| Basic Information | |
|---|---|
| Family ID | F067850 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 125 |
| Average Sequence Length | 41 residues |
| Representative Sequence | VVQLQLLDLMIPKECGAVPMDAATRADLIDLMARVLVAVFHEE |
| Number of Associated Samples | 109 |
| Number of Associated Scaffolds | 125 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 88.71 % |
| % of genes near scaffold ends (potentially truncated) | 95.20 % |
| % of genes from short scaffolds (< 2000 bps) | 96.80 % |
| Associated GOLD sequencing projects | 104 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (54.400 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (24.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (36.800 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.600 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 39.44% β-sheet: 0.00% Coil/Unstructured: 60.56% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 125 Family Scaffolds |
|---|---|---|
| PF04986 | Y2_Tnp | 24.00 |
| PF13340 | DUF4096 | 1.60 |
| PF00239 | Resolvase | 1.60 |
| PF13408 | Zn_ribbon_recom | 0.80 |
| PF00106 | adh_short | 0.80 |
| PF13586 | DDE_Tnp_1_2 | 0.80 |
| PF01797 | Y1_Tnp | 0.80 |
| PF02518 | HATPase_c | 0.80 |
| COG ID | Name | Functional Category | % Frequency in 125 Family Scaffolds |
|---|---|---|---|
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 1.60 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 1.60 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.80 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 54.40 % |
| Unclassified | root | N/A | 45.60 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459019|G14TP7Y01CAVVQ | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 589 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10132566 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 519 | Open in IMG/M |
| 3300000955|JGI1027J12803_109616225 | Not Available | 540 | Open in IMG/M |
| 3300001171|JGI12685J13342_100008 | Not Available | 2948 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100706339 | Not Available | 887 | Open in IMG/M |
| 3300004633|Ga0066395_10603222 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 643 | Open in IMG/M |
| 3300005175|Ga0066673_10777078 | Not Available | 548 | Open in IMG/M |
| 3300005332|Ga0066388_105231769 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300005363|Ga0008090_15530998 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 528 | Open in IMG/M |
| 3300005468|Ga0070707_101956791 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 554 | Open in IMG/M |
| 3300005561|Ga0066699_11104388 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 546 | Open in IMG/M |
| 3300005598|Ga0066706_10205543 | All Organisms → cellular organisms → Bacteria | 1514 | Open in IMG/M |
| 3300005602|Ga0070762_10096351 | Not Available | 1705 | Open in IMG/M |
| 3300005713|Ga0066905_101803053 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 564 | Open in IMG/M |
| 3300005764|Ga0066903_103729769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → Candidatus Accumulibacter aalborgensis | 819 | Open in IMG/M |
| 3300005764|Ga0066903_105861927 | Not Available | 645 | Open in IMG/M |
| 3300006034|Ga0066656_10852085 | Not Available | 583 | Open in IMG/M |
| 3300006050|Ga0075028_100956262 | Not Available | 530 | Open in IMG/M |
| 3300006086|Ga0075019_10590387 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 695 | Open in IMG/M |
| 3300006237|Ga0097621_101917372 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 565 | Open in IMG/M |
| 3300006797|Ga0066659_11432822 | Not Available | 577 | Open in IMG/M |
| 3300006881|Ga0068865_101137545 | Not Available | 689 | Open in IMG/M |
| 3300007258|Ga0099793_10430691 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 651 | Open in IMG/M |
| 3300010043|Ga0126380_11712071 | Not Available | 565 | Open in IMG/M |
| 3300010047|Ga0126382_10446969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1023 | Open in IMG/M |
| 3300010047|Ga0126382_12098772 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300010048|Ga0126373_10321447 | Not Available | 1550 | Open in IMG/M |
| 3300010048|Ga0126373_10623229 | Not Available | 1133 | Open in IMG/M |
| 3300010360|Ga0126372_10530763 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. CCBAU 51753 | 1113 | Open in IMG/M |
| 3300010376|Ga0126381_105043195 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 506 | Open in IMG/M |
| 3300010398|Ga0126383_11491617 | Not Available | 766 | Open in IMG/M |
| 3300012948|Ga0126375_10865891 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 722 | Open in IMG/M |
| 3300012986|Ga0164304_10878541 | Not Available | 699 | Open in IMG/M |
| 3300013297|Ga0157378_12961268 | Not Available | 527 | Open in IMG/M |
| 3300015374|Ga0132255_106160096 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 508 | Open in IMG/M |
| 3300016270|Ga0182036_11223400 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 625 | Open in IMG/M |
| 3300016319|Ga0182033_11678987 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
| 3300016319|Ga0182033_11733928 | Not Available | 566 | Open in IMG/M |
| 3300016341|Ga0182035_11624372 | Not Available | 583 | Open in IMG/M |
| 3300016341|Ga0182035_11625518 | Not Available | 583 | Open in IMG/M |
| 3300016371|Ga0182034_11689007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 557 | Open in IMG/M |
| 3300016371|Ga0182034_11711302 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 553 | Open in IMG/M |
| 3300016404|Ga0182037_11338474 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 632 | Open in IMG/M |
| 3300016404|Ga0182037_11498186 | Not Available | 598 | Open in IMG/M |
| 3300016422|Ga0182039_12078169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 523 | Open in IMG/M |
| 3300017943|Ga0187819_10064044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2184 | Open in IMG/M |
| 3300017961|Ga0187778_10427819 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
| 3300017970|Ga0187783_11109558 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 570 | Open in IMG/M |
| 3300018062|Ga0187784_11209806 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 599 | Open in IMG/M |
| 3300020580|Ga0210403_11235822 | Not Available | 574 | Open in IMG/M |
| 3300021407|Ga0210383_10253493 | All Organisms → cellular organisms → Bacteria | 1510 | Open in IMG/M |
| 3300021477|Ga0210398_11302403 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 571 | Open in IMG/M |
| 3300021560|Ga0126371_13785853 | Not Available | 510 | Open in IMG/M |
| 3300022711|Ga0242674_1058984 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 543 | Open in IMG/M |
| 3300024176|Ga0224565_1023356 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300024331|Ga0247668_1099520 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 589 | Open in IMG/M |
| 3300025906|Ga0207699_11340325 | Not Available | 529 | Open in IMG/M |
| 3300025910|Ga0207684_11718396 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 505 | Open in IMG/M |
| 3300025929|Ga0207664_11943766 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 511 | Open in IMG/M |
| 3300025937|Ga0207669_11902207 | Not Available | 508 | Open in IMG/M |
| 3300026528|Ga0209378_1239225 | Not Available | 577 | Open in IMG/M |
| 3300026804|Ga0207737_114988 | Not Available | 524 | Open in IMG/M |
| 3300026891|Ga0208889_1010098 | Not Available | 581 | Open in IMG/M |
| 3300026908|Ga0207787_1014850 | Not Available | 775 | Open in IMG/M |
| 3300027042|Ga0207766_1006634 | Not Available | 1407 | Open in IMG/M |
| 3300027071|Ga0209214_1018677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 881 | Open in IMG/M |
| 3300027109|Ga0208603_1075177 | Not Available | 500 | Open in IMG/M |
| 3300027173|Ga0208097_1042881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 526 | Open in IMG/M |
| 3300027548|Ga0209523_1119677 | Not Available | 544 | Open in IMG/M |
| 3300027576|Ga0209003_1019183 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
| 3300028799|Ga0307284_10415470 | Not Available | 548 | Open in IMG/M |
| 3300028811|Ga0307292_10233610 | Not Available | 761 | Open in IMG/M |
| 3300028882|Ga0302154_10501281 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 577 | Open in IMG/M |
| 3300030047|Ga0302286_10602284 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 559 | Open in IMG/M |
| 3300031090|Ga0265760_10354606 | Not Available | 525 | Open in IMG/M |
| 3300031231|Ga0170824_127561067 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300031469|Ga0170819_11957641 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 519 | Open in IMG/M |
| 3300031474|Ga0170818_100382240 | Not Available | 560 | Open in IMG/M |
| 3300031474|Ga0170818_108190228 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 581 | Open in IMG/M |
| 3300031525|Ga0302326_13655297 | Not Available | 507 | Open in IMG/M |
| 3300031545|Ga0318541_10867724 | Not Available | 503 | Open in IMG/M |
| 3300031561|Ga0318528_10671603 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 555 | Open in IMG/M |
| 3300031562|Ga0310886_10614603 | Not Available | 669 | Open in IMG/M |
| 3300031564|Ga0318573_10413959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 724 | Open in IMG/M |
| 3300031572|Ga0318515_10676864 | Not Available | 546 | Open in IMG/M |
| 3300031573|Ga0310915_10802671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 662 | Open in IMG/M |
| 3300031573|Ga0310915_10947432 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 602 | Open in IMG/M |
| 3300031573|Ga0310915_11135593 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 542 | Open in IMG/M |
| 3300031719|Ga0306917_10183352 | Not Available | 1575 | Open in IMG/M |
| 3300031719|Ga0306917_10243548 | Not Available | 1375 | Open in IMG/M |
| 3300031720|Ga0307469_10478493 | Not Available | 1085 | Open in IMG/M |
| 3300031736|Ga0318501_10695609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 560 | Open in IMG/M |
| 3300031740|Ga0307468_100963670 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 746 | Open in IMG/M |
| 3300031747|Ga0318502_10220446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1101 | Open in IMG/M |
| 3300031754|Ga0307475_11190734 | Not Available | 593 | Open in IMG/M |
| 3300031778|Ga0318498_10509582 | Not Available | 529 | Open in IMG/M |
| 3300031797|Ga0318550_10536891 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 563 | Open in IMG/M |
| 3300031833|Ga0310917_10997125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 561 | Open in IMG/M |
| 3300031835|Ga0318517_10493823 | Not Available | 551 | Open in IMG/M |
| 3300031845|Ga0318511_10542671 | Not Available | 540 | Open in IMG/M |
| 3300031859|Ga0318527_10429443 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 563 | Open in IMG/M |
| 3300031860|Ga0318495_10505057 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 527 | Open in IMG/M |
| 3300031879|Ga0306919_11342853 | Not Available | 540 | Open in IMG/M |
| 3300031890|Ga0306925_11902435 | Not Available | 565 | Open in IMG/M |
| 3300031893|Ga0318536_10630076 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 535 | Open in IMG/M |
| 3300031910|Ga0306923_11372327 | Not Available | 746 | Open in IMG/M |
| 3300031910|Ga0306923_12103230 | Not Available | 569 | Open in IMG/M |
| 3300031912|Ga0306921_10296479 | Not Available | 1894 | Open in IMG/M |
| 3300031912|Ga0306921_11169070 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 858 | Open in IMG/M |
| 3300031942|Ga0310916_11529373 | Not Available | 543 | Open in IMG/M |
| 3300031945|Ga0310913_11218372 | Not Available | 523 | Open in IMG/M |
| 3300031946|Ga0310910_11372831 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 544 | Open in IMG/M |
| 3300031962|Ga0307479_11835526 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 557 | Open in IMG/M |
| 3300032001|Ga0306922_11165001 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300032001|Ga0306922_11896981 | Not Available | 584 | Open in IMG/M |
| 3300032043|Ga0318556_10132024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1282 | Open in IMG/M |
| 3300032054|Ga0318570_10161776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1004 | Open in IMG/M |
| 3300032066|Ga0318514_10644778 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 563 | Open in IMG/M |
| 3300032076|Ga0306924_12452296 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 524 | Open in IMG/M |
| 3300032828|Ga0335080_10165578 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 2444 | Open in IMG/M |
| 3300032828|Ga0335080_10384972 | Not Available | 1507 | Open in IMG/M |
| 3300033158|Ga0335077_11842673 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 567 | Open in IMG/M |
| 3300033289|Ga0310914_10979879 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 745 | Open in IMG/M |
| 3300033290|Ga0318519_10788297 | Not Available | 584 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 24.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.80% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.80% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 6.40% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.80% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 4.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.20% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.20% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.40% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.40% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.40% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.60% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.80% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.80% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.80% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.80% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.80% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.80% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.80% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.80% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.80% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.80% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.80% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.80% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459019 | Litter degradation MG4 | Engineered | Open in IMG/M |
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001171 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M1 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022711 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024176 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU1 | Environmental | Open in IMG/M |
| 3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026804 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026891 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPB (SPAdes) | Environmental | Open in IMG/M |
| 3300026908 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 77 (SPAdes) | Environmental | Open in IMG/M |
| 3300027042 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 68 (SPAdes) | Environmental | Open in IMG/M |
| 3300027071 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027109 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF008 (SPAdes) | Environmental | Open in IMG/M |
| 3300027173 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF036 (SPAdes) | Environmental | Open in IMG/M |
| 3300027548 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027576 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028882 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_3 | Environmental | Open in IMG/M |
| 3300030047 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E2_3 | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 4MG_03802610 | 2170459019 | Switchgrass, Maize And Mischanthus Litter | VVQLQLLDLMIPKECGAVPMGAATRADLIDLMARVLVAAFARGGKSQ |
| AF_2010_repII_A001DRAFT_101325661 | 3300000793 | Forest Soil | VQFQLLDLMIPKECGAVPMDAATRADLIDLMARVLAAVFHEEGR |
| JGI1027J12803_1096162252 | 3300000955 | Soil | VVVQLQLLDLMIAKEYGAVSMDVATRADLIDLMARVLAV |
| JGI12685J13342_1000083 | 3300001171 | Forest Soil | VVQLQLLDLMISRECGAVPMDAATRADLIDLMARAIAAVFHEEEEKRK* |
| JGIcombinedJ26739_1007063391 | 3300002245 | Forest Soil | VVQLQLLDLMISRECSAVPMDAATRAALIDLMARVVVTVLHQEG |
| Ga0066395_106032221 | 3300004633 | Tropical Forest Soil | VVQLQLRDLMIPKECGAVPMDAATRADLIDLMARVLVAVFSRGGGRSQ* |
| Ga0066673_107770781 | 3300005175 | Soil | VVQLQLLGLMIPKERGAVPMDAATRAGLIDLMARVLVAVFHEE |
| Ga0066388_1052317691 | 3300005332 | Tropical Forest Soil | VEAREVAVVQLQLLDLMISRECGAVPMDAATRADLIDLMA |
| Ga0008090_155309981 | 3300005363 | Tropical Rainforest Soil | MQLQLLDLMVAKQCGAVPMDAAIRADLIDLMARVLVAVFREEGGR |
| Ga0070707_1019567911 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | LPDAKEVVVLQLQLLDLMIRKETEAVPMDAATRADLIDLMARVL |
| Ga0066699_111043881 | 3300005561 | Soil | VVQLQFLDLMIPKECGAVPMDAATRADLIDLMARVLVVVFHE |
| Ga0066706_102055431 | 3300005598 | Soil | VVQLQLLGLMIPKERGAVPMDAATRAGLIDLMARVLVAVF |
| Ga0070762_100963514 | 3300005602 | Soil | VVQLQLLDLVISRECGAVPMDAATRADLIDLTARVIAAV |
| Ga0066905_1018030531 | 3300005713 | Tropical Forest Soil | VVQLQFLDLMIPKECGAMPMDAATRADLIDLMARVL |
| Ga0066903_1037297691 | 3300005764 | Tropical Forest Soil | VVQLQLLDMMIPKECAAPMDAATRADLIDLMARALVAVFH |
| Ga0066903_1058619272 | 3300005764 | Tropical Forest Soil | VVQLQLLDLVIPKEYAAAPMGAATRANLIDLMARVLV |
| Ga0066656_108520851 | 3300006034 | Soil | VVQLQLLGLMIPKERGAVPMDAATRAGLIDLMARVLVAVFHEEGG |
| Ga0075028_1009562621 | 3300006050 | Watersheds | VVQLQLLDLMIPKECGAVPMDAATRADLIDLMARILVAVFH |
| Ga0075019_105903871 | 3300006086 | Watersheds | VVQLQLLDLMILKECGAAPMDAATRADLIDLMARVLVAVFHEE |
| Ga0097621_1019173723 | 3300006237 | Miscanthus Rhizosphere | VVQLQFLDLMIPKECDAVPMDAATRADLIDLMARVLVVVFH |
| Ga0066659_114328221 | 3300006797 | Soil | VVQLQLLDLMISRECGAVPMDAATRADLIDLMARAVAAVFHEEGRR |
| Ga0068865_1011375451 | 3300006881 | Miscanthus Rhizosphere | VVQLQLLDLMIPNECGAVPMDAATRADLIDLMARVL |
| Ga0099793_104306912 | 3300007258 | Vadose Zone Soil | LTDAKEVVVVQLQLLDLVIREENEAVPMDAATRADLIDLMARVLVVAFHE* |
| Ga0126380_117120711 | 3300010043 | Tropical Forest Soil | VVQLQLLDLMIPKECGAVPMDAATRADLIDLMARVLVA |
| Ga0126382_104469692 | 3300010047 | Tropical Forest Soil | VVQLQLLDLMIPKECGSVPMDAATRADLIDLMARVLVAVFH |
| Ga0126382_120987722 | 3300010047 | Tropical Forest Soil | VVQLQLLDLMISRECGAVPMDAATRADLIDLMARVI |
| Ga0126373_103214473 | 3300010048 | Tropical Forest Soil | VVQLQLLGLMIPKECGAVPMEAAARADLIDLMARALIAVF |
| Ga0126373_106232292 | 3300010048 | Tropical Forest Soil | DSKEVVVVQLQLLDLMIPKECGAVPMDAATRAALGHT* |
| Ga0126372_105307633 | 3300010360 | Tropical Forest Soil | LADSREVVVVQLQLLDLMIPKECGALPMDAATRADLIDLMARALVA |
| Ga0126381_1008722671 | 3300010376 | Tropical Forest Soil | LPDIREVVVVQLNFLDLMIRKEGEAVLLDVATRANLIDLMARVLVVV |
| Ga0126381_1050431951 | 3300010376 | Tropical Forest Soil | MQLQLLDLMIREESEAVLMNAEARAELIDLMACVLAVVFHK |
| Ga0126383_114916171 | 3300010398 | Tropical Forest Soil | VVQLQLLDLMIPKECGAVPMDAATRADLIDLMARVLVAVFHEE |
| Ga0126375_108658913 | 3300012948 | Tropical Forest Soil | VVQLQLDLMITKECGAVPMDAATRADLIDLMARVL |
| Ga0164304_108785411 | 3300012986 | Soil | MQLKFLDLLIRKENEAVPMDAAVRADLIDLMARVLVVIF |
| Ga0157378_129612681 | 3300013297 | Miscanthus Rhizosphere | VVQLQFLDLMIPKECDAVPMDAATRADLIDLMARVLVVVFHEEG |
| Ga0132255_1061600961 | 3300015374 | Arabidopsis Rhizosphere | VLADAREVVVVQLELLDLMISRECGAVPMDAATRADLIDLMARAIAAV |
| Ga0182036_112234002 | 3300016270 | Soil | VVQIQLLDLRMRNENGAVPLDAATRADLIDLMARVLVVVFQAEGGR |
| Ga0182033_116789871 | 3300016319 | Soil | VVQLQLLGLRIEKESEAVSMDDAAIRSDLIDLMARVLVVVFQAEG |
| Ga0182033_117339282 | 3300016319 | Soil | VEAREAVVVQLQLLDLMISRECGAVPMDAATRADLIDLTARVIA |
| Ga0182035_116243723 | 3300016341 | Soil | MQLPLLDPMIAKECGAVPMDAATRADLIDLMARVLVAVFREE |
| Ga0182035_116255181 | 3300016341 | Soil | VVQLQLLGLRIEKESEAVSMDDAAIRSDLIDLMARVLVVVFQAEGG |
| Ga0182034_116890072 | 3300016371 | Soil | VAQLQLLDLMISECGAVPMDAATRADLIDLMARALVAVFHEERRR |
| Ga0182034_117113022 | 3300016371 | Soil | VVQLQLLDLMIRKERDAVSLDAAARVNLIDLMARVVVAVFHEE |
| Ga0182037_113384742 | 3300016404 | Soil | MQLQFLDLLIAKENGAVPLDAAVRADLIDLMARVLVVVFQE |
| Ga0182037_114981861 | 3300016404 | Soil | VAQLQLLDLMIPKECGAAPMDAATRADLIDLMARVLVAVF |
| Ga0182039_120781692 | 3300016422 | Soil | QLLDLMISECGAVPMDAATRADLIDLMARALVAVFHEERRR |
| Ga0187819_100640445 | 3300017943 | Freshwater Sediment | VVQLQLLDLMIPKECGAVPIDAVTRAHLIDLMARVLVAVFHE |
| Ga0187778_104278192 | 3300017961 | Tropical Peatland | VVQLQLLDLMIPKECGAVPMDAATRADLIDLMARALVAVFH |
| Ga0187783_111095583 | 3300017970 | Tropical Peatland | VVQLQLLDLMIQKECGAVPMDAATRADLIDLMARALVAVFHEEGR |
| Ga0187784_112098062 | 3300018062 | Tropical Peatland | VVQLQLLDLRIRKECRAVPIDATTRADLIDLMARVLM |
| Ga0210403_112358221 | 3300020580 | Soil | VVQLQLLDLMVRKECDAVSMDAATRADLIDLMARVVVAVFH |
| Ga0210383_102534931 | 3300021407 | Soil | VVQLRLLDLMVRRERDPVSMDVATRAALIDLMARVVVAVFHGEVGANDRH |
| Ga0210398_113024031 | 3300021477 | Soil | MVIQLQLLDLMIRKGSGAVSMDAATRADLINLMARVVMAVFHEE |
| Ga0126371_137858531 | 3300021560 | Tropical Forest Soil | VVQLQLLDLMISRECGAVPMDAATRADLIDLIARVIA |
| Ga0242674_10589842 | 3300022711 | Soil | VLQLQLQGLMIPKERGAVPIDAATRADVIDLMARILVAVFH |
| Ga0224565_10233561 | 3300024176 | Plant Litter | VVQLQLLDLMILKECGAAPMDAATRADLIDLMARVL |
| Ga0247668_10995202 | 3300024331 | Soil | VVQLQLLDLMIRRECDAVSLDAATRVELIGLMARVVVAVFHA |
| Ga0207699_113403251 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | VVQLQLLDLMIPKECGPVPMDAATRADLIDLMARV |
| Ga0207684_117183961 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VVQLQLLDLMISRECGAVPMDAATRADLIDLMARAIAAVFHEEGRR |
| Ga0207664_119437662 | 3300025929 | Agricultural Soil | VVQLQLLDLMISRECGAVPMDAATRADLIDLIARVIAAVFHEEG |
| Ga0207669_119022071 | 3300025937 | Miscanthus Rhizosphere | VVQLQLLDLMIPNECGAVPMDAATRADLIDLMARVLGA |
| Ga0209378_12392251 | 3300026528 | Soil | VVQLQLLDLMISRECGAVPMDAATRADLIDLIARVIAAVF |
| Ga0207737_1149881 | 3300026804 | Tropical Forest Soil | VVQLQLLDLVISRQCGAVPMDAATRAALIDLMARVLVVVFHE |
| Ga0208889_10100981 | 3300026891 | Soil | MVQLQLLDLMISRECGAVPMDAATRADLIDLTARVIAAVFHEEG |
| Ga0207787_10148501 | 3300026908 | Tropical Forest Soil | VVQLQFLDLMIPKECGAVPMDAATRAALIDLMARVLVVVFHE |
| Ga0207766_10066341 | 3300027042 | Tropical Forest Soil | VVQLQLLDLMISRECGAVPMGAATRADLIDLIARVI |
| Ga0209214_10186773 | 3300027071 | Forest Soil | VVQLQLLDLMISRECGAVPMDAATRTDLIDLIARVIAVV |
| Ga0208603_10751772 | 3300027109 | Forest Soil | VVQLQLLDLMIAKECGAVPMDAATRADLIDLMARVL |
| Ga0208097_10428811 | 3300027173 | Forest Soil | VVQLQLLDLMIAKECGAVPMDAATRADLIDLMARVLVA |
| Ga0209523_11196771 | 3300027548 | Forest Soil | MQLQLLDLMIPKECGAVPMDAATRIDLIDLMARALVAVFHEEGRR |
| Ga0209003_10191831 | 3300027576 | Forest Soil | VVQLQLLDLMIPKACGAVPTDAATRTDLIDLMARVLVAVFHEEGGR |
| Ga0307284_104154701 | 3300028799 | Soil | VVQLQLLDLMIPKECDAVSMDAATRADLINLMARVLVRVFHEEGGS |
| Ga0307292_102336101 | 3300028811 | Soil | VVQLQLLGLMIPKERGAVPMDAATRAGLIDLMARVLVAVFHEERG |
| Ga0302154_105012811 | 3300028882 | Bog | VVQLELLDLMIRKGSGAVSMDAATRADLINLMARV |
| Ga0302286_106022841 | 3300030047 | Fen | VVQLQLLDLMISRECGAVPMDAATRADLIDLTARVIAAVFHEEG |
| Ga0265760_103546062 | 3300031090 | Soil | VELQLLDLMIPKECGAVPMDAATRAALIDLMARVLVTVFHE |
| Ga0170824_1275610673 | 3300031231 | Forest Soil | VVQLQLLDLMIPKECGAVPMDAATHADLIDLMARVLAAVFHEEGRR |
| Ga0170819_119576411 | 3300031469 | Forest Soil | VVQLQLLDLMIPKECGAVPMDAATRADLIDLMARV |
| Ga0170818_1003822401 | 3300031474 | Forest Soil | VVQLQLLDLMISKECGAVPMDAATRPDLIDLMARVLVAVFH |
| Ga0170818_1081902282 | 3300031474 | Forest Soil | VVQLQFLDLMIPKECGAVPMDAATRADLIDLMARVLVVVFHEEGG |
| Ga0302326_136552972 | 3300031525 | Palsa | VVQLQLLDLMISRECGAVPMDAATRADLIDLTARVIAAVFHEEGRR |
| Ga0318541_108677241 | 3300031545 | Soil | VVQLQLLDLMISRECGAVPLDAATRADLIDLMARVIAEVF |
| Ga0318528_106716031 | 3300031561 | Soil | VVQLQLLDLMIPKECGAVPIDAATRTDLIDLMARVLVAVFREEGG |
| Ga0310886_106146031 | 3300031562 | Soil | VVQLQLLDLMIPKECGPVPMDTATRADLIDLMARVLVAVF |
| Ga0318573_104139592 | 3300031564 | Soil | VVQLQLLDLMISRECGAVPMDAATRADLIDLIARV |
| Ga0318515_106768641 | 3300031572 | Soil | MQLPLLDPMIAKECGAVPMDAATRADLIDLMARVLVAVFREEGGRAN |
| Ga0310915_108026711 | 3300031573 | Soil | VVQLQFLDLMIPKECGAVSMDAATRADLIDLMARVLVVV |
| Ga0310915_109474322 | 3300031573 | Soil | MQLQLLDLLIARENGAVPLDAAVRADLIDLMARVLVV |
| Ga0310915_111355931 | 3300031573 | Soil | MEVVVVQLQLLDMMIRKERDAVSMDAATRADLIGLMARVVIAV |
| Ga0306917_101833522 | 3300031719 | Soil | VLADARELVVLQLQLLDLMIPKECGAAPMDAATRADLIDLMARVLVAVFHE |
| Ga0306917_102435484 | 3300031719 | Soil | VVQLQLLDLMIPKECGGVPMDAATRADLIDLMARVL |
| Ga0307469_104784932 | 3300031720 | Hardwood Forest Soil | VVQLQLLDLMISRECGAVPKDAATRAELIDLMACAI |
| Ga0318501_106956093 | 3300031736 | Soil | VVQLQLLDLMIPKECGAVPIDAATRVDLINLMARALV |
| Ga0307468_1009636701 | 3300031740 | Hardwood Forest Soil | VVQLQLLDLMIPKECGAVAMDAATRADLIDLMARVLVA |
| Ga0318502_102204463 | 3300031747 | Soil | ARKVVVMQLQLLDLMIPKECGAVPMDAATRANLIDLMARVLGRVVN |
| Ga0307475_111907341 | 3300031754 | Hardwood Forest Soil | VVQLQLQDLMIPKECGAVPMDAATRADLIDLMARVLVAVFHEE |
| Ga0318498_105095822 | 3300031778 | Soil | VQLQLLDLMIPKECGAVPMDAAKRADLIDLMARVV |
| Ga0318550_105368911 | 3300031797 | Soil | VVQLQLLDLMIPKECGVVAIDAATRADLIDLMARVLVAVFREEGG |
| Ga0310917_109971253 | 3300031833 | Soil | VVQLQLLDLMISRECGAVPMDAATRADLIDLTARVIAAV |
| Ga0318517_104938231 | 3300031835 | Soil | VVQLQLLDLMISRECGAVPMDAATRADLIDLTARV |
| Ga0318511_105426712 | 3300031845 | Soil | VVQLQLLGLRIEKESEAVSMDDAAIRSDLIDLMARVLMVVFQKEGERDDDGG |
| Ga0318527_104294432 | 3300031859 | Soil | VVQLQLLDLMIPKECGVVAIDAATRADLIDLMARVLVAVFREEG |
| Ga0318495_105050571 | 3300031860 | Soil | VVQLQLLDLMISRECGAAPMDAATRADLIDVMARVVAAVFHE |
| Ga0306919_113428531 | 3300031879 | Soil | VVQLQLLDLMIRECGAVPMDTATRADLIDLMARALV |
| Ga0306925_119024351 | 3300031890 | Soil | VVQLQLLDLMISRECGAVPMDAATRADLIDLTARVI |
| Ga0318536_106300762 | 3300031893 | Soil | VVQLRLLDLMISRECGAVPMDAATRADLIDLMARVI |
| Ga0306923_113723272 | 3300031910 | Soil | MQLQFLDLLIAKENGAVPLDAAVRADLIDLMARVLVLVF |
| Ga0306923_121032301 | 3300031910 | Soil | VVQLQLLDLMISRECGAVPMDAATRADLIDLTARVIA |
| Ga0306921_102964791 | 3300031912 | Soil | VVQLQLLGWRIEKESEAVSMDDAAIRSDLIDLMARVLVVVFQ |
| Ga0306921_111690701 | 3300031912 | Soil | RKVVVMQLQLLDLMIPKECGAVPMDAATRANLIDLMARVLGRVVN |
| Ga0310916_115293731 | 3300031942 | Soil | VVQLQLLDLMISECGAVPTDTATRADLIDLMARALVAVFHEERRR |
| Ga0310913_112183721 | 3300031945 | Soil | VVQLQLLDLMIREECGAVPMDAATRADLIDLIARVI |
| Ga0310910_113728311 | 3300031946 | Soil | VVQLQFLDLMIPKECGAVSMDAATRADLIDLMARVLVVVFHEEG |
| Ga0307479_118355263 | 3300031962 | Hardwood Forest Soil | VVQLQLLDLMISRECGAVPMDAATRADLIDLIARVIAAVFNE |
| Ga0306922_111650011 | 3300032001 | Soil | VVQLHLLGLMIPKECGAVPMDAATRADLIDLMARVLVAVFHEEGGR |
| Ga0306922_118969811 | 3300032001 | Soil | VVQLQLLDLMIRKESAPVPISAAARGDLIDLMARVLVVVLH |
| Ga0318556_101320243 | 3300032043 | Soil | VLQLQLLDLMIPKECGAAPMDAATRADLIDLMARVLVAVFH |
| Ga0318570_101617761 | 3300032054 | Soil | LQLLDLMIPKECGAVPMDAATRANLIDLMARVLGRVVN |
| Ga0318514_106447782 | 3300032066 | Soil | MQLQLLDLMIPKECGAVPMDAATRANLIDLMARVLVA |
| Ga0306924_124522962 | 3300032076 | Soil | MQLPLLDPMIAKECGAVPMDAATRADLIDLMARVLVAV |
| Ga0335080_101655781 | 3300032828 | Soil | MQLEFLDLLIAKENGAVPLDAVVRADLIDLMARVLVVV |
| Ga0335080_103849724 | 3300032828 | Soil | VVQLQLLDLMISRECGAVPMDAATRADLIDLTARVIATVFHEEGRR |
| Ga0335077_118426731 | 3300033158 | Soil | VQLQLLDLMIRNESAAMSMDAATRADLIDLMARVLMVVFHEEGGRV |
| Ga0310914_109798791 | 3300033289 | Soil | VVQLQLLDLMIPKECGAVPVDAATRADLIDLMARVLVV |
| Ga0318519_107882971 | 3300033290 | Soil | VAQLQLLDLMIPKECGAAPMDAATRADLIDLMARVLVAV |
| ⦗Top⦘ |