F069498 |
| Family Type | Metagenome |
| Number of Sequences | 124 |
| Average Sequence Length | 43 residues |
| Representative Sequence | GVIEVDAFDEMFGKPDDEPEPTPEQGGMSLEQLMGGGEDEA |
| Number of Associated Samples | 88 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 2.42 % |
| % of genes near scaffold ends (potentially truncated) | 96.77 % |
| % of genes from short scaffolds (< 2000 bps) | 95.97 % |
| Associated GOLD sequencing projects | 78 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.25 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (61.290 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake (44.355 % of family members) |
| Environment Ontology (ENVO) | Unclassified (58.065 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Hypersaline (saline) (71.774 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 24.64% β-sheet: 0.00% Coil/Unstructured: 75.36% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.25 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 124 Family Scaffolds |
|---|---|---|
| PF01555 | N6_N4_Mtase | 37.90 |
| PF05869 | Dam | 8.06 |
| PF04233 | Phage_Mu_F | 7.26 |
| PF09979 | DUF2213 | 3.23 |
| PF01170 | UPF0020 | 1.61 |
| PF13262 | DUF4054 | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
|---|---|---|---|
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 39.52 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 37.90 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 37.90 |
| COG0116 | 23S rRNA G2445 N2-methylase RlmL | Translation, ribosomal structure and biogenesis [J] | 1.61 |
| COG0286 | Type I restriction-modification system, DNA methylase subunit | Defense mechanisms [V] | 1.61 |
| COG1092 | 23S rRNA G2069 N7-methylase RlmK or C1962 C5-methylase RlmI | Translation, ribosomal structure and biogenesis [J] | 1.61 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 1.61 |
| COG2263 | Predicted RNA methylase | General function prediction only [R] | 1.61 |
| COG2264 | Ribosomal protein L11 methylase PrmA | Translation, ribosomal structure and biogenesis [J] | 1.61 |
| COG2265 | tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD family | Translation, ribosomal structure and biogenesis [J] | 1.61 |
| COG2813 | 16S rRNA G1207 or 23S rRNA G1835 methylase RsmC/RlmG | Translation, ribosomal structure and biogenesis [J] | 1.61 |
| COG2890 | Methylase of polypeptide chain release factors | Translation, ribosomal structure and biogenesis [J] | 1.61 |
| COG4123 | tRNA1(Val) A37 N6-methylase TrmN6 | Translation, ribosomal structure and biogenesis [J] | 1.61 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 61.29 % |
| All Organisms | root | All Organisms | 37.90 % |
| Polyangium | genus | Polyangium | 0.81 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2084038011|ADL24m1u_contig06401 | Not Available | 803 | Open in IMG/M |
| 2084038019|ADL5mRS1u_contig07809 | Not Available | 581 | Open in IMG/M |
| 2100351014|ADL13m1u_contig04491__length_1027___numreads_16 | All Organisms → Viruses → Predicted Viral | 1027 | Open in IMG/M |
| 2100351014|ADL13m1u_GQIGRQ001DM1JH | Not Available | 507 | Open in IMG/M |
| 2140918027|contig14324 | Not Available | 697 | Open in IMG/M |
| 3300000405|LV_Brine_h2_0102DRAFT_1029812 | All Organisms → Viruses → Predicted Viral | 1008 | Open in IMG/M |
| 3300000405|LV_Brine_h2_0102DRAFT_1030711 | Not Available | 989 | Open in IMG/M |
| 3300000525|JGI1221J11331_1010257 | Not Available | 2539 | Open in IMG/M |
| 3300000525|JGI1221J11331_1053847 | All Organisms → Viruses | 760 | Open in IMG/M |
| 3300000525|JGI1221J11331_1072316 | Not Available | 608 | Open in IMG/M |
| 3300001097|JGIcombinedJ13537_10029021 | Not Available | 1582 | Open in IMG/M |
| 3300001097|JGIcombinedJ13537_10048013 | Not Available | 1090 | Open in IMG/M |
| 3300001097|JGIcombinedJ13537_10133067 | Not Available | 514 | Open in IMG/M |
| 3300005273|Ga0065697_1001735 | Not Available | 687 | Open in IMG/M |
| 3300005917|Ga0075115_10109497 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
| 3300005918|Ga0075116_10268634 | Not Available | 626 | Open in IMG/M |
| 3300005919|Ga0075114_10193038 | Not Available | 730 | Open in IMG/M |
| 3300005928|Ga0075105_1024086 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanosarcinales → unclassified Methanosarcinales → Methanosarcinales archaeon | 670 | Open in IMG/M |
| 3300005929|Ga0075107_1014042 | All Organisms → Viruses → Predicted Viral | 1080 | Open in IMG/M |
| 3300005929|Ga0075107_1028385 | Not Available | 665 | Open in IMG/M |
| 3300005930|Ga0075106_1032415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. NZP2298 | 840 | Open in IMG/M |
| 3300005935|Ga0075125_10313463 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300005935|Ga0075125_10426603 | Not Available | 507 | Open in IMG/M |
| 3300005936|Ga0075124_10102273 | All Organisms → Viruses → Predicted Viral | 1105 | Open in IMG/M |
| 3300011170|Ga0136570_112460 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanosarcinales → unclassified Methanosarcinales → Methanosarcinales archaeon | 676 | Open in IMG/M |
| 3300011177|Ga0136574_117496 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanosarcinales → unclassified Methanosarcinales → Methanosarcinales archaeon | 735 | Open in IMG/M |
| 3300011181|Ga0136607_1030573 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanosarcinales → unclassified Methanosarcinales → Methanosarcinales archaeon | 659 | Open in IMG/M |
| 3300011185|Ga0136597_1011756 | Polyangium → Polyangium spumosum | 2114 | Open in IMG/M |
| 3300011185|Ga0136597_1025526 | Not Available | 1271 | Open in IMG/M |
| 3300011189|Ga0136558_1151569 | Not Available | 542 | Open in IMG/M |
| 3300012026|Ga0136576_1009026 | All Organisms → Viruses → Predicted Viral | 1058 | Open in IMG/M |
| 3300012030|Ga0136599_1040851 | Not Available | 662 | Open in IMG/M |
| 3300012031|Ga0136561_1035717 | Not Available | 797 | Open in IMG/M |
| 3300012033|Ga0136589_1086503 | Not Available | 769 | Open in IMG/M |
| 3300012104|Ga0136567_1013583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. NZP2298 | 829 | Open in IMG/M |
| 3300012108|Ga0136562_125109 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanosarcinales → unclassified Methanosarcinales → Methanosarcinales archaeon | 528 | Open in IMG/M |
| 3300012115|Ga0136592_1014644 | Not Available | 757 | Open in IMG/M |
| 3300012128|Ga0136582_1027921 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 728 | Open in IMG/M |
| 3300012147|Ga0136588_1051270 | Not Available | 668 | Open in IMG/M |
| 3300012170|Ga0136598_1086497 | Not Available | 636 | Open in IMG/M |
| 3300012250|Ga0136573_119000 | All Organisms → Viruses | 602 | Open in IMG/M |
| 3300012261|Ga0136563_125852 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanosarcinales → unclassified Methanosarcinales → Methanosarcinales archaeon | 566 | Open in IMG/M |
| 3300012263|Ga0136564_1016836 | All Organisms → Viruses | 899 | Open in IMG/M |
| 3300012270|Ga0136604_1053398 | Not Available | 915 | Open in IMG/M |
| 3300012271|Ga0136555_1040511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia caballeronis | 1038 | Open in IMG/M |
| 3300012271|Ga0136555_1055471 | Not Available | 876 | Open in IMG/M |
| 3300022846|Ga0222699_1020824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → unclassified Marinobacter → Marinobacter sp. | 1319 | Open in IMG/M |
| 3300022846|Ga0222699_1044314 | Not Available | 755 | Open in IMG/M |
| 3300022856|Ga0222671_1035807 | Not Available | 962 | Open in IMG/M |
| 3300022860|Ga0222698_1028027 | All Organisms → cellular organisms → Bacteria | 1104 | Open in IMG/M |
| 3300022860|Ga0222698_1029383 | Not Available | 1067 | Open in IMG/M |
| 3300022871|Ga0222628_1045262 | Not Available | 734 | Open in IMG/M |
| 3300022882|Ga0222626_1022235 | All Organisms → cellular organisms → Bacteria | 1195 | Open in IMG/M |
| 3300022887|Ga0222642_1034733 | All Organisms → cellular organisms → Bacteria | 1030 | Open in IMG/M |
| 3300023227|Ga0222690_1012528 | Not Available | 1159 | Open in IMG/M |
| 3300023244|Ga0222627_1024465 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
| 3300023244|Ga0222627_1028689 | Not Available | 941 | Open in IMG/M |
| 3300023253|Ga0222695_1023459 | All Organisms → cellular organisms → Bacteria | 1094 | Open in IMG/M |
| 3300023299|Ga0222702_1090958 | Not Available | 593 | Open in IMG/M |
| 3300023299|Ga0222702_1107734 | Not Available | 527 | Open in IMG/M |
| 3300023301|Ga0209414_1005048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 5477 | Open in IMG/M |
| 3300023301|Ga0209414_1079464 | Not Available | 825 | Open in IMG/M |
| 3300023301|Ga0209414_1094951 | Not Available | 719 | Open in IMG/M |
| 3300025351|Ga0208135_113967 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanosarcinales → unclassified Methanosarcinales → Methanosarcinales archaeon | 655 | Open in IMG/M |
| 3300025352|Ga0207995_110785 | All Organisms → Viruses | 954 | Open in IMG/M |
| 3300025362|Ga0208647_1022427 | Not Available | 772 | Open in IMG/M |
| 3300025362|Ga0208647_1042363 | Not Available | 501 | Open in IMG/M |
| 3300025380|Ga0208901_1016412 | Not Available | 1114 | Open in IMG/M |
| 3300025380|Ga0208901_1051307 | Not Available | 540 | Open in IMG/M |
| 3300025433|Ga0208900_1031955 | All Organisms → Viruses → Predicted Viral | 1052 | Open in IMG/M |
| 3300025433|Ga0208900_1055392 | Not Available | 677 | Open in IMG/M |
| 3300025433|Ga0208900_1064139 | Not Available | 602 | Open in IMG/M |
| 3300025586|Ga0207996_1057315 | Not Available | 1026 | Open in IMG/M |
| 3300025586|Ga0207996_1062868 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
| 3300025628|Ga0208902_1068291 | Not Available | 1043 | Open in IMG/M |
| 3300025642|Ga0208648_1112634 | Not Available | 776 | Open in IMG/M |
| 3300025661|Ga0208905_1077789 | All Organisms → cellular organisms → Bacteria | 1035 | Open in IMG/M |
| 3300025697|Ga0208769_1067075 | Not Available | 1100 | Open in IMG/M |
| 3300025697|Ga0208769_1188229 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300025698|Ga0208771_1065211 | All Organisms → cellular organisms → Bacteria | 1079 | Open in IMG/M |
| 3300025698|Ga0208771_1216969 | Not Available | 507 | Open in IMG/M |
| 3300028345|Ga0306892_116297 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanosarcinales → unclassified Methanosarcinales → Methanosarcinales archaeon | 608 | Open in IMG/M |
| 3300028353|Ga0306902_110669 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanosarcinales → unclassified Methanosarcinales → Methanosarcinales archaeon | 647 | Open in IMG/M |
| 3300028360|Ga0306914_119452 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanosarcinales → unclassified Methanosarcinales → Methanosarcinales archaeon | 663 | Open in IMG/M |
| 3300028372|Ga0306901_1024916 | Not Available | 787 | Open in IMG/M |
| 3300028374|Ga0306906_1009599 | Not Available | 2189 | Open in IMG/M |
| 3300028374|Ga0306906_1021350 | Not Available | 1211 | Open in IMG/M |
| 3300028376|Ga0306912_1036717 | Not Available | 819 | Open in IMG/M |
| 3300028378|Ga0306868_1012882 | All Organisms → Viruses → Predicted Viral | 2312 | Open in IMG/M |
| 3300031209|Ga0307955_1038406 | Not Available | 914 | Open in IMG/M |
| 3300031211|Ga0307974_1050105 | All Organisms → Viruses → Predicted Viral | 1956 | Open in IMG/M |
| 3300031211|Ga0307974_1137623 | Not Available | 799 | Open in IMG/M |
| 3300031212|Ga0307959_1051625 | All Organisms → Viruses → Predicted Viral | 1192 | Open in IMG/M |
| 3300031212|Ga0307959_1156139 | Not Available | 551 | Open in IMG/M |
| 3300031213|Ga0307937_1014444 | All Organisms → Viruses → Predicted Viral | 1961 | Open in IMG/M |
| 3300031213|Ga0307937_1082235 | Not Available | 672 | Open in IMG/M |
| 3300031214|Ga0307958_1024930 | All Organisms → Viruses → Predicted Viral | 1216 | Open in IMG/M |
| 3300031215|Ga0307935_1033912 | Not Available | 927 | Open in IMG/M |
| 3300031215|Ga0307935_1077648 | Not Available | 518 | Open in IMG/M |
| 3300031216|Ga0307980_1042335 | Not Available | 1015 | Open in IMG/M |
| 3300031217|Ga0307940_1098706 | Not Available | 546 | Open in IMG/M |
| 3300031219|Ga0307973_1037763 | Not Available | 713 | Open in IMG/M |
| 3300031220|Ga0307939_1111627 | Not Available | 578 | Open in IMG/M |
| 3300031220|Ga0307939_1129410 | Not Available | 528 | Open in IMG/M |
| 3300031221|Ga0307948_1108152 | Not Available | 928 | Open in IMG/M |
| 3300031221|Ga0307948_1114017 | Not Available | 882 | Open in IMG/M |
| 3300031222|Ga0307972_1185601 | Not Available | 620 | Open in IMG/M |
| 3300031227|Ga0307928_10301554 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Phasmatodea → Verophasmatodea → Areolatae → Bacilloidea → Bacillidae → Bacillinae → Bacillini → Bacillus | 793 | Open in IMG/M |
| 3300031339|Ga0307932_1068627 | Not Available | 944 | Open in IMG/M |
| 3300031339|Ga0307932_1092997 | Not Available | 793 | Open in IMG/M |
| 3300031339|Ga0307932_1179391 | Not Available | 539 | Open in IMG/M |
| 3300031343|Ga0307952_1128357 | Not Available | 683 | Open in IMG/M |
| 3300031382|Ga0307971_1220537 | All Organisms → Viruses | 516 | Open in IMG/M |
| 3300031392|Ga0307975_1054110 | All Organisms → Viruses → Predicted Viral | 1544 | Open in IMG/M |
| 3300031392|Ga0307975_1136477 | Not Available | 849 | Open in IMG/M |
| 3300031392|Ga0307975_1177381 | Not Available | 680 | Open in IMG/M |
| 3300031395|Ga0307957_1062313 | Not Available | 780 | Open in IMG/M |
| 3300031398|Ga0307979_1096163 | Not Available | 667 | Open in IMG/M |
| 3300031399|Ga0307968_1163096 | Not Available | 556 | Open in IMG/M |
| 3300031403|Ga0307933_1177138 | Not Available | 546 | Open in IMG/M |
| 3300031631|Ga0307987_1033408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → unclassified Marinobacter → Marinobacter sp. | 1759 | Open in IMG/M |
| 3300031631|Ga0307987_1093700 | Not Available | 820 | Open in IMG/M |
| 3300031741|Ga0307988_1053054 | All Organisms → Viruses → Predicted Viral | 1056 | Open in IMG/M |
| 3300031741|Ga0307988_1105486 | Not Available | 606 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 44.35% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 36.29% |
| Hypersaline | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline | 13.71% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 3.23% |
| Lake Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Lake Water | 1.61% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2084038011 | Hypersaline microbial communities from Antarctic Deep Lake - 24m 0.1um | Environmental | Open in IMG/M |
| 2084038019 | Hypersaline microbial communities from Antarctic Deep Lake - 5mRS 0.1um | Environmental | Open in IMG/M |
| 2100351014 | Hypersaline microbial communities from Antarctic Deep Lake - 13m 0.1um | Environmental | Open in IMG/M |
| 2140918027 | Hypersaline microbial communities from Antarctic Deep Lake - 36m 3.0um, 0.8um, 0.1um pool | Environmental | Open in IMG/M |
| 3300000405 | Hypersaline microbial communities from Lake Vida, Antarctica - sample: Brine Hole Two 0.1-0.2 micron | Environmental | Open in IMG/M |
| 3300000525 | Hypersaline microbial communities from Lake Vida, Antarctica - Brine Hole Two >0.2 micron | Environmental | Open in IMG/M |
| 3300001097 | Saline microbial communities from Lake Vida, Antarctica (Lake Vida Brine Hole Two - Combined Assembly 2 samples, Mar 2013 Assem) | Environmental | Open in IMG/M |
| 3300005273 | Hypersaline microbial communities from Antarctic Deep Lake - 24m 0.8um | Environmental | Open in IMG/M |
| 3300005917 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKH | Environmental | Open in IMG/M |
| 3300005918 | Saline lake microbial communities from Ace Lake, Antarctica- Antarctic Ace Lake Metagenome 02UKC | Environmental | Open in IMG/M |
| 3300005919 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKM | Environmental | Open in IMG/M |
| 3300005928 | Saline lake microbial communities from Deep Lake, Antarctica - Antarctic Deep Lake Metagenome 02WF5 | Environmental | Open in IMG/M |
| 3300005929 | Saline lake microbial communities from Deep Lake, Antarctica - Antarctic Deep Lake Metagenome 022AM | Environmental | Open in IMG/M |
| 3300005930 | Saline lake microbial communities from Deep Lake, Antarctica - Antarctic Deep Lake Metagenome 02WF4 | Environmental | Open in IMG/M |
| 3300005935 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKN | Environmental | Open in IMG/M |
| 3300005936 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKS | Environmental | Open in IMG/M |
| 3300011170 | Saline lake microbial communities from Deep lake, Antarctica - Metagenome #51 | Environmental | Open in IMG/M |
| 3300011177 | Saline lake microbial communities from Deep lake, Antarctica - Metagenome #134 | Environmental | Open in IMG/M |
| 3300011181 | Saline lake microbial communities from Deep Lake, Antarctica - Metagenome #681 | Environmental | Open in IMG/M |
| 3300011185 | Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Torckler E11 #898 | Environmental | Open in IMG/M |
| 3300011189 | Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Torckler E6 #833 | Environmental | Open in IMG/M |
| 3300012026 | Saline lake microbial communities from Deep lake, Antarctica - Metagenome #138 | Environmental | Open in IMG/M |
| 3300012030 | Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Filla 2 #697 | Environmental | Open in IMG/M |
| 3300012031 | Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Hop E1 #498 | Environmental | Open in IMG/M |
| 3300012033 | Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Filla 3 #764 | Environmental | Open in IMG/M |
| 3300012104 | Saline lake microbial communities from Deep lake, Antarctica - Metagenome #3 | Environmental | Open in IMG/M |
| 3300012108 | Saline lake microbial communities from Club lake, Antarctica - Metagenome #312 | Environmental | Open in IMG/M |
| 3300012115 | Saline lake microbial communities from Deep Lake, Antarctica - Metagenome TFF #256 | Environmental | Open in IMG/M |
| 3300012128 | Saline lake microbial communities from Deep lake, Antarctica - Metagenome #293 | Environmental | Open in IMG/M |
| 3300012147 | Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Filla 1 #564 | Environmental | Open in IMG/M |
| 3300012170 | Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Torckler E11 #899 | Environmental | Open in IMG/M |
| 3300012250 | Saline lake microbial communities from Deep lake, Antarctica - Metagenome #85 | Environmental | Open in IMG/M |
| 3300012261 | Saline lake microbial communities from Club lake, Antarctica - Metagenome #315 | Environmental | Open in IMG/M |
| 3300012263 | Saline lake microbial communities from Club lake, Antarctica - Metagenome #318 | Environmental | Open in IMG/M |
| 3300012270 | Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Filla E10 #628 | Environmental | Open in IMG/M |
| 3300012271 | Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Torckler E5 #432 | Environmental | Open in IMG/M |
| 3300022846 | Saline water microbial communities from Ace Lake, Antarctica - #1452 | Environmental | Open in IMG/M |
| 3300022856 | Saline water microbial communities from Ace Lake, Antarctica - #797 | Environmental | Open in IMG/M |
| 3300022860 | Saline water microbial communities from Ace Lake, Antarctica - #1450 | Environmental | Open in IMG/M |
| 3300022871 | Saline water microbial communities from Ace Lake, Antarctica - #95 | Environmental | Open in IMG/M |
| 3300022882 | Saline water microbial communities from Ace Lake, Antarctica - #91 | Environmental | Open in IMG/M |
| 3300022887 | Saline water microbial communities from Ace Lake, Antarctica - #229 | Environmental | Open in IMG/M |
| 3300023227 | Saline water microbial communities from Ace Lake, Antarctica - #1234 | Environmental | Open in IMG/M |
| 3300023244 | Saline water microbial communities from Ace Lake, Antarctica - #93 | Environmental | Open in IMG/M |
| 3300023253 | Saline water microbial communities from Ace Lake, Antarctica - #1398 | Environmental | Open in IMG/M |
| 3300023299 | Saline water microbial communities from Ace Lake, Antarctica - #1504 | Environmental | Open in IMG/M |
| 3300023301 | Hypersaline microbial communities from Lake Vida, Antarctica - Brine Hole Two >0.2 micron (SPAdes) | Environmental | Open in IMG/M |
| 3300025351 | Saline lake microbial communities from Deep Lake, Antarctica - Antarctic Deep Lake Metagenome 02WF5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025352 | Saline lake microbial communities from Deep Lake, Antarctica - Antarctic Deep Lake Metagenome 022AM (SPAdes) | Environmental | Open in IMG/M |
| 3300025362 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKA (SPAdes) | Environmental | Open in IMG/M |
| 3300025380 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKF (SPAdes) | Environmental | Open in IMG/M |
| 3300025433 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKK (SPAdes) | Environmental | Open in IMG/M |
| 3300025586 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKG (SPAdes) | Environmental | Open in IMG/M |
| 3300025628 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKH (SPAdes) | Environmental | Open in IMG/M |
| 3300025642 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKL (SPAdes) | Environmental | Open in IMG/M |
| 3300025661 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKS (SPAdes) | Environmental | Open in IMG/M |
| 3300025697 | Saline lake microbial communities from Ace Lake, Antarctica- Antarctic Ace Lake Metagenome 02UKC (SPAdes) | Environmental | Open in IMG/M |
| 3300025698 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKX (SPAdes) | Environmental | Open in IMG/M |
| 3300028345 | Saline lake microbial communities from Deep lake, Antarctica - Metagenome #290 (v2) | Environmental | Open in IMG/M |
| 3300028353 | Saline lake microbial communities from Deep Lake, Antarctica - Metagenome TFF #256 (v2) | Environmental | Open in IMG/M |
| 3300028360 | Saline lake microbial communities from Deep Lake, Antarctica - Metagenome #681 (v2) | Environmental | Open in IMG/M |
| 3300028372 | Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Filla 3 #767 (v2) | Environmental | Open in IMG/M |
| 3300028374 | Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Torckler E11 #897 (v2) | Environmental | Open in IMG/M |
| 3300028376 | Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Filla E10 #628 (v2) | Environmental | Open in IMG/M |
| 3300028378 | Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Torckler E6 #832 (v2) | Environmental | Open in IMG/M |
| 3300031209 | Saline water microbial communities from Organic Lake, Antarctica - #439 | Environmental | Open in IMG/M |
| 3300031211 | Saline water microbial communities from Organic Lake, Antarctica - #784 | Environmental | Open in IMG/M |
| 3300031212 | Saline water microbial communities from Organic Lake, Antarctica - #494 | Environmental | Open in IMG/M |
| 3300031213 | Saline water microbial communities from Organic Lake, Antarctica - #3 | Environmental | Open in IMG/M |
| 3300031214 | Saline water microbial communities from Organic Lake, Antarctica - #492 | Environmental | Open in IMG/M |
| 3300031215 | Saline water microbial communities from Organic Lake, Antarctica - #92 | Environmental | Open in IMG/M |
| 3300031216 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #1060 | Environmental | Open in IMG/M |
| 3300031217 | Saline water microbial communities from Organic Lake, Antarctica - #124 | Environmental | Open in IMG/M |
| 3300031219 | Saline water microbial communities from Organic Lake, Antarctica - #782 | Environmental | Open in IMG/M |
| 3300031220 | Saline water microbial communities from Organic Lake, Antarctica - #122 | Environmental | Open in IMG/M |
| 3300031221 | Saline water microbial communities from Organic Lake, Antarctica - #280 | Environmental | Open in IMG/M |
| 3300031222 | Saline water microbial communities from Organic Lake, Antarctica - #780 | Environmental | Open in IMG/M |
| 3300031227 | Saline water microbial communities from Ace Lake, Antarctica - #232 | Environmental | Open in IMG/M |
| 3300031339 | Saline water microbial communities from Organic Lake, Antarctica - #48 | Environmental | Open in IMG/M |
| 3300031343 | Saline water microbial communities from Organic Lake, Antarctica - #376 | Environmental | Open in IMG/M |
| 3300031382 | Saline water microbial communities from Organic Lake, Antarctica - #714 | Environmental | Open in IMG/M |
| 3300031392 | Saline water microbial communities from Organic Lake, Antarctica - #917 | Environmental | Open in IMG/M |
| 3300031395 | Saline water microbial communities from Organic Lake, Antarctica - #490 | Environmental | Open in IMG/M |
| 3300031398 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #1058 | Environmental | Open in IMG/M |
| 3300031399 | Saline water microbial communities from Organic Lake, Antarctica - #650 | Environmental | Open in IMG/M |
| 3300031403 | Saline water microbial communities from Organic Lake, Antarctica - #88 | Environmental | Open in IMG/M |
| 3300031631 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #181 | Environmental | Open in IMG/M |
| 3300031741 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #183 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ADL24m1u_00952230 | 2084038011 | Hypersaline | VVKNAALMWKMGLDYEKYLEKNGVIENEPFEQMFGKPDDEPEPTPEQGGMSLEQLMGGDGEA |
| ADL5mRS1u_00590100 | 2084038019 | Hypersaline | KSAALMWKMGLDYEKYLEKNGVIENEPFEQMFGKPDDEPEPTPEQGGMSLEQLMGGDGEA |
| ADL13m1u_00889960 | 2100351014 | Hypersaline | VIENEPFEQMFGKPDDEPEPTPEQGGMSLEQLMGGDGD |
| ADL13m1u_00963100 | 2100351014 | Hypersaline | YLEKNGVIENEPFEQMFGKPDDEPEPTPEQGGMSLEQLMGGDGEA |
| ADL36m2_01217300 | 2140918027 | Hypersaline | KNGVIENEPFEQMFGKPDDEPEPTPEQGGMSLEQLMGGDGEA |
| LV_Brine_h2_0102DRAFT_10298121 | 3300000405 | Hypersaline | YEKYLEDNGVIENDPWDTVFGPVDDPEPTPEQGGMNLEQLMGGQQ* |
| LV_Brine_h2_0102DRAFT_10307111 | 3300000405 | Hypersaline | NAALLWQMGLDYEKYLEDNDVIQNDPWDSMFGKPDEDTEPTVEQGGMSLEQLMGVQE* |
| JGI1221J11331_10102574 | 3300000525 | Hypersaline | VKNALVLWQIGMDYEKYLEDNGVIENDPWDIVFGPVDDPEPTPEQGGMNLEQLMGGGES* |
| JGI1221J11331_10538471 | 3300000525 | Hypersaline | EDNGVIENDPWDTVFGPVDDPEPTAEQGGMSLEQLMGGQE* |
| JGI1221J11331_10723161 | 3300000525 | Hypersaline | DNGVIENDPWDTVFGKADEPEPLPDPEQSGMNLEQLLGGDGEA* |
| JGIcombinedJ13537_100290211 | 3300001097 | Hypersaline | LEDNGVIETDAFDKMFGKADEETEPTFEQGGMSLEQLMGGDSEA* |
| JGIcombinedJ13537_100480131 | 3300001097 | Hypersaline | EDNGVIENDPWDTVFGPVDDPEPTPEQGGMNLEQLMGGGES* |
| JGIcombinedJ13537_101330672 | 3300001097 | Hypersaline | MDYEKYLEDNGVIEKDPWDTVFGPVDDPEPTPEQGGMNLEQLMGGQQ* |
| Ga0065697_10017351 | 3300005273 | Hypersaline | LDYEKYLEKNGVIENEPFDQVFGPRDEPDQLPDPEDSSMXLEQLMGGDGEA* |
| Ga0075115_101094972 | 3300005917 | Saline Lake | AFDEMFGKPDEEPEPDNPEMNLEQLLGGGEDDYD* |
| Ga0075116_102686342 | 3300005918 | Saline Lake | DAFDEMFGKPDDDPEPTPEQGGMNLEQLMAGGADEA* |
| Ga0075114_101930381 | 3300005919 | Saline Lake | HGVIEVDAFDQMFGKPDDDPEPTPEQGGMSLEQLMAGGEDD* |
| Ga0075105_10240863 | 3300005928 | Saline Lake | NGVIENEPFEQMFGKPDDEPEPTPEQGGMSLEQLMGGDGEK* |
| Ga0075107_10140421 | 3300005929 | Saline Lake | LEKNGVIENEPFEQMFGKPDDEPEPTPEQGGMSLEQLMGGDGD* |
| Ga0075107_10283852 | 3300005929 | Saline Lake | KYLEDNGVIENDPFEVMFGKPEEDEAPTPEQGGMSLEELMRGGEK* |
| Ga0075106_10324152 | 3300005930 | Saline Lake | KNGVIENEPFEQMFGKPDDEPEPTPEQGGMSLEQLMGGADD* |
| Ga0075125_103134631 | 3300005935 | Saline Lake | WQMGLDYEKYLEKHGVIEVDAFDEMFGKPDDEPEPTPEQGGMSLEQLLGGGEDEYD* |
| Ga0075125_104266031 | 3300005935 | Saline Lake | YLETHGVIEVDAFDQMFGKPDDDPEPTPEQGGMNLEQLMAGGADEA* |
| Ga0075124_101022732 | 3300005936 | Lake Water | HGVIEVDAFDQMFGKPDEEPEPDNPEMSLEQLMAGGADD* |
| Ga0136570_1124601 | 3300011170 | Saline Lake | KNGVIENEPFEQMFGKPDDEPEPTPEQGGMSLEQLMGGDGEK* |
| Ga0136574_1174963 | 3300011177 | Saline Lake | VKNAALMWQMGLDYEKYLEKNGVIENEPFDQVFGPRDEPDQLPDPEDSSMSLEQLMGGDGEK* |
| Ga0136607_10305731 | 3300011181 | Saline Lake | NEPFEQMFGKPDDEPEPTPEQGGMSLEQLMGGDGEK* |
| Ga0136597_10117561 | 3300011185 | Saline Lake | KYLEDNGVIENDPFEVMFGKPEEDEAPTPEQGGMSLEELMEGGEK* |
| Ga0136597_10255263 | 3300011185 | Saline Lake | YEKYLEDNGVIENDPFEVMFGKPEEDEAPTPEQGGMSLEELMGGGEK* |
| Ga0136558_11515692 | 3300011189 | Saline Lake | GMDYEKYLEDNGVIENDPWDTMFSKPDDDPEPTPEQGGMSLEELMGGDGEA* |
| Ga0136576_10090263 | 3300012026 | Saline Lake | YLEKNGVIENEPFEQMFGKPDDEPEPTPEQGGMSLEQLMGGDGD* |
| Ga0136599_10408512 | 3300012030 | Saline Lake | WQMGQDYEKYLEKHGVIEVDAFEQMFAPADDPEPLPDPEQPEMNLEQLLAGGEDEA* |
| Ga0136561_10357171 | 3300012031 | Saline Lake | YLEKHGVIEVDAFEEMFGKPDDEPEPMPEQGGMSLEQLMVGADD* |
| Ga0136589_10865031 | 3300012033 | Saline Lake | EKHGVIEVDAFDEMFGKPDEDEAPTPEQGGMSLEQLMGGEE* |
| Ga0136567_10135831 | 3300012104 | Saline Lake | IENEPFEQMFGKPDDEPEPTPEQGGMSLEQLMGGADD* |
| Ga0136562_1251092 | 3300012108 | Saline Lake | ENEPFEQMFGKPDDEPEPTPEQGGMSLEQLMGGDGEK* |
| Ga0136592_10146441 | 3300012115 | Saline Lake | KNGVIENEPFEQMFGKPDDEPEPTPEQGGMSLEQLMGGDGD* |
| Ga0136582_10279212 | 3300012128 | Saline Lake | LEKNGVIENEPFEQMFGKPDDEPEPTPEQGGMSLEQLMGGADD* |
| Ga0136588_10512702 | 3300012147 | Saline Lake | WQMGQDYEKYLEKHGVIEVDAFEEMFGKPDDEPEPMPEQGGMSLEQLMVGADD* |
| Ga0136598_10864972 | 3300012170 | Saline Lake | GVIENDPFEVMFGKPEEDEAPTPEQGGMSLEELMGGGEK* |
| Ga0136573_1190002 | 3300012250 | Saline Lake | EKNGVIENEPFDQVFGPRDEPDQLPDPEDSSMSLEQLMGGADD* |
| Ga0136563_1258522 | 3300012261 | Saline Lake | DNGVIENDPWDTMFGKPDDEPEPTPEQGGMSLEQLMGGDGEK* |
| Ga0136564_10168361 | 3300012263 | Saline Lake | ENDPWDTMFGKPDDEPEPTPEQGGMSLEQLMGGDE* |
| Ga0136604_10533982 | 3300012270 | Saline Lake | VIENDPFEVMFGKPEEAPTPEQGGMSLEELMGGGEK* |
| Ga0136555_10405113 | 3300012271 | Saline Lake | DAFDEMFGKPDDDPELTPEQGGMSLEQLMGGGEDD* |
| Ga0136555_10554711 | 3300012271 | Saline Lake | GVIEVDAFDKMFGPSDEPEQLPDPDQPEMNLEQLLAGGEDGA* |
| Ga0222699_10208241 | 3300022846 | Saline Water | KYLETHGVIEVDAFDEMFGKPDEEPEPDNPEMNLEQSMAGAPDEA |
| Ga0222699_10443141 | 3300022846 | Saline Water | EVDAFDEMFGKPDDDPEPTPEQGGMSLEQLMAGGEDD |
| Ga0222671_10358071 | 3300022856 | Saline Water | VIEVDAFDQMFGKPDEEPEPDNPEMSLEQLMGGGEDD |
| Ga0222698_10280271 | 3300022860 | Saline Water | VDAFDQMFGKPDEEPEPDNPEMNLEQLLGGGEDDYD |
| Ga0222698_10293831 | 3300022860 | Saline Water | ETHGVIEVDAFDEMFGKPDEEPEPDNPEMNLEQSMAGAPDEA |
| Ga0222628_10452621 | 3300022871 | Saline Water | KHGVIEVDAFDEMFGKPDEEPEPDNPEMSLEQLMAGGADD |
| Ga0222626_10222353 | 3300022882 | Saline Water | KYLETHGVIEVDAFDEMFGKPDDDPEPTPEQGGMSLEQLLGGGEDEYD |
| Ga0222642_10347331 | 3300022887 | Saline Water | IEFDAFDEMFGKPDDDPEPTPEQGGMNLEQLLGGGEDEYD |
| Ga0222690_10125281 | 3300023227 | Saline Water | THGVIEVDAFDEMFGKPDEEPEPDNPEMNLEQSMAGGADD |
| Ga0222627_10244651 | 3300023244 | Saline Water | GVIEVDAFDEMFGKPDDDPEPTPEQGGMSLEQLLGGGEDEYD |
| Ga0222627_10286891 | 3300023244 | Saline Water | THGVIEVDAFDEMFGKPDEEPEPTPEQGGMNLEQLMAGGADD |
| Ga0222695_10234591 | 3300023253 | Saline Water | KYLEKHGVIEVDAFDQMFGKPDDDPEPTPEQGGMSLEQLMAGGADDYD |
| Ga0222702_10909581 | 3300023299 | Saline Water | VIEVDAFDQMFGKPDDDPEPTPEQGGMNLEQLMAGGADEA |
| Ga0222702_11077341 | 3300023299 | Saline Water | HGVIEVDAFDQMFGKPDEEPEPDNPEMNLEQLMAGGADEA |
| Ga0209414_10050481 | 3300023301 | Hypersaline | LLWQMGLDYEKYLEDNDVIQNDPWDSMFGKPDEDPEPTPEQGGMSLEQVMGGNGEA |
| Ga0209414_10794641 | 3300023301 | Hypersaline | VIENDPWDTVFGPVDDPEPTPEQGGMNLEQLMGGQQ |
| Ga0209414_10949512 | 3300023301 | Hypersaline | NGVIETDAFDKMFGKADEETEPTFEQGGMSLEQLMGGDSEA |
| Ga0208135_1139671 | 3300025351 | Saline Lake | EKNGVIENEPFEQMFGKPDDEPEPTPEQGGMSLEQLMGGDGEK |
| Ga0207995_1107853 | 3300025352 | Saline Lake | YLEKNGVIENEPFEQMFGKPDDEPEPTPEQGGMSLEQLMGGADD |
| Ga0208647_10224271 | 3300025362 | Saline Lake | GLDYEKYLEKHGVIEVDAFDQMFGKPDEEPEPDNPEMNLEQLMAGGADEA |
| Ga0208647_10423631 | 3300025362 | Saline Lake | EVDAFDEMFGKPDEEPEPDNPEMNLEQLMAGAPDEA |
| Ga0208901_10164121 | 3300025380 | Saline Lake | WQMGLDYEKYLETHGVIEVDAFDQMFGKPDDDPEPTPEQGGMNLEQLMAGGADEA |
| Ga0208901_10513072 | 3300025380 | Saline Lake | GVIEVDAFDQMFGKPDEEELPEMNLEQLMAGGADEA |
| Ga0208900_10319552 | 3300025433 | Saline Lake | WQMGLDYEKYLETHGVIEVDAFDQMFGKPDDDPEPTPEQGGMSLEQLMAGAPDEA |
| Ga0208900_10553921 | 3300025433 | Saline Lake | YEKYLEKHGVIEVDAFDEMFGKPDEEPEPEQGGMNLEQLMAGAPDEA |
| Ga0208900_10641391 | 3300025433 | Saline Lake | EVDAFDEMFGKPDEEPEPDNPEMSLEQLMAGAPDEA |
| Ga0207996_10573152 | 3300025586 | Saline Lake | THGVIEVDAFDEMFGKPDEEPEPDNPEMSLEQLMGGGEDD |
| Ga0207996_10628682 | 3300025586 | Saline Lake | EKHGVIEVDAFDEMFGKPDEEPEPDNPEMNLEQLLGGGEDDYD |
| Ga0208902_10682912 | 3300025628 | Saline Lake | IEVDAFDQMFGKPDEEPEPDNPEMNLEQSMAGGADD |
| Ga0208648_11126341 | 3300025642 | Saline Lake | DYEKYLEKHGVIEVDAFDEMFGKPDEEPEPDNPEMNLEQSMAGGEDD |
| Ga0208905_10777891 | 3300025661 | Lake Water | EVDAFDQMFGKPDEEPEPDNPEMNLEQLLGGGEDDYD |
| Ga0208769_10670753 | 3300025697 | Saline Lake | EVDAFDQMFGKPDDEPDPTPEQGGMSIEQLMGGGE |
| Ga0208769_11882291 | 3300025697 | Saline Lake | QMGLDYEKYLETHGVIEVDAFDEMFGKPDEEPEPDNPEMNLEQLLGGGEDDYD |
| Ga0208771_10652112 | 3300025698 | Saline Lake | GLDYEKYLETHGVIEVDAFDAMFGKPDEEPEPDNPEMSLEQLMAGGADDYD |
| Ga0208771_12169691 | 3300025698 | Saline Lake | YLETHGVIEVDAFDQMFGKPDDDPEPTPEQGGMNLEQLMAGGADEA |
| Ga0306892_1162971 | 3300028345 | Saline Lake | ENEPFEQMFGKPDDEPEPTPEQGGMSLEQLMGGDGEK |
| Ga0306902_1106693 | 3300028353 | Saline Lake | EPFEQMFGKPDDEPEPTPEQGGMSLEQLMGGDGEK |
| Ga0306914_1194521 | 3300028360 | Saline Lake | NEPFEQMFGKPDDEPEPTPEQGGMSLEQLMGGDGEK |
| Ga0306901_10249162 | 3300028372 | Saline Lake | KYLEKHGVIEVDAFDEMFGKPDDEPEPTPEQGGMSLEQLMGGDGEA |
| Ga0306906_10095993 | 3300028374 | Saline Lake | YEKYLEDNGVIENDPFEVMFGKPEEDEAPTPEQGGMSLEELMGGGEK |
| Ga0306906_10213503 | 3300028374 | Saline Lake | YEKYLEDNGVIENDPFEVMFGKPEEDEAPTPEQGGMSLEELMEGGEK |
| Ga0306912_10367172 | 3300028376 | Saline Lake | HGVIEVDAFDEMFAPADEPEPLPDPEQPEMNLEQLLAGGEDEA |
| Ga0306868_10128824 | 3300028378 | Saline Lake | NGVIENDSWDTMFGKPDDDPEPTPEQGGMSLEQLMGGDGEA |
| Ga0307955_10384061 | 3300031209 | Saline Water | IENDPWDTMFSKPDDDPEPTPEQGGMSLEQLMGGDE |
| Ga0307974_10501053 | 3300031211 | Saline Water | GVVEKDPFEEMFGKPDQGEAPTPEQGGMSLEELMGGDDEA |
| Ga0307974_11376231 | 3300031211 | Saline Water | DYEKYLEKHGVIEVDAFEQMFGKPDNEPEPTPEQGGMSLEQLMAGGEDD |
| Ga0307959_10516253 | 3300031212 | Saline Water | YEKYLEDNGVIENDPWDTMFGKPDDDPEATPEQGGMSLEQLMGGDE |
| Ga0307959_11561392 | 3300031212 | Saline Water | VIENDPWDTMFSKPDDDPEPTPEQGGMSLEQLMGGDE |
| Ga0307937_10144441 | 3300031213 | Saline Water | GLDYDKYLTDNGVVEKDPFEEMFGKPDQGEAPTPEQGGMSLEQLMGGDDD |
| Ga0307937_10822351 | 3300031213 | Saline Water | VDAFDEMFGKPDDEPEPMPEQGGMSLEQLMGGADEA |
| Ga0307958_10249303 | 3300031214 | Saline Water | KNALILWQMGMDYEKYLEDNGVIENDPWDTMFDKPDDEPEPTPEQGGMSLEQLMGGDE |
| Ga0307935_10339121 | 3300031215 | Saline Water | LEDNGVIENDPWDTMFSKPDDDPEPTPEQGGMSLEQLMGGDE |
| Ga0307935_10776481 | 3300031215 | Saline Water | EKHGVIEVDAFDEMFGKPDDEPEPTPEQGGMSLEQLMGGGEDEA |
| Ga0307980_10423353 | 3300031216 | Saline Water | IEVDAFEQMFGKPDDEPEPMPEQGGMSLEQLMGGADE |
| Ga0307940_10987062 | 3300031217 | Saline Water | HGVIEVDAFDEMFGKPDEPEQLPDPDQPEMNLEQLLAGGEDEA |
| Ga0307973_10377631 | 3300031219 | Saline Water | GVIENDPWDTMFGKPDDDPEPTPEQGGMSLEQLMGGDE |
| Ga0307939_11116272 | 3300031220 | Saline Water | ENHGVIEVDAFDEMFGKPDDEPEPTPEQGGMSLEQLMGGEE |
| Ga0307939_11294101 | 3300031220 | Saline Water | DYEKYLEKHGVIEVDAFDEMFGKPDDEPEPMPEQGGMSLEQLMGGADE |
| Ga0307948_11081521 | 3300031221 | Saline Water | ENDPWDTMFSKPDDDPEPTPEQGGMSLEQLMGGDE |
| Ga0307948_11140171 | 3300031221 | Saline Water | QMGQDYEKYLEKHGVIEVDAFDTMFGASDDMEQSPEPDNPEMSLEQLLAGGADE |
| Ga0307972_11856011 | 3300031222 | Saline Water | GVIEVDAFDEMFGKPDDEPEPTPEQGGMSLEQLMGGGEDEA |
| Ga0307928_103015541 | 3300031227 | Saline Water | VIEVDAFDQMFGKPDEEPEPDNPEMSLEQLMAGGADD |
| Ga0307932_10686271 | 3300031339 | Saline Water | LEDNGVIENDPWDTMFGKPDDDPEATPEQGGMSLEQLMGGDE |
| Ga0307932_10929972 | 3300031339 | Saline Water | WQMGQDYEKYLEKHGVIEVDAFDEMFGKPDEPEQLPDPDQSEMNLEQLLAGGEDEA |
| Ga0307932_11793912 | 3300031339 | Saline Water | GLDYKKYLEKHDVIEVDAFEQMFGASDDMEQSPDPEQPEVSLEQLLAGGEDEA |
| Ga0307952_11283572 | 3300031343 | Saline Water | VDAFDEMFGKPDDEPEPMPEQGGMSLEQLMGGADE |
| Ga0307971_12205371 | 3300031382 | Saline Water | DKYLTDNGVVEKDPFEEMFGKPDQGEAPTPEQGGMSLEQLMGGDDD |
| Ga0307975_10541101 | 3300031392 | Saline Water | NAFVLWQMGLDYDKYLTDNGVVEKDPFEEMFGKPDQGEAPTPEQGGMSLEELMGGDDEA |
| Ga0307975_11364773 | 3300031392 | Saline Water | EKYLEKHGVIEVDAFDEMFGKPDDEPEPMPEQGGMSLEQLMGGADE |
| Ga0307975_11773811 | 3300031392 | Saline Water | GVIENDPWDTMFSKPDDDPEPTPEQGGMSLEQLMGGDE |
| Ga0307957_10623131 | 3300031395 | Saline Water | ENDPWDTMFGKPDDDPEATPEQGGMSLEQLMGGDE |
| Ga0307979_10961631 | 3300031398 | Saline Water | YLEKHGVIEVDAFEEMFGKPDDEPEPMPEQGGMSLEQLMGGADE |
| Ga0307968_11630962 | 3300031399 | Saline Water | LDYEKYLEKHGVIEVDAFEEMFGTPDDDPELTPEQGGMSLEQLLAGGADEA |
| Ga0307933_11771382 | 3300031403 | Saline Water | HGVIEVDAFEQMFGKPDDEPEPTPEQGGMSLEQLMGGGEDEA |
| Ga0307987_10334083 | 3300031631 | Marine | YEKYLEKHGVIEVDAFDEMFGKPDDEPEPTPGQGGMNLEQLMAGGADEA |
| Ga0307987_10937002 | 3300031631 | Marine | IEVDAFDEMFGKPDDEPEPTPEQGGMNLEQLMNGGPDEA |
| Ga0307988_10530541 | 3300031741 | Marine | KHGVIEVDAFDEMFGKPDDEPEPTPGQGGMNLEQLMAGGADD |
| Ga0307988_11054862 | 3300031741 | Marine | HGVIEVDAFDQMFGTSDEEELPEMNLEQLMNGGPDEA |
| ⦗Top⦘ |