NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F069358

Metagenome / Metatranscriptome Family F069358

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F069358
Family Type Metagenome / Metatranscriptome
Number of Sequences 124
Average Sequence Length 65 residues
Representative Sequence MEDHKIRALKDHYKAQITWAASELTSYLEYPSAVGEHTFLETMDKLVQQIAENEDKLVVLETHFNE
Number of Associated Samples 97
Number of Associated Scaffolds 124

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 71.54 %
% of genes near scaffold ends (potentially truncated) 29.03 %
% of genes from short scaffolds (< 2000 bps) 73.39 %
Associated GOLD sequencing projects 86
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Predicted Viral (45.161 % of family members)
NCBI Taxonomy ID 10239 (predicted)
Taxonomy All Organisms → Viruses → Predicted Viral

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Strait → Unclassified → Seawater
(19.355 % of family members)
Environment Ontology (ENVO) Unclassified
(80.645 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(89.516 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 83.33%    β-sheet: 0.00%    Coil/Unstructured: 16.67%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 124 Family Scaffolds
PF02867Ribonuc_red_lgC 23.39
PF00268Ribonuc_red_sm 16.13
PF03819MazG 11.29
PF137592OG-FeII_Oxy_5 9.68
PF11753DUF3310 1.61

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 124 Family Scaffolds
COG0209Ribonucleotide reductase alpha subunitNucleotide transport and metabolism [F] 23.39
COG0208Ribonucleotide reductase beta subunit, ferritin-like domainNucleotide transport and metabolism [F] 16.13


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms67.74 %
UnclassifiedrootN/A32.26 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000115|DelMOSum2011_c10033373All Organisms → Viruses → Predicted Viral2242Open in IMG/M
3300000116|DelMOSpr2010_c10059648All Organisms → Viruses → Predicted Viral1612Open in IMG/M
3300000116|DelMOSpr2010_c10184572All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium TMED228681Open in IMG/M
3300000116|DelMOSpr2010_c10256723All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium TMED228530Open in IMG/M
3300000117|DelMOWin2010_c10075690All Organisms → Viruses → Predicted Viral1334Open in IMG/M
3300001450|JGI24006J15134_10012824All Organisms → Viruses → Predicted Viral4049Open in IMG/M
3300001450|JGI24006J15134_10017890All Organisms → Viruses → Predicted Viral3315Open in IMG/M
3300001450|JGI24006J15134_10033409All Organisms → Viruses → Predicted Viral2234Open in IMG/M
3300001450|JGI24006J15134_10169284All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium TMED228696Open in IMG/M
3300001472|JGI24004J15324_10001452Not Available9434Open in IMG/M
3300001589|JGI24005J15628_10176845Not Available620Open in IMG/M
3300002753|JGI24929J39151_1010337All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium TMED228586Open in IMG/M
3300002754|JGI24928J39210_1011705Not Available652Open in IMG/M
3300003620|JGI26273J51734_10180131Not Available540Open in IMG/M
3300004279|Ga0066605_10041496All Organisms → Viruses → Predicted Viral2129Open in IMG/M
3300004448|Ga0065861_1063913Not Available617Open in IMG/M
3300006164|Ga0075441_10018712All Organisms → Viruses → Predicted Viral2881Open in IMG/M
3300006164|Ga0075441_10083253All Organisms → Viruses → Predicted Viral1237Open in IMG/M
3300006165|Ga0075443_10036955All Organisms → Viruses → Predicted Viral1632Open in IMG/M
3300006191|Ga0075447_10060080All Organisms → Viruses → Predicted Viral1381Open in IMG/M
3300006191|Ga0075447_10126392Not Available870Open in IMG/M
3300006352|Ga0075448_10104668Not Available886Open in IMG/M
3300006803|Ga0075467_10103466All Organisms → Viruses → Predicted Viral1691Open in IMG/M
3300006803|Ga0075467_10220521All Organisms → Viruses → Predicted Viral1044Open in IMG/M
3300006810|Ga0070754_10082719All Organisms → Viruses → Predicted Viral1616Open in IMG/M
3300006916|Ga0070750_10086050All Organisms → Viruses → Predicted Viral1470Open in IMG/M
3300006916|Ga0070750_10090325All Organisms → Viruses → Predicted Viral1428Open in IMG/M
3300006916|Ga0070750_10390605Not Available582Open in IMG/M
3300006919|Ga0070746_10218860Not Available900Open in IMG/M
3300006929|Ga0098036_1067808All Organisms → Viruses → Predicted Viral1101Open in IMG/M
3300007344|Ga0070745_1325101All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium TMED228544Open in IMG/M
3300007345|Ga0070752_1024428All Organisms → Viruses → Predicted Viral3014Open in IMG/M
3300007539|Ga0099849_1109067All Organisms → Viruses → Predicted Viral1097Open in IMG/M
3300007540|Ga0099847_1195489Not Available591Open in IMG/M
3300007555|Ga0102817_1116828Not Available590Open in IMG/M
3300007862|Ga0105737_1081838All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium TMED228804Open in IMG/M
3300007863|Ga0105744_1090532Not Available755Open in IMG/M
3300007956|Ga0105741_1076723All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes817Open in IMG/M
3300008950|Ga0102891_1078544All Organisms → Viruses → Predicted Viral1007Open in IMG/M
3300008999|Ga0102816_1288258Not Available521Open in IMG/M
3300009086|Ga0102812_10268171All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes929Open in IMG/M
3300009412|Ga0114903_1052096Not Available958Open in IMG/M
3300009414|Ga0114909_1144453All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes631Open in IMG/M
3300009420|Ga0114994_10423275Not Available881Open in IMG/M
3300009436|Ga0115008_10109738All Organisms → Viruses → Predicted Viral2040Open in IMG/M
3300009512|Ga0115003_10362994All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes853Open in IMG/M
3300009603|Ga0114911_1076264Not Available1003Open in IMG/M
3300009703|Ga0114933_10971147Not Available538Open in IMG/M
3300010153|Ga0098059_1264111Not Available662Open in IMG/M
3300010883|Ga0133547_12116670All Organisms → Viruses → Predicted Viral1025Open in IMG/M
3300011245|Ga0151673_102866All Organisms → Viruses → Predicted Viral2702Open in IMG/M
3300011248|Ga0151670_1006477All Organisms → Viruses → Predicted Viral1187Open in IMG/M
3300017710|Ga0181403_1015287All Organisms → Viruses → Predicted Viral1641Open in IMG/M
3300017710|Ga0181403_1030262All Organisms → Viruses → Predicted Viral1143Open in IMG/M
3300017717|Ga0181404_1003021All Organisms → Viruses → Predicted Viral4736Open in IMG/M
3300017719|Ga0181390_1023049All Organisms → Viruses → Predicted Viral2012Open in IMG/M
3300017725|Ga0181398_1051124All Organisms → Viruses → Predicted Viral1000Open in IMG/M
3300017727|Ga0181401_1051368All Organisms → Viruses → Predicted Viral1127Open in IMG/M
3300017730|Ga0181417_1015812All Organisms → Viruses → Predicted Viral1909Open in IMG/M
3300017731|Ga0181416_1001336Not Available6239Open in IMG/M
3300017742|Ga0181399_1108300All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes684Open in IMG/M
3300017742|Ga0181399_1177791All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium TMED228505Open in IMG/M
3300017743|Ga0181402_1085718All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium TMED228821Open in IMG/M
3300017748|Ga0181393_1014939All Organisms → Viruses → Predicted Viral2320Open in IMG/M
3300017748|Ga0181393_1132696All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium TMED228627Open in IMG/M
3300017749|Ga0181392_1013129All Organisms → Viruses → Predicted Viral2688Open in IMG/M
3300017753|Ga0181407_1006568All Organisms → Viruses → Predicted Viral3403Open in IMG/M
3300017767|Ga0181406_1025431All Organisms → Viruses → Predicted Viral1862Open in IMG/M
3300017776|Ga0181394_1197846Not Available613Open in IMG/M
3300017776|Ga0181394_1260739All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium TMED228517Open in IMG/M
3300017783|Ga0181379_1013730All Organisms → Viruses → Predicted Viral3359Open in IMG/M
3300017783|Ga0181379_1249806Not Available612Open in IMG/M
3300017786|Ga0181424_10014826All Organisms → Viruses → Predicted Viral3370Open in IMG/M
3300018642|Ga0188867_1000140All Organisms → Viruses → Predicted Viral2467Open in IMG/M
3300020428|Ga0211521_10017777All Organisms → Viruses → Predicted Viral4172Open in IMG/M
3300020438|Ga0211576_10061518All Organisms → Viruses → Predicted Viral2123Open in IMG/M
3300020440|Ga0211518_10392251Not Available641Open in IMG/M
3300020468|Ga0211475_10228835Not Available927Open in IMG/M
3300021957|Ga0222717_10023991All Organisms → Viruses → Predicted Viral4069Open in IMG/M
3300021957|Ga0222717_10275665Not Available968Open in IMG/M
3300021959|Ga0222716_10349118Not Available876Open in IMG/M
3300022061|Ga0212023_1025146All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium TMED228815Open in IMG/M
3300022061|Ga0212023_1061567Not Available520Open in IMG/M
3300022066|Ga0224902_102394Not Available938Open in IMG/M
3300022068|Ga0212021_1019997All Organisms → Viruses → Predicted Viral1243Open in IMG/M
3300022074|Ga0224906_1132096Not Available715Open in IMG/M
3300022178|Ga0196887_1024940All Organisms → Viruses → Predicted Viral1730Open in IMG/M
(restricted) 3300024059|Ga0255040_10019059All Organisms → Viruses → Predicted Viral2355Open in IMG/M
3300024346|Ga0244775_10117655All Organisms → Viruses → Predicted Viral2253Open in IMG/M
3300024346|Ga0244775_10365003All Organisms → Viruses → Predicted Viral1190Open in IMG/M
(restricted) 3300024518|Ga0255048_10214233Not Available939Open in IMG/M
3300025120|Ga0209535_1104502All Organisms → Viruses → Predicted Viral1005Open in IMG/M
3300025120|Ga0209535_1172834Not Available647Open in IMG/M
3300025128|Ga0208919_1070214All Organisms → Viruses → Predicted Viral1165Open in IMG/M
3300025137|Ga0209336_10064018All Organisms → Viruses → Predicted Viral1104Open in IMG/M
3300025137|Ga0209336_10095190All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium TMED228850Open in IMG/M
3300025137|Ga0209336_10192746Not Available507Open in IMG/M
3300025138|Ga0209634_1000946All Organisms → cellular organisms → Bacteria21929Open in IMG/M
3300025138|Ga0209634_1321459Not Available522Open in IMG/M
3300025168|Ga0209337_1203697All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium TMED228801Open in IMG/M
3300025168|Ga0209337_1337045Not Available524Open in IMG/M
3300025276|Ga0208814_1014448All Organisms → Viruses → Predicted Viral2746Open in IMG/M
3300025508|Ga0208148_1090408All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes675Open in IMG/M
3300025543|Ga0208303_1104162Not Available594Open in IMG/M
3300025705|Ga0209374_1029246All Organisms → Viruses → Predicted Viral2276Open in IMG/M
3300025853|Ga0208645_1193528All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes727Open in IMG/M
3300025870|Ga0209666_1214608All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes816Open in IMG/M
3300027081|Ga0208954_1051302Not Available525Open in IMG/M
3300027196|Ga0208438_1069118All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium TMED228576Open in IMG/M
3300027280|Ga0208972_1053266All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes793Open in IMG/M
3300027686|Ga0209071_1091115Not Available896Open in IMG/M
3300027704|Ga0209816_1041883All Organisms → Viruses → Predicted Viral2147Open in IMG/M
3300027704|Ga0209816_1120290Not Available987Open in IMG/M
3300028125|Ga0256368_1050450All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium TMED228732Open in IMG/M
3300031519|Ga0307488_10045281All Organisms → Viruses → Predicted Viral3438Open in IMG/M
3300031519|Ga0307488_10059742All Organisms → Viruses → Predicted Viral2912Open in IMG/M
3300031622|Ga0302126_10334293Not Available504Open in IMG/M
3300031766|Ga0315322_10307652All Organisms → Viruses → Predicted Viral1081Open in IMG/M
3300031766|Ga0315322_10465112All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes833Open in IMG/M
3300031775|Ga0315326_10048180All Organisms → Viruses → Predicted Viral2687Open in IMG/M
3300031775|Ga0315326_11006301All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium TMED228509Open in IMG/M
3300031851|Ga0315320_10009532Not Available7827Open in IMG/M
3300033742|Ga0314858_078079All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium TMED228828Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater19.35%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine18.55%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous14.52%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine12.10%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine4.84%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater4.03%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine4.03%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine4.03%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean3.23%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water2.42%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water2.42%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine1.61%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine1.61%
Sea-Ice BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine1.61%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine1.61%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake0.81%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.81%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater0.81%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.81%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface0.81%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000115Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011EnvironmentalOpen in IMG/M
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300000117Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010EnvironmentalOpen in IMG/M
3300001450Marine viral communities from the Pacific Ocean - LP-53EnvironmentalOpen in IMG/M
3300001472Marine viral communities from the Pacific Ocean - LP-32EnvironmentalOpen in IMG/M
3300001589Marine viral communities from the Pacific Ocean - LP-40EnvironmentalOpen in IMG/M
3300002753Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - C0912_C27A4_35EnvironmentalOpen in IMG/M
3300002754Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - C0912_C43A7_35EnvironmentalOpen in IMG/M
3300003620Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNAEnvironmentalOpen in IMG/M
3300004279Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_10mEnvironmentalOpen in IMG/M
3300004448Marine viral communities from Newfoundland, Canada BC-1EnvironmentalOpen in IMG/M
3300006164Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNAEnvironmentalOpen in IMG/M
3300006165Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNAEnvironmentalOpen in IMG/M
3300006191Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNAEnvironmentalOpen in IMG/M
3300006352Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG108-DNAEnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300006929Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaGEnvironmentalOpen in IMG/M
3300007344Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4EnvironmentalOpen in IMG/M
3300007345Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30EnvironmentalOpen in IMG/M
3300007539Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaGEnvironmentalOpen in IMG/M
3300007540Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007555Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555EnvironmentalOpen in IMG/M
3300007862Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373A_0.2umEnvironmentalOpen in IMG/M
3300007863Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459B_0.2umEnvironmentalOpen in IMG/M
3300007956Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459A_0.2umEnvironmentalOpen in IMG/M
3300008950Estuarine microbial communities from the Columbia River estuary - metaG 1552A-02EnvironmentalOpen in IMG/M
3300008999Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545EnvironmentalOpen in IMG/M
3300009086Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713EnvironmentalOpen in IMG/M
3300009412Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s2EnvironmentalOpen in IMG/M
3300009414Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_906EnvironmentalOpen in IMG/M
3300009420Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009512Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88EnvironmentalOpen in IMG/M
3300009603Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_904EnvironmentalOpen in IMG/M
3300009703Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaGEnvironmentalOpen in IMG/M
3300010153Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaGEnvironmentalOpen in IMG/M
3300010883western Arctic Ocean co-assemblyEnvironmentalOpen in IMG/M
3300011245Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_4, 0.2EnvironmentalOpen in IMG/M
3300011248Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, 0.2EnvironmentalOpen in IMG/M
3300017710Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28EnvironmentalOpen in IMG/M
3300017717Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25EnvironmentalOpen in IMG/M
3300017719Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21EnvironmentalOpen in IMG/M
3300017725Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29EnvironmentalOpen in IMG/M
3300017727Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20EnvironmentalOpen in IMG/M
3300017730Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13EnvironmentalOpen in IMG/M
3300017731Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16EnvironmentalOpen in IMG/M
3300017742Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21EnvironmentalOpen in IMG/M
3300017743Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17EnvironmentalOpen in IMG/M
3300017748Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21EnvironmentalOpen in IMG/M
3300017749Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15EnvironmentalOpen in IMG/M
3300017753Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26EnvironmentalOpen in IMG/M
3300017767Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20EnvironmentalOpen in IMG/M
3300017776Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23EnvironmentalOpen in IMG/M
3300017783Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10EnvironmentalOpen in IMG/M
3300017786Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18EnvironmentalOpen in IMG/M
3300018642Metatranscriptome of marine microbial communities from Baltic Sea - GS695_0p1EnvironmentalOpen in IMG/M
3300020428Marine microbial communities from Tara Oceans - TARA_E500000331 (ERX556032-ERR599094)EnvironmentalOpen in IMG/M
3300020438Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942)EnvironmentalOpen in IMG/M
3300020440Marine microbial communities from Tara Oceans - TARA_E500000178 (ERX555952-ERR599043)EnvironmentalOpen in IMG/M
3300020468Marine microbial communities from Tara Oceans - TARA_A100000164 (ERX555914-ERR598993)EnvironmentalOpen in IMG/M
3300021389Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021959Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13DEnvironmentalOpen in IMG/M
3300022061Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v2)EnvironmentalOpen in IMG/M
3300022066Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 (v2)EnvironmentalOpen in IMG/M
3300022068Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2)EnvironmentalOpen in IMG/M
3300022074Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2)EnvironmentalOpen in IMG/M
3300022178Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3)EnvironmentalOpen in IMG/M
3300024059 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_2EnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300024518 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_2EnvironmentalOpen in IMG/M
3300025120Marine viral communities from the Pacific Ocean - LP-28 (SPAdes)EnvironmentalOpen in IMG/M
3300025128Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025137Marine viral communities from the Pacific Ocean - LP-32 (SPAdes)EnvironmentalOpen in IMG/M
3300025138Marine viral communities from the Pacific Ocean - LP-40 (SPAdes)EnvironmentalOpen in IMG/M
3300025168Marine viral communities from the Pacific Ocean - LP-53 (SPAdes)EnvironmentalOpen in IMG/M
3300025276Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes)EnvironmentalOpen in IMG/M
3300025508Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025543Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025705Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_10m (SPAdes)EnvironmentalOpen in IMG/M
3300025853Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes)EnvironmentalOpen in IMG/M
3300025870Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027081Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - C0912_C33A6_35 (SPAdes)EnvironmentalOpen in IMG/M
3300027196Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545 (SPAdes)EnvironmentalOpen in IMG/M
3300027280Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_48_BLW_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027686Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG108-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027704Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300028125Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SBEnvironmentalOpen in IMG/M
3300031519Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2EnvironmentalOpen in IMG/M
3300031622Marine microbial communities from Western Arctic Ocean, Canada - CB4_20mEnvironmentalOpen in IMG/M
3300031766Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 21515EnvironmentalOpen in IMG/M
3300031775Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 32315EnvironmentalOpen in IMG/M
3300031851Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515EnvironmentalOpen in IMG/M
3300033742Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawaterEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2011_1003337353300000115MarineKSMYKAQIMWAGSELKNYLENPAAVGEHTMLETMDELVGKIAEAEDKLVVLETSFLESAFNE*
DelMOSpr2010_1005964843300000116MarineMEDHKIRALKDHYKAQITWAASELQSYLEYPSAVGEHTFLETMDKLIQQIAENEDKMVVLETHFNE*
DelMOSpr2010_1018457223300000116MarineMEDHKIRALKDHYKAQITWAASELQSYLEYPSAVGEHTFLETMDKLVQQIAENEDKMVVLETHFDE*
DelMOSpr2010_1025672323300000116MarineMKGTKMEDHKIRALKDHYKAQITWAASELQSYLEYPSAVGEHTFLETMDKLVQQIAENEDKMVVLETHFDE*
DelMOWin2010_1007569023300000117MarineMEDHKIKALKSMYKAQIIWATSEFKNYLENPAAVGEHTMLETMDELVGKIAEAEDKLVVLETFFNE*
JGI24006J15134_1001282433300001450MarineMEDHKIRALKDHYKSQITWALSELQSYLEHPSAVGEHTFLETMDKLVQQVAENEDKMIILETHFNE*
JGI24006J15134_1001789023300001450MarineMYKAKIMWAGSELKNYLDNPVAVGEHTMLETMDELVGKIAESEDKLIVLETHFSE*
JGI24006J15134_1003340933300001450MarineMKDHKLEALKDHYKSQITWAASELTSYLEYPSAVGEHTFLETMDKLVQQIAENEDKLVVLETHFNE*
JGI24006J15134_1016928433300001450MarineMEDHKIRALKDYYKAQITWALSELQSYLEHPSAVGEHTFLETMDKLVQQVAENEDKMIILETHF
JGI24004J15324_1000145283300001472MarineMEDHKLKALKDHYKAQITWAASELTSYLEYPSAVGEHTFLETMDRLVQQVAENEDKLVVLETHFNE*
JGI24005J15628_1017684523300001589MarineMEDHKLKALKDHYKSQITWAASELTSYLEYPSAVGEHTFLETMDKLVQQVAENEDKLVVLETHFNE*
JGI24929J39151_101033733300002753MarineMEDHKIRALKDHYKAQITWAASELTSYLEYPSAVGEHTFLETMDKLVQQIAENEDKMVVL
JGI24928J39210_101170513300002754MarineMEDHKIRALKDHYKAQITWAASELTSYLEYPSAVGEHTFLETMDKLVQQIAENEDKMVVLETHFNE*
JGI26273J51734_1018013123300003620MarineMEDHKLRALKDHYKAQISWASSEITSYLEYPSAVGEHTFLETMDKLVHQIAEAEDKLVVLETHFNE*
Ga0066605_1004149663300004279MarineMEDHKIRALKDHYKAQITWAASELTSYLEYPSAVGEHTFLETMDKLVQKIAENEDKMVVLETHFNE*
Ga0065861_106391323300004448MarineMEDHKIRALKDHYKAQITWAASELQSYLEYPSAVGEHTFLETMDKLVQQIAENEDKMVVLETHFNE*
Ga0075441_1001871243300006164MarineMEDHKLRALKDHYKAQITWAASELTSYLEYPSAVGEHTFLETMDKLVQQIAENEDKLVVLETHFNE*
Ga0075441_1008325343300006164MarineMEDHKLRALKDHYKAQITWAASELTSYLEYPSAVGEHTFLETMDKLVQQIAENEDKLVVLETHFNG*
Ga0075443_1003695513300006165MarineYKAQITWAASELTSYLEYPSAVGEHTFLETMDKLVQQIAENEDKLVVLETHFNE*
Ga0075447_1006008013300006191MarineVTMEDHKLRALKDHYKSQITWAASELTSYLEYPSAVGEHTFLETMDKLVQQVAENEDKLVVLETHFNE*
Ga0075447_1012639233300006191MarineMEDHKLRALKDHYKSQITWAVSELTSYLEYPSAVGEHTFLETMDKLVQQIAENEDKMVVLETHFNE*
Ga0075448_1010466833300006352MarineMKDHKLEALKAHYKSQITWAASELTSYLEYPSAVGEHTFLETMDKLVQQIAENEDKLVVLETHFNG*
Ga0075467_1010346623300006803AqueousMKGTKMEDHKIRALKDYYKAQITWALSELQSYLEHPSAVGEHTFLETMDKLVQQVAENEDKMIILETHFSE*
Ga0075467_1022052123300006803AqueousMKGTKMEDHKIRALKDYYKAQITWALSELQSYLEHPSAVGEHTFLETMDKLVQQVAENEDKMIILETHFSD*
Ga0070754_1008271913300006810AqueousIRALKDYYKAQITWALSELQSYLEHPSAVGEHTFLETMDKLVQQVAENEDKMIILETHFSD*
Ga0070750_1008605023300006916AqueousMEDHKIKALKSMYKAQIMWAGSELKNYLENPAAVGEHTMLETMDELVGKISEAEDKLVVLETFFNE*
Ga0070750_1009032523300006916AqueousMEDHKLKALKSMYKAQIMWAGSELKNYLDNPAAVGEHTMLETMDELVGIAEAEDKLVVLETSFLETAFNE*
Ga0070750_1039060523300006916AqueousLKSMYKAQIMWAGSELKNYLENPAAVGEHTMLETMDELVGKIAEAEDKLVVLETSFLESAFNE*
Ga0070746_1021886023300006919AqueousMYKAQIIWAASELKNYLENPAAVGEHTMLETMDELVGKIAEAEDKLVVLETSFIETAFNE
Ga0098036_106780843300006929MarineMEDHKIKALKSMYKAKIMWAGSELKNYLENPAAVGEHTMLETMDELVGKIAEAEDKLVVLETHFSE*
Ga0070745_132510123300007344AqueousMEDHKIRALKDYYKAQITWALSELQSYLEHPSAVGEHTFLETMDKLVQQVAEN
Ga0070752_102442843300007345AqueousVKDHKIRALKDYYKAQITWALSELQSYLEHPSAVGEHTFLETMDKLVQQVAENEDKMIILETHFNE*
Ga0099849_110906733300007539AqueousMEDHKIRALKDYYKAQITWALSELQSYLEHPSAVGEHTFLETMDKLVQQVAENEDKMIILETHFSD*
Ga0099847_119548933300007540AqueousMEDHKIRALKDRYKAQISWASSEIKSYLEYPSAVGEHTFLETMDKLVHQIAEAEDK
Ga0102817_111682823300007555EstuarineMEDHRIKALKSMYKAQIMWAGSELKNYLDNPVAVGEHTMLETMDELVGKIAESEDKLIVLETHFSE*
Ga0105737_108183823300007862Estuary WaterMEDHKIRALKNYYKAQITWALSELQSYLEHPSAVGEHTFLETMDKLVQQVAENEDKMIILETHFSD*
Ga0105744_109053233300007863Estuary WaterMEDHKIRALKDHYKAQITWAASELTSYLEYPSAVGEHTFLETMDKLVHQIAEAEDKLVVLETHFNE*
Ga0105741_107672313300007956Estuary WaterTKMEDHKIRALKNYYKAQITWALSELQSYLEHPSAVGEHTFLETMDKLVQQIAENEDKMVVLETHFNE*
Ga0102891_107854423300008950EstuarineMEDHKIRALKDHYKAQITWAASELTSYLEYPSAVGEHTFLETMDKLVHQIAENEDKMVVLETHFNE*
Ga0102816_128825813300008999EstuarineMEDHKIRALKDYYKAQITWAASELTSYLEHPSAVGEHTFLETMDKLVQQIAENEDKMIVLETHFN*
Ga0102812_1026817143300009086EstuarineMEDHKIRALKDHYKAQISWASSEITSYLEYPSAVGEHTFLETMDKLVHQIAEAEDKLVVLETHFNE*
Ga0114903_105209623300009412Deep OceanMEDHKIKALKSMYKAQIIWANSELKNYLENPVAVGEHTMLETMDELVGKIAESEDKLVVLETHFSE*
Ga0114909_114445313300009414Deep OceanMEDHKIKALKSMYKAQIIWANSELKNYLENPAAVGEHTMLETMDELVGKIAEAEDKLVVLETFFNE*
Ga0114994_1042327523300009420MarineMEDHKIRALKNHYKAQITWALSELQSYLEHPSAVGEHTFLETMDKLVQQVAENEDKMIILETHFSE*
Ga0115008_1010973843300009436MarineMEDHKIRALKDYYKAQITWALSELQSYLEHPSAVGEHTFLETMDKLVQQVAENEDKMIILETHFSE*
Ga0115003_1036299433300009512MarineIYWRKVTMEDHKLKALKDHYKSQITWAASELTSYLEYPSAVGEHTFLETMDKLVQQIAENEDKLVVLETHFNE*
Ga0114911_107626423300009603Deep OceanMEDHKIKALKSMYKAQIIWANSELKNYLENPAAVGEHTMLETMDELVGKIAESEDKLVVLETHFSE*
Ga0114933_1097114713300009703Deep SubsurfaceKAQIIWANSELKNYLENPAAVGEHTMLETMDELVGKIAESEDKLVVLETHFSE*
Ga0098059_126411133300010153MarineMEDHKIKALKSMYKAQIMWAGSELKNYLENPAAVGEHTMLETMDELVGKIAEAEDKLVVL
Ga0133547_1211667023300010883MarineMEDHKLKALKDHYKSQITWAASELTSYLEYPSAVGEHTFLETMDKLVQQIAENEDKMVVLETHFNE*
Ga0151673_10286633300011245MarineMEDHKIRALKDHYKAQITWAASELQSYLEYPSAVGEHTFLETMDKLVQQIAEERRQNSSIGDTL*
Ga0151670_100647733300011248MarineMEDHKIRALKDHYKAQISWASSEITSYLEYPSAVGEHTFLDTMDKLVHQIAEAEDKLVVLETHFNE*
Ga0181403_101528733300017710SeawaterMEDHRIKALKSMYKAKIMWAGSELKNYLDNPVAVGEHTMLETMDELIGKIAESEDKLIVLETHFSE
Ga0181403_103026233300017710SeawaterMEDHKIRALKDYYKAQITWGLSELQSYLEHPSAVGEHTFLETMDKLVQQVAENEDKMIILETHFSD
Ga0181404_1003021123300017717SeawaterMEDHRIKALKSMYKAQIMWAGSELKNYLENPAAVGEHTMLETMDELVGKIAESEDKLIVLETHFSE
Ga0181390_102304943300017719SeawaterMEDHKIRALKDHYKAQISWASSEITSYLEYPSAVGEHTFLETMDKLVHQIAEAEDKLVVLETHFNE
Ga0181398_105112423300017725SeawaterMYKAKIMWAGSELKNYLDNPVAVGEHTMLETMDELVGKIAESEDKLIVLETHFSE
Ga0181401_105136813300017727SeawaterMEDHKLRALKDHYKAQISWASSEITSYLEYPSAVGEHTFLETMDKLVQQIAENEDKMVVLETHFDE
Ga0181417_101581223300017730SeawaterMYKAQIIWAASELKNYLENPAAVGEHTMLETMDELVGKIAEAEDKLVVLETSFLETAFNE
Ga0181416_100133653300017731SeawaterMYKAQIMWAGSELKNYLDNPVAVGEHTMLETMDELVGKIAESEDKLIVLETHFSE
Ga0181399_110830033300017742SeawaterALKDYYKAQITWALSELQSYLEHPSAVGEHTFLETMDKLVQQIAENEDKMVVLETHFDE
Ga0181399_117779113300017742SeawaterMEDHKIRALKDHYKAQITWAASELTSYLEYPSAVGEHTFLETMDKLVQQIAENEDKMVVLETHFN
Ga0181402_108571833300017743SeawaterMEDHKIRALKDYYKAQITWGLSELQSYLEHPSAVGEHTFLETMDKLVQQVAENEDKMIILETHFSE
Ga0181393_101493933300017748SeawaterMYKAQIIWATSEFKNYLENPAAVGEHTMLETMDELVGKIAEAEDKLVVLETFFNE
Ga0181393_113269633300017748SeawaterMEDHKIRALKNYYKAQITWALSELQSYLEHPSAVGEHTFLETMDKLVQQVAENEDKMIILET
Ga0181392_101312933300017749SeawaterMEDHKLRALKDHYKANINWAISELTSYLEYPSAVGEHMFLDTMDKLIQRVAEAEDKLVVLETHFNE
Ga0181407_100656843300017753SeawaterMYKAQIMWAGSELKNYIENPAAVGEHTMLETMDELVGKIAGAEDKLVVLETSFLESAFNE
Ga0181406_102543113300017767SeawaterVKRAMEDHRIKALKSMYKAQIMWAGSELKNYLENPAAVGEHTMLETMDELVGKIAGAEDKLVVLETSFLESAFNE
Ga0181394_119784623300017776SeawaterMEDHKIRALKDHYKAQITWATSELTSYLEYPSAVGEHTFLETMDKLVQQIAENEDKMVVLETHFNE
Ga0181394_126073923300017776SeawaterMEDHKIRALKDYYKAQITWALSELQSYLEHPSAVGEHTFLETMDKLVQQIAENEDKLVVLETHFNE
Ga0181379_101373033300017783SeawaterMKGTKMEDHKIRALKDHCKAQITWAASELQSYLEYPSAVGEHTFLETMDKLVQQIAENEDKMVVLETHFDE
Ga0181379_124980623300017783SeawaterMEDHKIRALKDYYKAQITWALSELQSYLEHPSAVGEHTFLETMDKLVQQVAENEDKIIILETHFSD
Ga0181424_1001482653300017786SeawaterMEDHKLKALKSMYKAQIMWAGSELKNYLDNPVAVGEHTMLETMDELVGKIAESEDKLIVLETHFSE
Ga0188867_100014033300018642Freshwater LakeMEDHKIRALKDYYKAQITWALSELQSYLEHPSAVGEHTFLETMDKLVQQVAENEDKLIILERHFDE
Ga0211521_10017777133300020428MarineKSMYKAQIIWANSELKNYLENPAAVGEHTMLETMDELVGKIAESEDKLVVLETHFSE
Ga0211576_1006151823300020438MarineMYKAQIMWAGSELKNYLENPAAVGEHTMLETMDELVGKIAGAEDKLVVLETSFLESAFNE
Ga0211518_1039225113300020440MarineKRKMEDHKIKALKSMYKAQIIWANSELKNYLENPAAVGEHTMLETMDELVGKIAEAEDKLVVLETFFNE
Ga0211475_1022883523300020468MarineMYKAQIIWATSELKNYLENPAAVGEHTMLETMDKLVGKIAEAEDKLVVLETFFNE
Ga0213868_1025021713300021389SeawaterMEDHRLKALKSMYKAQIMWAGSELKNYLDNPAAVGEHTMLETMDELVGKIAEAEDKL
Ga0222717_1002399163300021957Estuarine WaterMEDHKIRALKDHYKANINWAISELTSYLEYPSAVGEHMFLDTMDKLIQRVAEAEDKLVVLETHFNE
Ga0222717_1027566533300021957Estuarine WaterMEDHKIRALKDHYKAQITWAASELTSYLEYPSAVGEHTFLETMDKLVQQIAENEDKMVVLETHFNE
Ga0222716_1034911823300021959Estuarine WaterMEDHKLRALKDHYKAQISWASSEITSYLEYPSAVGEHTFLETMDKLVHQIAEAEDKLVVLETHFNE
Ga0212023_102514623300022061AqueousMKGTKMEDHKIRALKDYYKAQITWALSELQSYLEHPSAVGEHTFLETMDKLVQQVAENEDKMIILETHFSE
Ga0212023_106156723300022061AqueousMEDHKIRALKDHYKAQITWAASELQSYLEYPSAVGEHTFLETMDKLVQQIAENEDKMVVLETHFNE
Ga0224902_10239423300022066SeawaterKHGGVKRAMEDHRIKALKSMYKAKIMWAGSELKNYLDNPVAVGEHTMLETMDELVGKIAESEDKLIVLETHFSE
Ga0212021_101999723300022068AqueousMEDHKIKALKSMYKAQIMWAGSELKNYLENPAAVGEHTMLETMDELVGKISEAEDKLVVLETFFNE
Ga0224906_113209623300022074SeawaterMEDHRIKALKSMYKAQIMWAGSELKNYLENPAAVGEHTMLETMDELVGKIAGAEDKLVVLETSFLESAFNE
Ga0196887_102494033300022178AqueousMKGTKMEDHKIRALKDYYKAQITWALSELQSYLEHPSAVGEHTFLETMDKLVQQVAENEDKMII
(restricted) Ga0255040_1001905933300024059SeawaterMEDHKIRALKDYYKAQITWALSELQSYLEHPSAVGEHTFLETMDKLVQQVAENEDKMIILETHFSE
Ga0244775_1011765543300024346EstuarineMEDHRIKALKSMYKAQIMWAGSELKNYLDNPVAVGEHTMLETMDELVGKIAESEDKLIVLETHFSE
Ga0244775_1036500333300024346EstuarineMKGTKMEDHKIRALKDHYKAQITWAASELQSYLEYPSAVGEHTFLETMDKLVQQIAENEDKMVVLETHFDE
(restricted) Ga0255048_1021423323300024518SeawaterMEDHKIRALKDYYKAQITWALSELQSYLEHPSAVGEHTFLETMDKLVQQVAENEDKMIILETHFNE
Ga0209535_110450233300025120MarineMEDHKIRALKDYYKAQITWALSELQSYLEHPSAVGEHTFLETMDKLVQQVAENEDKMIILETHFSD
Ga0209535_117283413300025120MarineKVTMKGTKMEDHKIRALKDHYKAQITWAASELQSYLEYPSAVGEHTFLETMDKLVQQIAENEDKMVVLETHFDE
Ga0208919_107021443300025128MarineMEDHKIKALKSMYKAKIMWAGSELKNYLENPAAVGEHTMLETMDELVGKIAEAEDKLVVLETHFSE
Ga0209336_1006401833300025137MarineMEDHKLKALKDHYKAQITWAASELTSYLEYPSAVGEHTFLETMDRLVQQVAENEDKLVVLETHFNE
Ga0209336_1009519033300025137MarineMEDHKIRALKDHYKAQITWAASELTSYLEYPSAVGEHTFLETMDKLVQQIAENEDKLVVLETHFNE
Ga0209336_1019274623300025137MarineMEDHRIKALKSMYKAKIMWAGSELKNYLDNPVAVGEHTMLETMDELVGKIAESEDKLIVLETHFSE
Ga0209634_1000946333300025138MarineMKDHKLEALKDHYKSQITWAASELTSYLEYPSAVGEHTFLETMDKLVQQIAENEDKLVVLETHFNE
Ga0209634_132145933300025138MarineHKLKALKDHYKSQITWAASELTSYLEYPSAVGEHTFLETMDKLVQQVAENEDKLVVLETHFNE
Ga0209337_120369713300025168MarineMEDHKIRALKDYYKAQITWALSELQSYLEHPSAVGEHTFLETMDKLVQQVAENEDKMIIL
Ga0209337_133704533300025168MarineDHKLKALKDHYKSQITWAASELTSYLEYPSAVGEHTFLETMDKLVQQVAENEDKLVVLETHFNE
Ga0208814_101444843300025276Deep OceanMEDHKLRALKDHYKAQITWAASELTSYLEYPSAVGEHTFLETMDKLVQQIAENEDKLVVLETHFNG
Ga0208148_109040813300025508AqueousLKDHYKAQITWAASELQSYLEYPSAVGEHTFLETMDKLVQQIAENEDKMVVLETHFNE
Ga0208303_110416213300025543AqueousMEDHKIRALKDRYKAQISWASSEIKSYLEYPSAVGEHTFLETMDKLVHQIAEAED
Ga0209374_102924633300025705MarineMEDHKIRALKDHYKAQITWAASELTSYLEYPSAVGEHTFLETMDKLVQKIAENEDKMVVLETHFNE
Ga0208645_119352813300025853AqueousTKMEDHKIRALKDYYKAQITWALSELQSYLEHPSAVGEHTFLETMDKLVQQVAENEDKMIILETHFSD
Ga0209666_121460813300025870MarineYWRKDTMEDHKIRALKDHYKAQITWAASELTSYLEYPSAVGEHTFLETMDKLVQQIAENEDKMVVLETHFNE
Ga0208954_105130223300027081MarineMEDHKIRALKDHYKAQITWALSELQSYLEHPSAVGEHTFLETMDKLVQQVAENEDKMIILETHFSD
Ga0208438_106911813300027196EstuarineMKGTKMEDHKIRALKDHYKAQITWAASELQSYLEYPSAVGEHTFLETMDKLVQQIAENEDKMVVLETH
Ga0208972_105326623300027280MarineMEDHKIRALKNYYKAQITWALSELQSYLEHPSAVGEHTFLETMDKLVQQVAENEDKMIILETHFSD
Ga0209071_109111533300027686MarineYKSQITWAASELTSYLEYPSAVGEHTFLETMDKLVQQIAENEDKLVVLETHFNG
Ga0209816_104188353300027704MarineHYKAQITWAASELTSYLEYPSAVGEHTFLETMDKLVQQIAENEDKLVVLETHFNE
Ga0209816_112029033300027704MarineMEDHKLRALKDHYKSQITWAVSELTSYLEYPSAVGEHTFLETMDKLVQQIAENEDKMVVLETHFNE
Ga0256368_105045023300028125Sea-Ice BrineMEDHKIRALKNHYKAQITWALSELQSYLEHPSAVGEHTFLETMDKLVQQVAENEDKMIILETHFSE
Ga0307488_1004528113300031519Sackhole BrineMEDHKIRALKDHYKAQITWALSELQSYLEHPSAVGEHTFLETMDKLVQQVAENEDKMIILETHFSE
Ga0307488_1005974243300031519Sackhole BrineMEDHKLKALKDHYKSQITWAASELTSYLEYPSAVGEHTFLETMDKLVQQIAENEDKMVVLETHFNE
Ga0302126_1033429323300031622MarineMEDHKIRALKDHYKSQITWALSELQSYLEHPSAVGEHTFLETMDKLVQQVAENEDKMIILETHFNE
Ga0315322_1030765233300031766SeawaterMEDHKIRALKDYYKAQITWAASELTSYLEYPSAVGEHTFLETMDKLVQQIAENEDKMVVLETHFNE
Ga0315322_1046511233300031766SeawaterKVTTKGTKMEDHKIRALKDYYKAQITWALSELQSYLEHPSAVGEHTFLETMDKLVQQVAENEDKMIILETHFND
Ga0315326_1004818013300031775SeawaterRALKDYYKAQITWAASELTSYLEYPSAVGEHTFLETMDKLVQQIAENEDKMVVLETHFNE
Ga0315326_1100630113300031775SeawaterMEDHKIRALKDHYKAQITWAASELTSYLEYPSAVGEHTFLETMDKLVQQIAEN
Ga0315320_1000953233300031851SeawaterMEDHKIRALKDHYKAQITWGLSELQSYLEHPSAVGEHTFLETMDKLVQQVAENEDKMIILETHFNE
Ga0314858_078079_93_2933300033742Sea-Ice BrineMEDHKLKALKDHYKSQITWAASELTSYLEYPSAVGEHTFLETMDKLVQQVAENEDKLVVLETHFNE


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.