Basic Information | |
---|---|
Family ID | F068265 |
Family Type | Metagenome |
Number of Sequences | 125 |
Average Sequence Length | 45 residues |
Representative Sequence | MAKKKQPAAVPVKDGLFFPEDFTKLHRRHVIYIKKGVIIDLDKL |
Number of Associated Samples | 72 |
Number of Associated Scaffolds | 125 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 81.60 % |
% of genes near scaffold ends (potentially truncated) | 18.40 % |
% of genes from short scaffolds (< 2000 bps) | 65.60 % |
Associated GOLD sequencing projects | 66 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.53 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (76.800 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment (16.800 % of family members) |
Environment Ontology (ENVO) | Unclassified (35.200 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Sediment (saline) (29.600 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 8.33% β-sheet: 19.44% Coil/Unstructured: 72.22% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 125 Family Scaffolds |
---|---|---|
PF13401 | AAA_22 | 3.20 |
PF01656 | CbiA | 0.80 |
PF12846 | AAA_10 | 0.80 |
PF03050 | DDE_Tnp_IS66 | 0.80 |
PF10431 | ClpB_D2-small | 0.80 |
PF14216 | DUF4326 | 0.80 |
PF02781 | G6PD_C | 0.80 |
PF00216 | Bac_DNA_binding | 0.80 |
PF13814 | Replic_Relax | 0.80 |
PF04343 | DUF488 | 0.80 |
PF00589 | Phage_integrase | 0.80 |
PF13419 | HAD_2 | 0.80 |
PF05872 | HerA_C | 0.80 |
PF01935 | DUF87 | 0.80 |
PF13646 | HEAT_2 | 0.80 |
PF06067 | DUF932 | 0.80 |
COG ID | Name | Functional Category | % Frequency in 125 Family Scaffolds |
---|---|---|---|
COG0364 | Glucose-6-phosphate 1-dehydrogenase | Carbohydrate transport and metabolism [G] | 0.80 |
COG0433 | Archaeal DNA helicase HerA or a related bacterial ATPase, contains HAS-barrel and ATPase domains | Replication, recombination and repair [L] | 0.80 |
COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 0.80 |
COG3189 | Uncharacterized conserved protein YeaO, DUF488 family | Function unknown [S] | 0.80 |
COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.80 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 91.20 % |
Unclassified | root | N/A | 8.80 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001371|BBDRAFT_10313636 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 12251 | Open in IMG/M |
3300001751|JGI2172J19969_10122006 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 745 | Open in IMG/M |
3300001751|JGI2172J19969_10234485 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 501 | Open in IMG/M |
3300001752|JGI2173J19968_10023774 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 2122 | Open in IMG/M |
3300001752|JGI2173J19968_10035588 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1660 | Open in IMG/M |
3300001752|JGI2173J19968_10052200 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 1295 | Open in IMG/M |
3300001752|JGI2173J19968_10104345 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 822 | Open in IMG/M |
3300002052|SMTZ1_10006097 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 13720 | Open in IMG/M |
3300002231|KVRMV2_100599475 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 928 | Open in IMG/M |
3300003988|Ga0055475_10264022 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 549 | Open in IMG/M |
3300004481|Ga0069718_13968060 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 1466 | Open in IMG/M |
3300005612|Ga0070723_10289001 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 771 | Open in IMG/M |
3300005613|Ga0074649_1011853 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 5938 | Open in IMG/M |
3300005613|Ga0074649_1034546 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 2458 | Open in IMG/M |
3300005782|Ga0079367_1076981 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 1380 | Open in IMG/M |
3300005832|Ga0074469_11285696 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 2804 | Open in IMG/M |
3300008470|Ga0115371_10558045 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 611 | Open in IMG/M |
3300008516|Ga0111033_1161762 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1813 | Open in IMG/M |
3300008516|Ga0111033_1231689 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1113 | Open in IMG/M |
3300008516|Ga0111033_1282157 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 2329 | Open in IMG/M |
3300009034|Ga0115863_1122998 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 3204 | Open in IMG/M |
3300009034|Ga0115863_1304035 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1878 | Open in IMG/M |
3300009128|Ga0118727_1058304 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 3741 | Open in IMG/M |
3300009149|Ga0114918_10000347 | All Organisms → cellular organisms → Bacteria | 39924 | Open in IMG/M |
3300009149|Ga0114918_10002244 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 17359 | Open in IMG/M |
3300009149|Ga0114918_10617055 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 573 | Open in IMG/M |
3300009150|Ga0114921_10370060 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1033 | Open in IMG/M |
3300009150|Ga0114921_10668111 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 766 | Open in IMG/M |
3300009150|Ga0114921_10703624 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 746 | Open in IMG/M |
3300009320|Ga0117909_1305144 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 1112 | Open in IMG/M |
3300009488|Ga0114925_10355573 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1004 | Open in IMG/M |
3300009488|Ga0114925_11489376 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 503 | Open in IMG/M |
3300009499|Ga0114930_10049226 | Not Available | 2592 | Open in IMG/M |
3300009499|Ga0114930_10437347 | Not Available | 599 | Open in IMG/M |
3300009513|Ga0129285_10401282 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Latescibacteria → unclassified Candidatus Latescibacteria → Candidatus Latescibacteria bacterium | 621 | Open in IMG/M |
3300009528|Ga0114920_10173317 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1424 | Open in IMG/M |
3300009529|Ga0114919_10178472 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 1520 | Open in IMG/M |
3300009529|Ga0114919_10541193 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 801 | Open in IMG/M |
3300009529|Ga0114919_11202054 | Not Available | 506 | Open in IMG/M |
3300010392|Ga0118731_103514220 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1004 | Open in IMG/M |
3300010392|Ga0118731_108998055 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 697 | Open in IMG/M |
3300010392|Ga0118731_113737116 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 536 | Open in IMG/M |
3300010430|Ga0118733_103382818 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 867 | Open in IMG/M |
3300010430|Ga0118733_106093616 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 631 | Open in IMG/M |
3300011118|Ga0114922_10062017 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 3244 | Open in IMG/M |
3300011118|Ga0114922_11493130 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 543 | Open in IMG/M |
3300011118|Ga0114922_11598981 | Not Available | 523 | Open in IMG/M |
3300012931|Ga0153915_12469971 | Not Available | 608 | Open in IMG/M |
3300013089|Ga0163203_1058592 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1129 | Open in IMG/M |
(restricted) 3300013130|Ga0172363_10300019 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 1062 | Open in IMG/M |
(restricted) 3300013130|Ga0172363_10572831 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 717 | Open in IMG/M |
3300014208|Ga0172379_10000226 | All Organisms → cellular organisms → Bacteria | 153588 | Open in IMG/M |
3300014903|Ga0164321_10363640 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 704 | Open in IMG/M |
3300014911|Ga0180301_10007151 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 8471 | Open in IMG/M |
3300017963|Ga0180437_10000135 | All Organisms → cellular organisms → Bacteria | 156395 | Open in IMG/M |
3300017963|Ga0180437_10203845 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 1554 | Open in IMG/M |
3300017963|Ga0180437_10272860 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1297 | Open in IMG/M |
3300017971|Ga0180438_10989986 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 609 | Open in IMG/M |
3300017987|Ga0180431_10001396 | All Organisms → cellular organisms → Bacteria | 33828 | Open in IMG/M |
3300017987|Ga0180431_10060311 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 3345 | Open in IMG/M |
3300017987|Ga0180431_10146957 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1864 | Open in IMG/M |
3300017991|Ga0180434_10163164 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1807 | Open in IMG/M |
3300017991|Ga0180434_11140089 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 584 | Open in IMG/M |
3300022553|Ga0212124_10039760 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 2839 | Open in IMG/M |
3300024262|Ga0210003_1000433 | All Organisms → cellular organisms → Bacteria | 37918 | Open in IMG/M |
3300024262|Ga0210003_1002028 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 17368 | Open in IMG/M |
3300024353|Ga0209979_1029787 | Not Available | 2940 | Open in IMG/M |
(restricted) 3300024519|Ga0255046_10508085 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 578 | Open in IMG/M |
(restricted) 3300024529|Ga0255044_10154728 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 879 | Open in IMG/M |
3300025309|Ga0209212_1080030 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 2129 | Open in IMG/M |
3300027555|Ga0207752_1000309 | All Organisms → cellular organisms → Bacteria | 23304 | Open in IMG/M |
3300027740|Ga0214474_1345744 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 521 | Open in IMG/M |
(restricted) 3300027865|Ga0255052_10524863 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 581 | Open in IMG/M |
(restricted) 3300027872|Ga0255058_10281709 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 801 | Open in IMG/M |
(restricted) 3300027881|Ga0255055_10624825 | Not Available | 576 | Open in IMG/M |
3300027888|Ga0209635_10031411 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 4302 | Open in IMG/M |
3300027888|Ga0209635_10079162 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 2688 | Open in IMG/M |
3300027888|Ga0209635_10396621 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1074 | Open in IMG/M |
3300027888|Ga0209635_10550696 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 871 | Open in IMG/M |
3300027893|Ga0209636_11031388 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 601 | Open in IMG/M |
3300027901|Ga0209427_10007720 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 12149 | Open in IMG/M |
3300027901|Ga0209427_10066035 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 3363 | Open in IMG/M |
3300027901|Ga0209427_10411473 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1042 | Open in IMG/M |
3300027901|Ga0209427_10455447 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 975 | Open in IMG/M |
3300027901|Ga0209427_10489521 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 929 | Open in IMG/M |
3300027901|Ga0209427_11144350 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 517 | Open in IMG/M |
3300027917|Ga0209536_100263149 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 2160 | Open in IMG/M |
3300027917|Ga0209536_100956946 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1056 | Open in IMG/M |
3300027917|Ga0209536_102204356 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 656 | Open in IMG/M |
3300028167|Ga0268285_1070801 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 817 | Open in IMG/M |
3300028883|Ga0272443_10069244 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 2056 | Open in IMG/M |
3300028883|Ga0272443_10349273 | Not Available | 698 | Open in IMG/M |
3300028920|Ga0272441_10043774 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 5154 | Open in IMG/M |
3300028920|Ga0272441_10054210 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 4438 | Open in IMG/M |
3300028920|Ga0272441_10090616 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 3097 | Open in IMG/M |
3300028920|Ga0272441_10155236 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 2129 | Open in IMG/M |
3300028920|Ga0272441_10216317 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1704 | Open in IMG/M |
3300028920|Ga0272441_11428662 | Not Available | 510 | Open in IMG/M |
3300030613|Ga0299915_10026739 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 4320 | Open in IMG/M |
3300030616|Ga0272442_10060140 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 3675 | Open in IMG/M |
3300030616|Ga0272442_10075105 | Not Available | 3151 | Open in IMG/M |
3300030616|Ga0272442_10237944 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 1357 | Open in IMG/M |
3300030616|Ga0272442_10726103 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 608 | Open in IMG/M |
3300031539|Ga0307380_10063908 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 3961 | Open in IMG/M |
3300031539|Ga0307380_10124760 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 2604 | Open in IMG/M |
3300031539|Ga0307380_10135238 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 2474 | Open in IMG/M |
3300031539|Ga0307380_10261129 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 1630 | Open in IMG/M |
3300031539|Ga0307380_10605946 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 941 | Open in IMG/M |
3300031539|Ga0307380_10745932 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 817 | Open in IMG/M |
3300031565|Ga0307379_10339077 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 1465 | Open in IMG/M |
3300031566|Ga0307378_11511758 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 511 | Open in IMG/M |
3300031586|Ga0315541_1004834 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 9681 | Open in IMG/M |
3300031624|Ga0315545_1314108 | Not Available | 526 | Open in IMG/M |
3300031698|Ga0315537_1292739 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium | 647 | Open in IMG/M |
3300031698|Ga0315537_1402858 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 509 | Open in IMG/M |
3300031707|Ga0315291_10521528 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 1097 | Open in IMG/M |
3300031746|Ga0315293_10155576 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 1905 | Open in IMG/M |
3300031885|Ga0315285_10791297 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 596 | Open in IMG/M |
3300031999|Ga0315274_10225110 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 2302 | Open in IMG/M |
3300032029|Ga0315546_1091485 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 758 | Open in IMG/M |
3300032046|Ga0315289_11230633 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 600 | Open in IMG/M |
3300032053|Ga0315284_10012243 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 12221 | Open in IMG/M |
3300032069|Ga0315282_10169382 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 1669 | Open in IMG/M |
3300032156|Ga0315295_10239289 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 1830 | Open in IMG/M |
3300033513|Ga0316628_100723859 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1307 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 16.80% |
Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 16.00% |
Marine Sediment | Environmental → Aquatic → Marine → Wetlands → Sediment → Marine Sediment | 9.60% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 8.00% |
Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 7.20% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 6.40% |
Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 5.60% |
Salt Marsh Sediment | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment | 4.00% |
Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 2.40% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.60% |
Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.60% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.60% |
Sediment, Intertidal | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Sediment, Intertidal | 1.60% |
Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 1.60% |
Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 1.60% |
Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment | 1.60% |
Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.80% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.80% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.80% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.80% |
Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Estuarine | 0.80% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.80% |
Enviromental | Environmental → Aquatic → Marine → Unclassified → Unclassified → Enviromental | 0.80% |
Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.80% |
Seawater | Environmental → Aquatic → Marine → Gulf → Unclassified → Seawater | 0.80% |
Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.80% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.80% |
Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.80% |
Beach Aquifer Porewater | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Beach Aquifer Porewater | 0.80% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.80% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.80% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.80% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001371 | Baker-B-sed | Environmental | Open in IMG/M |
3300001751 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-30_32 | Environmental | Open in IMG/M |
3300001752 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-36_30 | Environmental | Open in IMG/M |
3300002052 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-36_30 | Environmental | Open in IMG/M |
3300002231 | Marine sediment microbial communities from Santorini caldera mats, Greece - red mat | Environmental | Open in IMG/M |
3300003988 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_CordB_D2 | Environmental | Open in IMG/M |
3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
3300005612 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2 | Environmental | Open in IMG/M |
3300005613 | Saline sediment microbial communities from Etoliko Lagoon, Greece - sediment | Environmental | Open in IMG/M |
3300005782 | Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 125 cmbsf, PM3 | Environmental | Open in IMG/M |
3300005832 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.41_BBB | Environmental | Open in IMG/M |
3300008470 | Sediment core microbial communities from Adelie Basin, Antarctica. Combined Assembly of Gp0136540, Gp0136562, Gp0136563 | Environmental | Open in IMG/M |
3300008516 | Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 125 cmbsf. Combined Assembly of MM3PM3 | Environmental | Open in IMG/M |
3300009034 | Intertidal mud flat sediment archaeal communities from Garolim Bay, Chungcheongnam-do, Korea | Environmental | Open in IMG/M |
3300009128 | Combined Assembly of Gp0137084, Gp0137083 | Environmental | Open in IMG/M |
3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
3300009150 | Deep subsurface microbial communities from South Atlantic Ocean to uncover new lineages of life (NeLLi) - Benguela_00093 metaG | Environmental | Open in IMG/M |
3300009320 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 900m, 250-2.7um, replicate b | Environmental | Open in IMG/M |
3300009488 | Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00607 metaG | Environmental | Open in IMG/M |
3300009499 | Deep subsurface microbial communities from Anholt, Denmark to uncover new lineages of life (NeLLi) - Anholt_01485 metaG | Environmental | Open in IMG/M |
3300009513 | Microbial community of beach aquifer porewater from Cape Shores, Lewes, Delaware, USA - F-1Y | Environmental | Open in IMG/M |
3300009528 | Deep subsurface microbial communities from South Pacific Ocean to uncover new lineages of life (NeLLi) - Chile_00310 metaG | Environmental | Open in IMG/M |
3300009529 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG | Environmental | Open in IMG/M |
3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
3300011118 | Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaG | Environmental | Open in IMG/M |
3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
3300013089 | Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_330m | Environmental | Open in IMG/M |
3300013130 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment s2_kivu2a2 | Environmental | Open in IMG/M |
3300014208 | Groundwater microbial communities from an aquifer near a municipal landfill in Southern Ontario, Canada - Groundwater well OW334 metaG | Environmental | Open in IMG/M |
3300014903 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay12, Core 4567-28, 21-24 cm | Environmental | Open in IMG/M |
3300014911 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay16, Core 4569-2, 12-15 cm | Environmental | Open in IMG/M |
3300017963 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_1 metaG | Environmental | Open in IMG/M |
3300017971 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_2 metaG | Environmental | Open in IMG/M |
3300017987 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_MS_1 metaG | Environmental | Open in IMG/M |
3300017991 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_2 metaG | Environmental | Open in IMG/M |
3300022553 | Powell_combined assembly | Environmental | Open in IMG/M |
3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
3300024353 | Deep subsurface microbial communities from Anholt, Denmark to uncover new lineages of life (NeLLi) - Anholt_01485 metaG (SPAdes) | Environmental | Open in IMG/M |
3300024519 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27 | Environmental | Open in IMG/M |
3300024529 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_21 | Environmental | Open in IMG/M |
3300025309 | Soil microbial communities from Rifle, Colorado, USA - Groundwater C2 | Environmental | Open in IMG/M |
3300027555 | Marine sediment microbial community from Union City, CA, USA - Pond 2C Sediment 2 (SPAdes) | Environmental | Open in IMG/M |
3300027740 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214 HiSeq | Environmental | Open in IMG/M |
3300027865 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_21 | Environmental | Open in IMG/M |
3300027872 (restricted) | Seawater microbial communities from Amundsen Gulf, Northwest Territories, Canada - Cases_109_9 | Environmental | Open in IMG/M |
3300027881 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_27 | Environmental | Open in IMG/M |
3300027888 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-30_32 (SPAdes) | Environmental | Open in IMG/M |
3300027893 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-52-54 (SPAdes) | Environmental | Open in IMG/M |
3300027901 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-36_30 (SPAdes) | Environmental | Open in IMG/M |
3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
3300028167 | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2013_06_06_120m | Environmental | Open in IMG/M |
3300028883 | Marine sediment archaeal communities from Little Sippewissett salt marsh, Falmouth, MA, United States - SSM-Acet-12 | Environmental | Open in IMG/M |
3300028920 | Marine sediment archaeal communities from Little Sippewissett salt marsh, Falmouth, MA, United States - SSM-Prop-6N | Environmental | Open in IMG/M |
3300030613 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT92D227 | Environmental | Open in IMG/M |
3300030616 | Marine sediment archaeal communities from Little Sippewissett salt marsh, Falmouth, MA, United States - SSM-Form-2O | Environmental | Open in IMG/M |
3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
3300031566 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-1 | Environmental | Open in IMG/M |
3300031586 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-190 | Environmental | Open in IMG/M |
3300031624 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1602-10 | Environmental | Open in IMG/M |
3300031698 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1602-70 | Environmental | Open in IMG/M |
3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
3300032029 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-170 | Environmental | Open in IMG/M |
3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
3300032069 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_20 | Environmental | Open in IMG/M |
3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
BBDRAFT_103136369 | 3300001371 | Marine Estuarine | MGNNKTASVRIKDGMFFPEDFRKLLRNHVIYIKTGIIIDLDRL* |
JGI2172J19969_101220062 | 3300001751 | Marine Sediment | LLLSDVGGVLKMAKRNQSAAVPVKDAMFFPEDFTKLHRRYVILIKKGVIIDLDKL* |
JGI2172J19969_102344851 | 3300001751 | Marine Sediment | VSDVQGVLNMAKRKQSAAVPVKDAMFFPEDFMKLHRRHVIFIKKGVIIDLDKLG* |
JGI2173J19968_100237745 | 3300001752 | Marine Sediment | MAKRNQSAAVPVKDAMFFPEDFTKLHRRYVILIKK |
JGI2173J19968_100355883 | 3300001752 | Marine Sediment | MSDVGGVLKMAKRKQSAAVPVKDAMFFPEDFTRLHRKHVIYIKKGVIIDLDKL* |
JGI2173J19968_100522004 | 3300001752 | Marine Sediment | PVKDAMFFPEDFTKLHRRYVILIKKGVIIDLDKL* |
JGI2173J19968_101043453 | 3300001752 | Marine Sediment | SDVQGVLNMAKRKQSAAVPVKDAMFFPEDFMKLHRRHVIFIKKGVIIDLDKLG* |
SMTZ1_100060975 | 3300002052 | Marine Sediment | MAKRNQSAAVPVKDAMFFPEDFTKLHRRYVILIKKGVIIDLDKL* |
KVRMV2_1005994753 | 3300002231 | Marine Sediment | MAGKKQAAAVPVKDGMFFPEDFTRLHPRHVIYIKQGVVIDLDKL* |
Ga0055475_102640222 | 3300003988 | Natural And Restored Wetlands | MAKKKQSSSVPIKDGMFFPEDFAKLHKRHVIYIKKGLIIDLDKL* |
Ga0069718_139680603 | 3300004481 | Sediment | MCRKRQSAAVAVKDAMFFPKDFMKLHRRHVIYIKQGSIIDLDKL* |
Ga0070723_102890012 | 3300005612 | Marine Sediment | MKMAKKKQPASVPVEDGLFFPEDFRKLHKRYVIYIKQGVIIDLDKL* |
Ga0074649_101185310 | 3300005613 | Saline Water And Sediment | LAKKKQSASVPIEDALFFPKDFRELHERHAIYIKQGVIIDLDKL* |
Ga0074649_10345461 | 3300005613 | Saline Water And Sediment | VPIKEAMFFPEDFVKLDQRHVIYIKQGVIIDLDKL* |
Ga0079367_10769812 | 3300005782 | Marine Sediment | MAKKKQSAAMPVNDGLFFPEDFTKLHRRHVISIKQGVIINLDKL* |
Ga0074469_112856964 | 3300005832 | Sediment (Intertidal) | MAKKKQPASVPIKDGMFFPSDFTKLHKRHVIFITQGLIIDLDKL* |
Ga0115371_105580451 | 3300008470 | Sediment | MAKKKKSASVPIKDGLFFPEDFRRLHRNYVIYIKQGVIIDLDKL* |
Ga0111033_11617622 | 3300008516 | Marine Sediment | MKMAKKKQSASVPIKDAMFFPEDFRRLHRRHVIYIKKGVIIDLDKL* |
Ga0111033_12316892 | 3300008516 | Marine Sediment | MAKKKQPAALPVKDAMFFPEDFTKLHKRHVIYIKKGVIIDLDKL* |
Ga0111033_12821575 | 3300008516 | Marine Sediment | LEVVKLAKKKQTASVPIEDALFFPKDFGELHERHAIYIKQGVIIDLDKL* |
Ga0115863_11229986 | 3300009034 | Sediment, Intertidal | MKMAKKKQPASVPVEDGLFFPEDFRKLHKRHVIYIKQGVIIDLDKL* |
Ga0115863_13040353 | 3300009034 | Sediment, Intertidal | MEMVKKKQSAAVPVKDAIFFPEDFKKLHRRHVIYIKKGVIIDLDKL* |
Ga0118727_10583049 | 3300009128 | Marine | MAKKKQSASVPVKDGLFFPEDFRKLHKRHAIYIKQGVIIDLDKL* |
Ga0114918_1000034742 | 3300009149 | Deep Subsurface | MAKKKQPAAVQVKEAMFFPEDLTKLHKRHVIYIKKGLIIDLDKL* |
Ga0114918_1000224413 | 3300009149 | Deep Subsurface | MAKKKQPASVPIKDGMFFPSDFTKLHKRHVIFIKQGLIIDLDKL* |
Ga0114918_106170551 | 3300009149 | Deep Subsurface | LAGGGKMAKKEQPAAVPVEDGLFFPEDFRRLHPNHVIYIKQGVIIDL |
Ga0114921_103700602 | 3300009150 | Deep Subsurface | MAKKKQPAAVQVKEAMFFPEDFTKLHKRHVIYIKKGLIIDLDKL* |
Ga0114921_106681112 | 3300009150 | Deep Subsurface | MAKKKQSAAVQVKEAMFFPEDFTKLHKRHVIYIKKGLIIDLDKL* |
Ga0114921_107036242 | 3300009150 | Deep Subsurface | MKMAKKKQTASVPVEDGLFFPEDFRKLHKRHVIYIKQGVIIDLDKL* |
Ga0117909_13051443 | 3300009320 | Marine | MVKKNKPASLPIEDGMFFPEDFGKLHPNHVIYIKKGVIIDLDRL* |
Ga0114925_103555733 | 3300009488 | Deep Subsurface | MAKKKQPVAVQVKEAMFFPSDFTKLHKRHVIYIKKGLIIDLDKL* |
Ga0114925_114893762 | 3300009488 | Deep Subsurface | KTNVEVMKMPKNKQPAAVPVKDGLFFPEDFTKLHRRYTIYIKQGVIIDLDKL* |
Ga0114930_100492265 | 3300009499 | Deep Subsurface | MARKKQPAAVPVKDGMFFPEDFTKLHRRHVIYIKQGVIIDLDKL* |
Ga0114930_104373471 | 3300009499 | Deep Subsurface | MARKKQTAAVPVKDGMFFPEDFAKLHRRHVIYIKQGVIIDLDKL* |
Ga0129285_104012822 | 3300009513 | Beach Aquifer Porewater | MAKKKQPSAVPVEEGLFFPEDFLKLHKRHVIYIKKGVIIDLDKL* |
Ga0114920_101733174 | 3300009528 | Deep Subsurface | MAKKQSAAVPVKDAMFFPEDFKKLHRRHVIYIKQGVIIDLDKL* |
Ga0114919_101784723 | 3300009529 | Deep Subsurface | MAKKKQPAAVPVKDGLFFPEDFTKLHRRHVIYIKKGVIIDLDKL* |
Ga0114919_105411933 | 3300009529 | Deep Subsurface | WRCSEMAKKKQPAAVQVKEAMFFPEDLTKLHKRHVIYIKKGLIIDLDKL* |
Ga0114919_112020541 | 3300009529 | Deep Subsurface | MKMAKKKQSAAVPVKDGLFFPEDFTKLHRRHAIYIKQGVIIDLDKL* |
Ga0118731_1035142203 | 3300010392 | Marine | MKMAKKKQPSAVPVEEGLFFPEDFRKLHKGHVIYIKKGVIIDLDKL* |
Ga0118731_1089980552 | 3300010392 | Marine | MAKKKKSASVPIKDGIFFPEDFRRLHRNYVIYIKQGVIIDLDKL* |
Ga0118731_1137371162 | 3300010392 | Marine | MAKNKQSAAVPVKDAMFFPEDFTKLHKRHVIYIKKGLIIDLDKL* |
Ga0118733_1033828181 | 3300010430 | Marine Sediment | KVMKMAKKKQTASVPVEDGLFFPEDFRKLHKRHVIYIKQGVIIDLDKL* |
Ga0118733_1060936162 | 3300010430 | Marine Sediment | MAKKKTVASVVVKDGMFFPEDFKRLHPNHVIYIKTGVIFDLDEL* |
Ga0114922_100620177 | 3300011118 | Deep Subsurface | MAKKKQSAALPVKDAMFFPEDFKKLHRNHVIYIKQGVIIDLDKL* |
Ga0114922_114931302 | 3300011118 | Deep Subsurface | MKMAKKKQSAAVPVKEAMFFPEDFKKLHGDHLIYIKQGVIIDLGKL* |
Ga0114922_115989811 | 3300011118 | Deep Subsurface | MQMVKKKQPAAVPVKDGLFFPEDFTKLHRRHAIYIKQGVIIDLDKL* |
Ga0153915_124699712 | 3300012931 | Freshwater Wetlands | MVRKKQPAAVPVKDAMFFPEEFTKLHGRHVIYIKQGVVIDLDKL* |
Ga0163203_10585922 | 3300013089 | Freshwater | MTKKKQPASVPVEDALFFPKDFKELHERHAIYIKKGVIIDLDKL* |
(restricted) Ga0172363_103000192 | 3300013130 | Sediment | MKMAKKKQSVAVPIKDGLFFPEDFLKLHRRHAIYIKEGVIIDLNKL* |
(restricted) Ga0172363_105728312 | 3300013130 | Sediment | YDKMAKKSQSAAVPVKDALFFPQDFMKLHRRHVIYIKQGVIIDLDRL* |
Ga0172379_10000226127 | 3300014208 | Groundwater | MNMAKKKHSAAIPIKEGIFPPEDFTKLHQDYVIYIKEGVLIDLKKL* |
Ga0164321_103636402 | 3300014903 | Marine Sediment | MAKKKQSASVPIKDGMFFPSDFTKLHKRYVIYIKKGLIIDLDKL* |
Ga0180301_1000715114 | 3300014911 | Marine Sediment | MAKKKQSASVPIEDALFFPKDFEELHERHAIYIKKGVVIDLDKL* |
Ga0180437_1000013580 | 3300017963 | Hypersaline Lake Sediment | MAKRKQSAAVPVKDAMFFPEDFTRLHRRHVIFIKKGVIIDLDKLK |
Ga0180437_102038453 | 3300017963 | Hypersaline Lake Sediment | FLKMAKKKQTASLPIKDSLFFPEDFRKLHKRHVIYIKQGVITDLDKL |
Ga0180437_102728602 | 3300017963 | Hypersaline Lake Sediment | MEKKKTVSVRIKDGMFFPEDFRKLYRNHVIYIKTGVIIDLDRL |
Ga0180438_109899861 | 3300017971 | Hypersaline Lake Sediment | MTRKKQSSAMQIKDGLFFPEDFRKLHKNHVILIKQGVIIELGKS |
Ga0180431_1000139617 | 3300017987 | Hypersaline Lake Sediment | MAKKKQTASLPIKDSLFFPEDFRKLHKRHVIYIKQGVIADLDKL |
Ga0180431_100603115 | 3300017987 | Hypersaline Lake Sediment | MEKKKTASSRIKDGLFFPEDFRKLHRNHVIYIETGVIIDLDRL |
Ga0180431_101469571 | 3300017987 | Hypersaline Lake Sediment | MEKKKTASVRIKDGLFFPEDFRELHRNHVIYIKTGVIIDLDRL |
Ga0180434_101631642 | 3300017991 | Hypersaline Lake Sediment | MEKKKTASVRIKDGLFFPEDFRKLHRNHVIYIETGVTIDLDRL |
Ga0180434_111400892 | 3300017991 | Hypersaline Lake Sediment | MAKNKKSAAVPVKDAMFFPKDFAKLHQDHVIYIKKGLIIDLQKL |
Ga0212124_100397602 | 3300022553 | Freshwater | MTKKKQPASVPVEDALFFPKDFKELHERHAIYIKKGVIIDLDKL |
Ga0210003_10004331 | 3300024262 | Deep Subsurface | MAKKKQPAAVQVKEAMFFPEDLTKLHKRHVIYIKKGLIIDLDK |
Ga0210003_100202816 | 3300024262 | Deep Subsurface | MAKKKQPASVPIKDGMFFPSDFTKLHKRHVIFIKQGLIIDLDKL |
Ga0209979_10297875 | 3300024353 | Deep Subsurface | MARKKQPAAVPVKDGMFFPEDFTKLHRRHVIYIKQGVIIDLDKL |
(restricted) Ga0255046_105080851 | 3300024519 | Seawater | MAKKKKVASVVVKDGMFFPEDFKRLHPNHVIYIKAGVIFDLDEL |
(restricted) Ga0255044_101547281 | 3300024529 | Seawater | MAKKKKSASVPIKDGLFFPEDFRRLHRNYVIYIKQGVIFDLDKL |
Ga0209212_10800304 | 3300025309 | Soil | MANKKHSAAMPIKEGIFFPEDFTKLHKDYVIYIKEGVIIDLKKL |
Ga0207752_100030925 | 3300027555 | Enviromental | MTKKNQSAAVPVEGAMFFPEDFTRLHRRHVIYIKQGVIIDLDKL |
Ga0214474_13457442 | 3300027740 | Soil | MAEKKQSASVPVKDAMFFPEDFTKLHKRHVIYIKKGLIIDLDKL |
(restricted) Ga0255052_105248632 | 3300027865 | Seawater | QPAAVPVKDGLFFPEDFTKLHRRHAIYIKQGVIIDLDKL |
(restricted) Ga0255058_102817092 | 3300027872 | Seawater | MAKKKQSASVPVEEGLFFPEDFRKLHKRHAIYIKKGLIIDLDKL |
(restricted) Ga0255055_106248251 | 3300027881 | Seawater | MAKKKQSSTVPVEEGLFFPEDFRKLHKRHVIYIKKGV |
Ga0209635_100314114 | 3300027888 | Marine Sediment | MAKRKQSAAVPVKDAMFFPEDFTRLHRKHVIYIKKGVIIDLDKL |
Ga0209635_100791623 | 3300027888 | Marine Sediment | VSDVQGVLNMAKRKQSAAVPVKDAMFFPEDFMKLHRRHVIFIKKGVIIDLDKLG |
Ga0209635_103966212 | 3300027888 | Marine Sediment | MAKKKQSAAVPVKDAMFFPEDFRKLHRDHVIYIKQGVIIDLDKL |
Ga0209635_105506962 | 3300027888 | Marine Sediment | LLLSDVGGVLKMAKRNQSAAVPVKDAMFFPEDFTKLHRRYVILIKKGVIIDLDKL |
Ga0209636_110313882 | 3300027893 | Marine Sediment | EHKLNTDSEVMKMGKKKQPASVPVEDGLFFPEDFRKLHKRHVIYIKQGVIIDLDKL |
Ga0209427_100077204 | 3300027901 | Marine Sediment | MAKRNQSAAVPVKDAMFFPEDFTKLHRRYVILIKKGVIIDLDKL |
Ga0209427_100660356 | 3300027901 | Marine Sediment | MAKRKQSAAVPVKDAMFFPEDFTKLHRRHVIFIKKGVIIDLDKLK |
Ga0209427_104114732 | 3300027901 | Marine Sediment | MAKKKESAGVPVRDGLFFPEDFTRLHRRHVIYIKKGVIIDLDKL |
Ga0209427_104554472 | 3300027901 | Marine Sediment | MAKKKQTASVPVEDGLFFPEDFRKLHKRHVIYIKQGVIIDLDKL |
Ga0209427_104895212 | 3300027901 | Marine Sediment | MKMAKKKQPASVPVEDGLFFPEDFRKLHKRHVIYIKQGVIIDLDKL |
Ga0209427_111443502 | 3300027901 | Marine Sediment | TSKFGGFMKMAKKKQSAAVPVKDAMFFPEDFRRLHRRHVIYIKQGVIIDLDKL |
Ga0209536_1002631496 | 3300027917 | Marine Sediment | IAKRKQSAAVPVKDAMFFPEDFMKLHRRHVIFIKKGVIIDLDKL |
Ga0209536_1009569461 | 3300027917 | Marine Sediment | MAKRKQTAAVPVKDAMFFPEDFTKLHRRHVIFIKKGVIIDLDRL |
Ga0209536_1022043562 | 3300027917 | Marine Sediment | MAKKKQSATVPVKDGLFFPEDFKKLHPNHVIYIKRGVIIDLDKL |
Ga0268285_10708012 | 3300028167 | Saline Water | MTKKKQPASVPVEDALFFPKDFKELHERHAIYIKRGVIIDLDKL |
Ga0272443_100692443 | 3300028883 | Marine Sediment | MTRNSRSATVAVKDAMFFPEDFRRLHRRHVIYIQRGVIIDLDRL |
Ga0272443_103492731 | 3300028883 | Marine Sediment | MTRENRSATVVVKDAMFFPEDFRRLHGRHVIYVQRGVIIDLDKL |
Ga0272441_100437743 | 3300028920 | Marine Sediment | MEKKKTTSVRIKDGMFFPEDFRKLHRNHVIYIKTGVIIDLDRL |
Ga0272441_100542102 | 3300028920 | Marine Sediment | MENKTPASVRIKDGLFFPEDFRKLHRNHVIYIKTGVIIDLDRL |
Ga0272441_100906166 | 3300028920 | Marine Sediment | MAKKKPSAAVPVKEAMFFPEDFQKLHRGHVIYIKQGVIIDLDKL |
Ga0272441_101552364 | 3300028920 | Marine Sediment | MTRENRSATVAVKDAMFFPEDFRRLHGRHVIYVQRGVIIDLDKL |
Ga0272441_102163173 | 3300028920 | Marine Sediment | MEKKKTASVRIKDGMFFPEDFRKLRRNHVIYIKTGVIIDLERL |
Ga0272441_114286622 | 3300028920 | Marine Sediment | MTRKNQCASVPVKDALFFPEDFTRLHRRHVIYIQRGAIIDLDRL |
Ga0299915_100267393 | 3300030613 | Soil | MVKKKQSAAVPVKDALFFPEDFTKLHRRHVIYIKQGVIIDLDKL |
Ga0272442_100601402 | 3300030616 | Marine Sediment | MAKKKQPASVPVEDGLFFPEDFRKLHKRHVIYIKQGVIIDMDKL |
Ga0272442_100751058 | 3300030616 | Marine Sediment | SLPIKDSLFFPEDFRKLHKRHVIYIKQGVITDLDKL |
Ga0272442_102379442 | 3300030616 | Marine Sediment | LAKKKQSASVPIEDALFFPKDFRELHERHAIYIKKGVIIDLDKL |
Ga0272442_107261032 | 3300030616 | Marine Sediment | ASGRCGDTLTMTRKNQCASVPVKDALFFPEDFTRLHRRHVIYIQRGAIIDLDRL |
Ga0307380_100639083 | 3300031539 | Soil | MAKNKQPAAVPVKDAKFFPEDFIKLHKRHVIYIKKGLIIDLDKL |
Ga0307380_101247603 | 3300031539 | Soil | MAKKEQPAAVPVDDGLFFPEDFRRLHPIHVIYIKQGVIIDLDRL |
Ga0307380_101352384 | 3300031539 | Soil | MAKKEQPAAVPVEDGLFFPEDFRRLHPNHVIYIKQGVIIDLDRL |
Ga0307380_102611291 | 3300031539 | Soil | MAKKKQSGALPVKDAMFFPEDFKKLHRNHVIYIKQGVIIDLDKL |
Ga0307380_106059463 | 3300031539 | Soil | MAKNKQPAAVPVKDAMFFPEDFIKLHKRHVIYIKKGLIIDLDKL |
Ga0307380_107459322 | 3300031539 | Soil | MKMAKKKQSAAVPITEGLFFPEDFRRLHRKHAIYIKQGVIIDLDKL |
Ga0307379_103390771 | 3300031565 | Soil | HGGFIKMAKKKQSGALPVKDAMFFPEDFKKLHRNHVIYIKQGVIIDLDKL |
Ga0307378_115117581 | 3300031566 | Soil | KKQSAAVPVKDGLFFPEDFTKLHRRHAIYIKQGVIIDLDKL |
Ga0315541_10048345 | 3300031586 | Salt Marsh Sediment | LEVVKLAKKKQSASVPIEDALFFPKDFRELHERHAIYIKKGVIIDLDKL |
Ga0315545_13141081 | 3300031624 | Salt Marsh Sediment | MAKKKQSAAVQVKEAMFFPEDFTKLHKRHVIYIKKGLIIDLDKL |
Ga0315537_12927392 | 3300031698 | Salt Marsh Sediment | VIKIPKSKHPAAAPIKDGMFFPEDFRKLHNDNVIYIKKGVIIDLTKL |
Ga0315537_14028582 | 3300031698 | Salt Marsh Sediment | MKMAKKKQSASVPIKDAMFFPEDFRRLHRRHVIYIKKGVIIDLDKL |
Ga0315291_105215282 | 3300031707 | Sediment | MTKKNQSAAVPVKDAMFFPEDSRKLHRRHVIYIKRGVIIDLDKLG |
Ga0315293_101555762 | 3300031746 | Sediment | MVQKKQLVAVPVKDAMFFPEDFRKLHPRHVIYVKKGVIIDLDKL |
Ga0315285_107912971 | 3300031885 | Sediment | MAKKKQSASVPVKDAMFFPEDFTKLHKRHVIYIKKGLIIDLDKL |
Ga0315274_102251102 | 3300031999 | Sediment | MAKKKQSAAVPVKDAMFFQQDFTKLHRRHVIYIKQGVIIDLDRL |
Ga0315546_10914851 | 3300032029 | Salt Marsh Sediment | MVKRKQSASVTVNDGLFFPEDFRQLHPNYVIYIKRGVIIDLDKL |
Ga0315289_112306332 | 3300032046 | Sediment | MAKNKKSAAVPVKDAMFFPEDFRKLHRDHVIYIKRGVIIDLHEL |
Ga0315284_100122439 | 3300032053 | Sediment | MVKKKQSAAVPVKDAMFFPEDFRKLHRRHVIYIKQGVIIDLDRL |
Ga0315282_101693824 | 3300032069 | Sediment | MTKKSQSAAVAVKEAMFFPEDFTRLHPRHVIYIKRGVIIDLDKL |
Ga0315295_102392894 | 3300032156 | Sediment | MAKKKQSASVPVEDGLFFPEDFRKLHRRHVIYIKKGVIIDLDKL |
Ga0316628_1007238592 | 3300033513 | Soil | VKVTKKRRSAAIPVEDALFFPEDFRRLHPRHVIYIKRGVIIDLDRLE |
⦗Top⦘ |