| Basic Information | |
|---|---|
| Family ID | F066130 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 127 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MKTSLLKKLAPCLTRRGKKHRKLSQIQIENFDLNDFLFYRENRS |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 127 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 77.95 % |
| % of genes near scaffold ends (potentially truncated) | 26.77 % |
| % of genes from short scaffolds (< 2000 bps) | 67.72 % |
| Associated GOLD sequencing projects | 87 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (69.291 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (47.244 % of family members) |
| Environment Ontology (ENVO) | Unclassified (88.976 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (76.378 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.45% β-sheet: 6.82% Coil/Unstructured: 72.73% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 127 Family Scaffolds |
|---|---|---|
| PF00108 | Thiolase_N | 36.22 |
| PF00441 | Acyl-CoA_dh_1 | 12.60 |
| PF02771 | Acyl-CoA_dh_N | 9.45 |
| PF02803 | Thiolase_C | 6.30 |
| PF02737 | 3HCDH_N | 5.51 |
| PF02770 | Acyl-CoA_dh_M | 3.15 |
| PF16113 | ECH_2 | 2.36 |
| PF13977 | TetR_C_6 | 1.57 |
| PF07969 | Amidohydro_3 | 1.57 |
| PF01979 | Amidohydro_1 | 1.57 |
| PF01156 | IU_nuc_hydro | 0.79 |
| PF08545 | ACP_syn_III | 0.79 |
| PF07044 | DUF1329 | 0.79 |
| PF00266 | Aminotran_5 | 0.79 |
| PF03641 | Lysine_decarbox | 0.79 |
| PF13147 | Obsolete Pfam Family | 0.79 |
| COG ID | Name | Functional Category | % Frequency in 127 Family Scaffolds |
|---|---|---|---|
| COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 42.52 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 25.20 |
| COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 5.51 |
| COG0287 | Prephenate dehydrogenase | Amino acid transport and metabolism [E] | 5.51 |
| COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 5.51 |
| COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 5.51 |
| COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 5.51 |
| COG1748 | Saccharopine dehydrogenase, NADP-dependent | Amino acid transport and metabolism [E] | 5.51 |
| COG2084 | 3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase | Lipid transport and metabolism [I] | 5.51 |
| COG1611 | Nucleotide monophosphate nucleosidase PpnN/YdgH, Lonely Guy (LOG) family | Nucleotide transport and metabolism [F] | 0.79 |
| COG1957 | Inosine-uridine nucleoside N-ribohydrolase | Nucleotide transport and metabolism [F] | 0.79 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 69.29 % |
| Unclassified | root | N/A | 30.71 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000137|LP_F_10_SI03_10DRAFT_c1013092 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | 1598 | Open in IMG/M |
| 3300000142|LPaug09P16500mDRAFT_c1004639 | All Organisms → cellular organisms → Bacteria | 3096 | Open in IMG/M |
| 3300000150|SI48aug10_120mDRAFT_c1032436 | Not Available | 645 | Open in IMG/M |
| 3300000170|SI36aug09_135mDRAFT_c1038343 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 688 | Open in IMG/M |
| 3300000193|SI47jul10_135mDRAFT_c1053393 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 600 | Open in IMG/M |
| 3300000219|LPfeb10P161000mDRAFT_c1016782 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 1449 | Open in IMG/M |
| 3300000222|LPjun09P12500mDRAFT_1005680 | All Organisms → cellular organisms → Bacteria | 3038 | Open in IMG/M |
| 3300000264|LP_A_09_P04_500DRAFT_1002175 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 3287 | Open in IMG/M |
| 3300000264|LP_A_09_P04_500DRAFT_1002938 | All Organisms → cellular organisms → Bacteria | 2824 | Open in IMG/M |
| 3300002683|Ga0005275J37221_106694 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 2314 | Open in IMG/M |
| 3300002913|JGI26060J43896_10009730 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 3271 | Open in IMG/M |
| 3300003702|PicMicro_10016768 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia | 10039 | Open in IMG/M |
| 3300004276|Ga0066610_10210793 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 631 | Open in IMG/M |
| 3300005234|Ga0066613_1325457 | Not Available | 594 | Open in IMG/M |
| 3300005398|Ga0066858_10000678 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Marinimicrobia bacterium SCGC AAA003-E22 | 11763 | Open in IMG/M |
| 3300005401|Ga0066857_10112836 | Not Available | 971 | Open in IMG/M |
| 3300005402|Ga0066855_10214445 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 626 | Open in IMG/M |
| 3300005431|Ga0066854_10284284 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 558 | Open in IMG/M |
| 3300005521|Ga0066862_10094911 | Not Available | 1022 | Open in IMG/M |
| 3300005945|Ga0066381_10024802 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia | 1626 | Open in IMG/M |
| 3300006011|Ga0066373_10011646 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 2161 | Open in IMG/M |
| 3300006012|Ga0066374_10005776 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia | 3062 | Open in IMG/M |
| 3300006079|Ga0081601_1002245 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Marinimicrobia bacterium SCGC AAA298-D23 | 6177 | Open in IMG/M |
| 3300006091|Ga0082018_1003327 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia | 2668 | Open in IMG/M |
| 3300006166|Ga0066836_10046141 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia | 2470 | Open in IMG/M |
| 3300006166|Ga0066836_10046321 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia | 2465 | Open in IMG/M |
| 3300006166|Ga0066836_10947754 | Not Available | 519 | Open in IMG/M |
| 3300006310|Ga0068471_1236934 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia | 2081 | Open in IMG/M |
| 3300006311|Ga0068478_1206971 | Not Available | 1122 | Open in IMG/M |
| 3300006313|Ga0068472_10305237 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 951 | Open in IMG/M |
| 3300006346|Ga0099696_1344229 | Not Available | 649 | Open in IMG/M |
| 3300006567|Ga0099958_1149109 | Not Available | 745 | Open in IMG/M |
| 3300006902|Ga0066372_10128522 | Not Available | 1335 | Open in IMG/M |
| 3300006902|Ga0066372_10578626 | Not Available | 667 | Open in IMG/M |
| 3300007514|Ga0105020_1008981 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia | 10614 | Open in IMG/M |
| 3300008253|Ga0105349_10178615 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 886 | Open in IMG/M |
| 3300009104|Ga0117902_1056279 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia | 4679 | Open in IMG/M |
| 3300009104|Ga0117902_1444086 | All Organisms → cellular organisms → Bacteria | 1128 | Open in IMG/M |
| 3300009132|Ga0118730_1179427 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 1268 | Open in IMG/M |
| 3300009173|Ga0114996_10279113 | Not Available | 1315 | Open in IMG/M |
| 3300009173|Ga0114996_10492457 | Not Available | 925 | Open in IMG/M |
| 3300009173|Ga0114996_10564128 | Not Available | 850 | Open in IMG/M |
| 3300009173|Ga0114996_11017686 | Not Available | 587 | Open in IMG/M |
| 3300009173|Ga0114996_11226638 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 524 | Open in IMG/M |
| 3300009409|Ga0114993_11059777 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 575 | Open in IMG/M |
| 3300009420|Ga0114994_10191492 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia | 1378 | Open in IMG/M |
| 3300009420|Ga0114994_10302823 | Not Available | 1065 | Open in IMG/M |
| 3300009425|Ga0114997_10061026 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 2391 | Open in IMG/M |
| 3300009425|Ga0114997_10755596 | Not Available | 507 | Open in IMG/M |
| 3300009705|Ga0115000_10020620 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia | 4722 | Open in IMG/M |
| 3300009786|Ga0114999_10345887 | Not Available | 1183 | Open in IMG/M |
| 3300010883|Ga0133547_10383171 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia | 2882 | Open in IMG/M |
| 3300013116|Ga0171646_1011193 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia | 5584 | Open in IMG/M |
| 3300020263|Ga0211679_1001582 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria | 7841 | Open in IMG/M |
| 3300020286|Ga0211624_1047068 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 587 | Open in IMG/M |
| 3300020298|Ga0211657_1014378 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria | 1941 | Open in IMG/M |
| 3300020300|Ga0211662_1034389 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria | 909 | Open in IMG/M |
| 3300020330|Ga0211572_1031426 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria | 1446 | Open in IMG/M |
| 3300020330|Ga0211572_1072353 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 832 | Open in IMG/M |
| 3300020354|Ga0211608_10026370 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria | 1458 | Open in IMG/M |
| 3300020389|Ga0211680_10079496 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria | 1407 | Open in IMG/M |
| 3300020389|Ga0211680_10174354 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria | 841 | Open in IMG/M |
| 3300020398|Ga0211637_10067372 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 1444 | Open in IMG/M |
| 3300020399|Ga0211623_10040670 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria | 1579 | Open in IMG/M |
| 3300020472|Ga0211579_10002479 | All Organisms → cellular organisms → Bacteria | 13974 | Open in IMG/M |
| 3300020476|Ga0211715_10081226 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria | 1578 | Open in IMG/M |
| 3300021065|Ga0206686_1102990 | Not Available | 850 | Open in IMG/M |
| 3300021068|Ga0206684_1020485 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria | 2362 | Open in IMG/M |
| 3300021342|Ga0206691_1214567 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 3212 | Open in IMG/M |
| 3300021345|Ga0206688_10312851 | Not Available | 508 | Open in IMG/M |
| 3300021352|Ga0206680_10253683 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria | 682 | Open in IMG/M |
| 3300021443|Ga0206681_10326222 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 594 | Open in IMG/M |
| 3300021791|Ga0226832_10140028 | Not Available | 912 | Open in IMG/M |
| 3300022227|Ga0187827_10354706 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 925 | Open in IMG/M |
| 3300022227|Ga0187827_10647826 | Not Available | 608 | Open in IMG/M |
| (restricted) 3300022931|Ga0233433_10000381 | All Organisms → cellular organisms → Bacteria | 48605 | Open in IMG/M |
| (restricted) 3300022931|Ga0233433_10050732 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 2236 | Open in IMG/M |
| (restricted) 3300022933|Ga0233427_10010027 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Marinimicrobia bacterium SCGC AAA298-D23 | 6666 | Open in IMG/M |
| 3300025456|Ga0209776_1029881 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 1203 | Open in IMG/M |
| 3300025623|Ga0209041_1008787 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia | 4325 | Open in IMG/M |
| 3300025673|Ga0209494_1055525 | Not Available | 1295 | Open in IMG/M |
| 3300026084|Ga0208881_1001875 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia | 7338 | Open in IMG/M |
| 3300026092|Ga0207965_1003505 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia | 4550 | Open in IMG/M |
| 3300026207|Ga0208895_1112737 | Not Available | 728 | Open in IMG/M |
| 3300026213|Ga0208131_1003776 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia | 3823 | Open in IMG/M |
| 3300026321|Ga0208764_10043076 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 2428 | Open in IMG/M |
| 3300026321|Ga0208764_10077856 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia | 1736 | Open in IMG/M |
| 3300026321|Ga0208764_10114385 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 1385 | Open in IMG/M |
| 3300026321|Ga0208764_10130802 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 1279 | Open in IMG/M |
| 3300026321|Ga0208764_10502814 | Not Available | 555 | Open in IMG/M |
| 3300027630|Ga0209432_1020584 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 1833 | Open in IMG/M |
| 3300027677|Ga0209019_1006764 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia | 4953 | Open in IMG/M |
| 3300027779|Ga0209709_10001851 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia | 19076 | Open in IMG/M |
| 3300027779|Ga0209709_10352624 | Not Available | 603 | Open in IMG/M |
| 3300027827|Ga0209035_10331334 | Not Available | 752 | Open in IMG/M |
| 3300027827|Ga0209035_10419752 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 654 | Open in IMG/M |
| 3300027838|Ga0209089_10007302 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia | 8791 | Open in IMG/M |
| 3300027838|Ga0209089_10210672 | Not Available | 1142 | Open in IMG/M |
| 3300027838|Ga0209089_10447745 | Not Available | 707 | Open in IMG/M |
| 3300027839|Ga0209403_10470549 | Not Available | 642 | Open in IMG/M |
| 3300027844|Ga0209501_10439144 | Not Available | 763 | Open in IMG/M |
| 3300027847|Ga0209402_10008316 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia | 8810 | Open in IMG/M |
| 3300028198|Ga0257121_1197125 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 645 | Open in IMG/M |
| 3300028487|Ga0257109_1234829 | Not Available | 508 | Open in IMG/M |
| 3300031142|Ga0308022_1009627 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 3200 | Open in IMG/M |
| 3300031510|Ga0308010_1319434 | Not Available | 527 | Open in IMG/M |
| 3300031596|Ga0302134_10114877 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 1158 | Open in IMG/M |
| 3300031598|Ga0308019_10351699 | Not Available | 538 | Open in IMG/M |
| 3300031605|Ga0302132_10293182 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 756 | Open in IMG/M |
| 3300031605|Ga0302132_10465008 | Not Available | 560 | Open in IMG/M |
| 3300031606|Ga0302119_10035394 | All Organisms → cellular organisms → Bacteria | 2104 | Open in IMG/M |
| 3300031606|Ga0302119_10085091 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia | 1294 | Open in IMG/M |
| 3300031606|Ga0302119_10146779 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 938 | Open in IMG/M |
| 3300031623|Ga0302123_10332153 | Not Available | 723 | Open in IMG/M |
| 3300031623|Ga0302123_10441038 | Not Available | 593 | Open in IMG/M |
| 3300031627|Ga0302118_10089784 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia | 1538 | Open in IMG/M |
| 3300031721|Ga0308013_10010429 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia | 4077 | Open in IMG/M |
| 3300031774|Ga0315331_10653900 | Not Available | 747 | Open in IMG/M |
| 3300031774|Ga0315331_10664092 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 740 | Open in IMG/M |
| 3300031775|Ga0315326_10910895 | Not Available | 541 | Open in IMG/M |
| 3300031801|Ga0310121_10053165 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia | 2719 | Open in IMG/M |
| 3300032011|Ga0315316_10188610 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia | 1719 | Open in IMG/M |
| 3300032019|Ga0315324_10353157 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 530 | Open in IMG/M |
| 3300032032|Ga0315327_10873378 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 542 | Open in IMG/M |
| 3300032132|Ga0315336_1089818 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia | 1372 | Open in IMG/M |
| 3300032278|Ga0310345_11023074 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 807 | Open in IMG/M |
| 3300034695|Ga0372840_174155 | Not Available | 641 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 47.24% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 11.02% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 8.66% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 6.30% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 3.15% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 3.15% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 3.94% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 3.94% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 2.36% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 2.36% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 1.57% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 1.57% |
| Methane Seep Mesocosm | Environmental → Aquatic → Marine → Unclassified → Unclassified → Methane Seep Mesocosm | 1.57% |
| Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 0.79% |
| Hydrothermal Vent Fluids | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Fluids | 0.79% |
| Diffuse Hydrothermal Fluid | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Fluid | 0.79% |
| Marine, Hydrothermal Vent Plume | Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Marine, Hydrothermal Vent Plume | 0.79% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000137 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample F_10_SI03_10 | Environmental | Open in IMG/M |
| 3300000142 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2009 P16 500m | Environmental | Open in IMG/M |
| 3300000150 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 48 08/11/10 120m | Environmental | Open in IMG/M |
| 3300000170 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 36 08/11/09 135m | Environmental | Open in IMG/M |
| 3300000193 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 47 07/07/10 135m | Environmental | Open in IMG/M |
| 3300000219 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - February 2010 P16 1000m | Environmental | Open in IMG/M |
| 3300000222 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2009 P12 500m | Environmental | Open in IMG/M |
| 3300000264 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample_A_09_P04_500 | Environmental | Open in IMG/M |
| 3300002683 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - MetaT SI075_165m_B (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300002913 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - AAIW_A/KNORR_S2/LV | Environmental | Open in IMG/M |
| 3300003702 | Hydrothermal vent plume microbial communities from the Mid Cayman Rise - Piccard2013-Plume - Microbial Assembly | Environmental | Open in IMG/M |
| 3300004276 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_165m | Environmental | Open in IMG/M |
| 3300005234 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI047_100m_RNA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005398 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV201 | Environmental | Open in IMG/M |
| 3300005401 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV203 | Environmental | Open in IMG/M |
| 3300005402 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV73 | Environmental | Open in IMG/M |
| 3300005431 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV75 | Environmental | Open in IMG/M |
| 3300005521 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV255 | Environmental | Open in IMG/M |
| 3300005945 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_AAIW_ad_876m_LV_B | Environmental | Open in IMG/M |
| 3300006011 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_O2min_ad_340m_LV | Environmental | Open in IMG/M |
| 3300006012 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_AAIW_ad_750m_LV_A | Environmental | Open in IMG/M |
| 3300006079 | Microbial communities in diffuse hydrothermal fluids of Manus Basin, Bismarck Sea ? fluid D | Environmental | Open in IMG/M |
| 3300006091 | Marine microbial communities from the Eastern Tropical South Pacific Oxygen Minumum Zone, cruise NBP1315, 2013 - sample NBP125 | Environmental | Open in IMG/M |
| 3300006166 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV91 | Environmental | Open in IMG/M |
| 3300006310 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_3_0500m | Environmental | Open in IMG/M |
| 3300006311 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_1_1000m | Environmental | Open in IMG/M |
| 3300006313 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_2_0770m | Environmental | Open in IMG/M |
| 3300006346 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_0770m | Environmental | Open in IMG/M |
| 3300006567 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_0770m | Environmental | Open in IMG/M |
| 3300006902 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_250_ad_251m_LV_A | Environmental | Open in IMG/M |
| 3300007514 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 2.7-0.2um, replicate a | Environmental | Open in IMG/M |
| 3300008253 | Methane-oxidizing microbial communities from mesocosms in the Hudson Canyon - EN1B Hudson Canyon | Environmental | Open in IMG/M |
| 3300009104 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 2.7-0.2um | Environmental | Open in IMG/M |
| 3300009132 | Combined Assembly of Gp0139359, Gp0139510 | Environmental | Open in IMG/M |
| 3300009173 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 | Environmental | Open in IMG/M |
| 3300009409 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009425 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 | Environmental | Open in IMG/M |
| 3300009705 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 | Environmental | Open in IMG/M |
| 3300009786 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300013116 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, May cruise - 103m, 2.7-0.2um, replicate b | Environmental | Open in IMG/M |
| 3300020263 | Marine microbial communities from Tara Oceans - TARA_B100000809 (ERX555942-ERR599125) | Environmental | Open in IMG/M |
| 3300020286 | Marine microbial communities from Tara Oceans - TARA_B100000470 (ERX556011-ERR599131) | Environmental | Open in IMG/M |
| 3300020298 | Marine microbial communities from Tara Oceans - TARA_B100000953 (ERX556051-ERR599128) | Environmental | Open in IMG/M |
| 3300020300 | Marine microbial communities from Tara Oceans - TARA_B100000959 (ERX555977-ERR598981) | Environmental | Open in IMG/M |
| 3300020330 | Marine microbial communities from Tara Oceans - TARA_B100001964 (ERX556097-ERR599147) | Environmental | Open in IMG/M |
| 3300020354 | Marine microbial communities from Tara Oceans - TARA_B100000408 (ERX555905-ERR599164) | Environmental | Open in IMG/M |
| 3300020389 | Marine microbial communities from Tara Oceans - TARA_B100000809 (ERX556139-ERR599008) | Environmental | Open in IMG/M |
| 3300020398 | Marine microbial communities from Tara Oceans - TARA_B100000949 (ERX555993-ERR599072) | Environmental | Open in IMG/M |
| 3300020399 | Marine microbial communities from Tara Oceans - TARA_B100000470 (ERX555969-ERR598947) | Environmental | Open in IMG/M |
| 3300020472 | Marine microbial communities from Tara Oceans - TARA_B100001250 (ERX556017-ERR598995) | Environmental | Open in IMG/M |
| 3300020476 | Marine microbial communities from Tara Oceans - TARA_B100001750 (ERX556108-ERR598958) | Environmental | Open in IMG/M |
| 3300021065 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 500m 12015 | Environmental | Open in IMG/M |
| 3300021068 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 100m 12015 | Environmental | Open in IMG/M |
| 3300021342 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021345 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021352 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 150m 12015 | Environmental | Open in IMG/M |
| 3300021443 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 12015 | Environmental | Open in IMG/M |
| 3300021791 | Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Daikoku_FS921 150_kmer | Environmental | Open in IMG/M |
| 3300022227 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014_SV_150_PacBio MetaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300022931 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_100_MG | Environmental | Open in IMG/M |
| 3300022933 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_100_MG | Environmental | Open in IMG/M |
| 3300025456 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI074_LV_10m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025623 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S2LV_100m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025673 | Methane-oxidizing microbial communities from mesocosms in the Hudson Canyon - EN1B Hudson Canyon (SPAdes) | Environmental | Open in IMG/M |
| 3300026084 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_AAIW_ad_876m_LV_B (SPAdes) | Environmental | Open in IMG/M |
| 3300026092 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_O2min_ad_571m_LV (SPAdes) | Environmental | Open in IMG/M |
| 3300026207 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV82 (SPAdes) | Environmental | Open in IMG/M |
| 3300026213 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV73 (SPAdes) | Environmental | Open in IMG/M |
| 3300026321 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV91 (SPAdes) | Environmental | Open in IMG/M |
| 3300027630 | Marine microbial communities from oxygen minimum zone in mesopelagic equatorial Pacific - METZYME_3_800m (SPAdes) | Environmental | Open in IMG/M |
| 3300027677 | Marine microbial communities from oxygen minimum zone in mesopelagic equatorial Pacific - METZYME_3_300m (SPAdes) | Environmental | Open in IMG/M |
| 3300027779 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300027827 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - AAIW_A/KNORR_S2/LV (SPAdes) | Environmental | Open in IMG/M |
| 3300027838 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300027839 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_86 (SPAdes) | Environmental | Open in IMG/M |
| 3300027844 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300027847 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300028198 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI106_100 | Environmental | Open in IMG/M |
| 3300028487 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_2000m | Environmental | Open in IMG/M |
| 3300031142 | Marine microbial communities from water near the shore, Antarctic Ocean - #353 | Environmental | Open in IMG/M |
| 3300031510 | Marine microbial communities from water near the shore, Antarctic Ocean - #129 | Environmental | Open in IMG/M |
| 3300031596 | Marine microbial communities from Western Arctic Ocean, Canada - CB9_SCM | Environmental | Open in IMG/M |
| 3300031598 | Marine microbial communities from water near the shore, Antarctic Ocean - #284 | Environmental | Open in IMG/M |
| 3300031605 | Marine microbial communities from Western Arctic Ocean, Canada - CB9_32.1 | Environmental | Open in IMG/M |
| 3300031606 | Marine microbial communities from Western Arctic Ocean, Canada - AG5_Tmax | Environmental | Open in IMG/M |
| 3300031623 | Marine microbial communities from Western Arctic Ocean, Canada - CB21_32.1 | Environmental | Open in IMG/M |
| 3300031627 | Marine microbial communities from Western Arctic Ocean, Canada - AG5_33.1 | Environmental | Open in IMG/M |
| 3300031721 | Marine microbial communities from water near the shore, Antarctic Ocean - #181 | Environmental | Open in IMG/M |
| 3300031774 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915 | Environmental | Open in IMG/M |
| 3300031775 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 32315 | Environmental | Open in IMG/M |
| 3300031801 | Marine microbial communities from Western Arctic Ocean, Canada - CB27_Tmax_986 | Environmental | Open in IMG/M |
| 3300032011 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416 | Environmental | Open in IMG/M |
| 3300032019 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 21515 | Environmental | Open in IMG/M |
| 3300032032 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 32315 | Environmental | Open in IMG/M |
| 3300032132 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - ASW #5 | Environmental | Open in IMG/M |
| 3300032278 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-500_MG | Environmental | Open in IMG/M |
| 3300034695 | Seawater microbial communities from the Northeast subarctic Pacific Ocean - P26_June_2012_500m | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| LP_F_10_SI03_10DRAFT_10130922 | 3300000137 | Marine | MKISLLKKLAPYLTLRGKKHRKLSQIQIENFDLNDFLFYRENRS* |
| LPaug09P16500mDRAFT_10046394 | 3300000142 | Marine | MKIPLLKKLAPYLTRRGKKHRKLSQIQIENFDLNDFLFYRENRS* |
| SI48aug10_120mDRAFT_10324362 | 3300000150 | Marine | MKLPLLKKLAPCLTRRGKKHRKLSQIQIENFDLNDFLFYRENRS* |
| SI36aug09_135mDRAFT_10383431 | 3300000170 | Marine | MKTLSLKKIAPCLNRRKKEQRKLSHLNIENFDLTEFLFHRENR |
| SI47jul10_135mDRAFT_10533932 | 3300000193 | Marine | MKTSLLKKLAPNFTRRGKKHRKLSQIQIENFDLNDFLFHRENR* |
| LPfeb10P161000mDRAFT_10167822 | 3300000219 | Marine | MKIPLLKKIAPCLTRRGKKHRKLSQIQIENFDLNDFLFYRENRS* |
| LPjun09P12500mDRAFT_10056804 | 3300000222 | Marine | MKTPSLKKLAPCLTRRGKKHRKLSQIQIENFDLNDFLFYRENRS* |
| LP_A_09_P04_500DRAFT_10021752 | 3300000264 | Marine | MKXXXXKKLAPXLTRRGKKHRKLSQIQIXNFDLNDFLFYRENRS* |
| LP_A_09_P04_500DRAFT_10029384 | 3300000264 | Marine | MKTSLLKKLAPCFTRREKKHRKLSQIQIENFNLNDFLFHRE |
| Ga0005275J37221_1066942 | 3300002683 | Marine | MKTLSLKKIAPCLNRRKKEQRKLSHLNIENFDLTEFLFHRENRN* |
| JGI26060J43896_100097302 | 3300002913 | Marine | MKTPSLKKLAPCLTRRGKKHRKLSQIQIENFDLNEFLFYRENRS* |
| PicMicro_100167684 | 3300003702 | Marine, Hydrothermal Vent Plume | MKIPLLKKLAPCLTRRGKKHRKLSQIQIENFDLNDFLFYRENRS* |
| Ga0066610_102107931 | 3300004276 | Marine | MKTSLLKKLAPNFTRRGKKHRKLSQIQIENFDLNDFLFHRENRS* |
| Ga0066613_13254572 | 3300005234 | Marine | KTIMKTSLLKKLAPNFTRRGKKHRKLSQIQIENFDLNDFLFHRENRS* |
| Ga0066858_100006785 | 3300005398 | Marine | MKTSLLKKLAPCFTRREKKHRKLSQIQIENFDLNDFLFHRENRS* |
| Ga0066857_101128362 | 3300005401 | Marine | MKTSLLKKLAPCFTRREKKHRKLSQIQIENFNLNDFLFHRENRS* |
| Ga0066855_102144452 | 3300005402 | Marine | MKTPLLKKIVPCLTRRGKKHRKLSQIQIENFDLNDFLFYRENRS* |
| Ga0066854_102842842 | 3300005431 | Marine | MKIPLLKKLAPCLTRRGKKYRKLSQIQIENFDLNDFLFYRENRS* |
| Ga0066862_100949112 | 3300005521 | Marine | MKTSLLKKLAPSFTRRGGKHRKLSQIQIENFDLNDFLFHRENRS* |
| Ga0066381_100248022 | 3300005945 | Marine | MKTSLLKKLAPCYTQREKKHRKISQIQIENFDLNDFLFYRENRS* |
| Ga0066373_100116462 | 3300006011 | Marine | MKTSLLEKLAPCFTQREKKHRKLSQIQIENFDLNDFLFHRENRS* |
| Ga0066374_100057762 | 3300006012 | Marine | MKIPLLKKLVPCLTRRGKKHRKLSQIQIENFDLNDFLFYRENRS* |
| Ga0081601_10022453 | 3300006079 | Diffuse Hydrothermal Fluid | MKIPLLKKLVHCLTRRGKKHRKLSQIQIENFDLNDFLFYRENRS* |
| Ga0082018_10033272 | 3300006091 | Marine | MKTSLLKKLAPNFTRRGKKHRKLSQIQIENFDLNDFLFYRENRS* |
| Ga0066836_100461412 | 3300006166 | Marine | MKTSLLKRIAPCFTRREKKHGKLSQIQIENFDLNDFLFHRENRS* |
| Ga0066836_100463212 | 3300006166 | Marine | MKTSLLKKLAPSFTRRGGKHRKLSQIQIENFDFNDFLFHRENRS* |
| Ga0066836_109477541 | 3300006166 | Marine | MKIPFVKKLVPILTKQGEKHRQLSQIQIENFDLNDFSFYRENRL* |
| Ga0068471_12369342 | 3300006310 | Marine | MKTSLLKKLAPCLTRRGKKHRKLSQIQIENFDLNDFLFYRENRS* |
| Ga0068478_12069711 | 3300006311 | Marine | KRKTIMKIPLLKKLAPCLTRRGKKHRKLSQIQIENFDLNDFLFYRENRS* |
| Ga0068472_103052371 | 3300006313 | Marine | MKTSLLKKLAPCFTQREKKHRKLSQIQIENFDLNDFLFY |
| Ga0099696_13442292 | 3300006346 | Marine | MKTSLLKKLAPCFTQREKKHRKLSQIQIENFDLNDFLFYRENRS* |
| Ga0099958_11491091 | 3300006567 | Marine | LAPCLTRRGKKYRKLSQIQIENFDLNDFLFYRENRS* |
| Ga0066372_101285221 | 3300006902 | Marine | MKTSLLKKLAPCFTRREKKHRKLSQIQIENFDLNDFLFHRKNRS* |
| Ga0066372_105786262 | 3300006902 | Marine | MKTSLLKKLAPSFTRRGKKHRKLSQIQIENFDLNDFLFHRENRS* |
| Ga0105020_10089818 | 3300007514 | Marine | MKTSLLKKLAPCFTPREKKHRKLSLIQIENFDLNDFFISP* |
| Ga0105349_101786151 | 3300008253 | Methane Seep Mesocosm | MKIPLLKKLAPYLTRRGKKHRKLSQIQIKNFDLNDFLFYRENRS* |
| Ga0117902_10562793 | 3300009104 | Marine | MKTSLLKKIAPCFTRREKKHGKLFQIQIENFDLNDFLFHRENRS* |
| Ga0117902_14440862 | 3300009104 | Marine | MKTSLLKKLALCFTRREKKHRKLSLIQIDNFDLNDFLFHHENLS* |
| Ga0118730_11794272 | 3300009132 | Marine | MKTSLLINLSIFFTQREKNLRKLSQIQIEYFDLNDLLFHRENRS* |
| Ga0114996_102791132 | 3300009173 | Marine | MKTPLLKKIAPYLIRRKKEHRKLSQIQIENFDLNDYLFHRENGS* |
| Ga0114996_104924572 | 3300009173 | Marine | MKIPLLKKLAPYLIQRGKKHRKLSQIQIENFDLNDFLFHRENRS* |
| Ga0114996_105641282 | 3300009173 | Marine | PLLKKLAPYLTRRGKKHRKLSQIQIENFDLNDFLFYRENRS* |
| Ga0114996_110176862 | 3300009173 | Marine | MKTPLLKKLTPYLTRRKKEHRKLSQIQIENFDLSDFLFHRENRS* |
| Ga0114996_112266382 | 3300009173 | Marine | MKIPLLKKLAPCLTRRGKKHRKISQIQIENFDLNDFLFYRENRS* |
| Ga0114993_110597772 | 3300009409 | Marine | MKTPLLKKLTPYLTRRKKEHRKLSQIQIENFDLNDFLFHRENRS* |
| Ga0114994_101914922 | 3300009420 | Marine | MKTPLLKKLTPYLTRRKKEHRKLSQIQIENFDLNDFLFHRENRL* |
| Ga0114994_103028232 | 3300009420 | Marine | MKTPLLKKIAPYLIRRRKEHRKLSQIQIENFDLNDFLFHRENRS* |
| Ga0114997_100610263 | 3300009425 | Marine | MKTPLLKKLTPYLTRRKKEHRKLSQTQIENFDLNNFLFHRENRS* |
| Ga0114997_107555961 | 3300009425 | Marine | MKTPLLKKIAPYLIRREKEHRKLFQIQIENFDLNDYLFHRENRS* |
| Ga0115000_100206204 | 3300009705 | Marine | MKTPLLKKIAPYLIRRRKEHRKLSQIQIENLDLNDFLFHRENRS* |
| Ga0114999_103458871 | 3300009786 | Marine | LPLLKKLAPYLTRRGKKHRKLSQIQIENFDLNDFLFYRENRS* |
| Ga0133547_103831712 | 3300010883 | Marine | MKTLSLKKIASCLTKRKKEQRKLSQLNIENFDLTEFLFHRENRN* |
| Ga0171646_10111934 | 3300013116 | Marine | MKTSLLKKLAPCFTRREKKHRKLLPIQIENFDLNDFFISP* |
| Ga0211679_10015823 | 3300020263 | Marine | MKIPLLKKLAPYLTRRKKEHRKLSQIQIENFDLNDFLFHRENRS |
| Ga0211624_10470682 | 3300020286 | Marine | MKTSLLKKLAPCFTRREKKHRKLSQIQIENFDLNDFLFYCEN |
| Ga0211657_10143782 | 3300020298 | Marine | MKTSLLKKLAPSFTRRGKKHRKLSQIQIENFDLNDFLFHRENRS |
| Ga0211662_10343892 | 3300020300 | Marine | MKTSLLKKLAPNFTRRGKKHRKLSQIQIENFDLNDFLFHRENRS |
| Ga0211572_10314263 | 3300020330 | Marine | ITHSKRKTIMKTSLLKKLAPCFTRREKKHRKLSQIQIENFDLNDFLFHRENRS |
| Ga0211572_10723532 | 3300020330 | Marine | MKTSLLKKLAPNFTRRGKKHRKLSQIQIENFDLNDFLFHREN |
| Ga0211608_100263702 | 3300020354 | Marine | MKIPLLKKLAPCLTRRGKKHRKLSQIQIENFDLNDFLFYRENRS |
| Ga0211680_100794962 | 3300020389 | Marine | MKTPLLKKLAPYLTRRKKEHRKLSQIQIENFDLNDFLFHRENRS |
| Ga0211680_101743542 | 3300020389 | Marine | MKTPSLKKLAPCLTRRGKKHRKLSQIQIENFDLNDFLFYRENRS |
| Ga0211637_100673722 | 3300020398 | Marine | MKIPLLKKLAPCLTRRGKKYRKLSQIQIENFDLNDFLFYRENRS |
| Ga0211623_100406702 | 3300020399 | Marine | MKTPLLKKLVPCLTRRGKKHRKLSQIQIENFDLNDFLFYRENRS |
| Ga0211579_100024798 | 3300020472 | Marine | MKIPFVLKLVPFLTKRGKKHRQLSQIQIENFDLNDFSFYRENRL |
| Ga0211715_100812262 | 3300020476 | Marine | MKTSLLKKLAPCFTPREKKHRKLSLIQIENFDLNDFLFHRENRS |
| Ga0206686_11029902 | 3300021065 | Seawater | PLLKKLAPCLTRRGKKHRKLSQIQIENFDLNDFLFYRENRS |
| Ga0206684_10204852 | 3300021068 | Seawater | MKTSLLKKLAPCFTRREKKHRKLSQIQIENFNLNDFLFHRENRS |
| Ga0206691_12145673 | 3300021342 | Seawater | MKTSLLKKLAPSFTRRGKKHRKLSQIQIENFDLNDFLFYRENRS |
| Ga0206688_103128511 | 3300021345 | Seawater | RKTIMKTSLLKKLAPCFTRREKKHRKLSQIQIENFNLNDFLFHRENRS |
| Ga0206680_102536832 | 3300021352 | Seawater | MKTSLLKKLAPCFTRREKKHRKLSQIQIENFDLNDFLFHRENRS |
| Ga0206681_103262221 | 3300021443 | Seawater | MKISLLKKLAPYLTRRGKKHRKLSQIQIENFDLNDFLFYRENRS |
| Ga0226832_101400282 | 3300021791 | Hydrothermal Vent Fluids | SLLKKLAPCFTRREKKHRKLSQIQIENFDLNDFLFHRENRS |
| Ga0187827_103547062 | 3300022227 | Seawater | MKTSLLKKLAPCFTRREKKHRKLSQIQIENFDLNDFL |
| Ga0187827_106478261 | 3300022227 | Seawater | RKTIMKTSLLKKLAPCFTRREKKHRKLSQIQIENFDLNDFLFHRENRS |
| (restricted) Ga0233433_1000038149 | 3300022931 | Seawater | MKTLSLKKIAPCLNRRKKEQRKLSHLNIENFDLTEFLFHRENRN |
| (restricted) Ga0233433_100507322 | 3300022931 | Seawater | MKLPLLKKLAPCLTRRGKKHRKLSQIQIENFDLNDFLFYRENRS |
| (restricted) Ga0233427_100100273 | 3300022933 | Seawater | MKISLLKKLAPYLTLRGKKHRKLSQIQIENFDLNDFLFYRENRS |
| Ga0209776_10298812 | 3300025456 | Marine | MKTLSLKKIAPCLNRRKKEQRKLSHLNIENFDLTEFLFHRE |
| Ga0209041_10087875 | 3300025623 | Marine | MKTSLLKKLAPNFTRRGKKHRKLSQIQIENFDLNDFLFYRENRS |
| Ga0209494_10555251 | 3300025673 | Methane Seep Mesocosm | IKITHSKRKTIMKIPLLKKLAPYLTRRGKKHRKLSQIQIKNFDLNDFLFYRENRS |
| Ga0208881_10018753 | 3300026084 | Marine | MKIPLLKKLAPYLTRRGKKHRKLSQIQIENFDLNDFLFYRENRS |
| Ga0207965_10035052 | 3300026092 | Marine | MKTSLLKKLAPCFTQREKKHWKLSQIQIENFDLNDFLFHRENRS |
| Ga0208895_11127372 | 3300026207 | Marine | MKTSLLKKLAPCLTRRGKKHRKLSQIQIENFDLNDFLFYRENRS |
| Ga0208131_10037762 | 3300026213 | Marine | MKIPLLKKLALCLTRRGKKHRKLSQIQIENFDLNDFLFYRENRS |
| Ga0208764_100430762 | 3300026321 | Marine | MKTSLLKRIAPCFTRREKKHGKLSQIQIENFDLNDFLFHRENRS |
| Ga0208764_100778561 | 3300026321 | Marine | LKEIMKTSLLINLSTFFTQREKKLRKLSQIQIEYFDLNDLLFHRENRS |
| Ga0208764_101143851 | 3300026321 | Marine | MKTSLLKKLAPSFTRRGGKHRKLSQIQIENFDFNDFLFHREN |
| Ga0208764_101308022 | 3300026321 | Marine | MITPLLKKLVPCLTRRGKKHRKLSQIQIENFDLNDFLFYRENRS |
| Ga0208764_105028142 | 3300026321 | Marine | MKIPFVKKLVPILTKQGEKHRQLSQIQIENFDLNDFSFYSENRL |
| Ga0209432_10205842 | 3300027630 | Marine | MKTSLLKKLAPCFTQREKKHRKLSQIQIENFDLNDFLFYRENRS |
| Ga0209019_10067644 | 3300027677 | Marine | MKTSLLKKLAPCFTRREKKHRKLSQIQIENFYLNDFLFYRENRS |
| Ga0209709_100018514 | 3300027779 | Marine | MKTPLLKKIAPYLIRRRKEHRKLSQIQIENFDLNDFLFHRENRS |
| Ga0209709_103526241 | 3300027779 | Marine | IIMKTPLLKKLTPYLTRRKKEHRKLSQIQIENFDLNDFLFHRENRS |
| Ga0209035_103313342 | 3300027827 | Marine | MKTPSLKKLAPCLTRRGKKHRKLSQIQIENFDLNEFLFYRENRS |
| Ga0209035_104197522 | 3300027827 | Marine | MKTPLFKKIAPYLIRREKEHRKLSQIQIENFDLNDYLFHRENRS |
| Ga0209089_100073025 | 3300027838 | Marine | MKTPLLKKIAPYLIRRKKEHRKLSQIQIENFDLNDYLFHRENGS |
| Ga0209089_102106722 | 3300027838 | Marine | MKTPLLKKLTPYLTRRKKEHRKLSQIQIENFDLNDFLFHRENRS |
| Ga0209089_104477452 | 3300027838 | Marine | MKIPLLKKLAPCLTRRGKKHRKISQIQIENFDLNDFLFYRENRS |
| Ga0209403_104705492 | 3300027839 | Marine | MKIPLLKKLAPYLIQRGKKHRKLSQIQIENFDLNDFLFHRENRS |
| Ga0209501_104391442 | 3300027844 | Marine | MKLPLLKKLAPYLTRRGKKHRKLSQIQIENFDLNDFLFYRENRS |
| Ga0209402_100083162 | 3300027847 | Marine | MKIHLLKKLAPCLTRRGKKHRKISQIQIENFDLNDFLFYRENRS |
| Ga0257121_11971252 | 3300028198 | Marine | MKLPLLKKLAPCLTRRGKKHRKLSQIQIENFDLNDFL |
| Ga0257109_12348291 | 3300028487 | Marine | MKIPLLKKLAPCLTQLGKKHRKLFQIQIENFDLNDFLFHRENRS |
| Ga0308022_10096272 | 3300031142 | Marine | MKTPLLKKLAPYLTRRKKEHRKLSQIQIENFDLNDYLFHRENRS |
| Ga0308010_13194341 | 3300031510 | Marine | KRRINMKTPLLKKIAPYLIRGKKEHRKLSQIQIENFDLNDYLFHRENRS |
| Ga0302134_101148772 | 3300031596 | Marine | MKTPLLKKLTPYLTRRKKEHRKLSQIQIENFDLNNFLFHRENRS |
| Ga0308019_103516991 | 3300031598 | Marine | LKKIAPYLIRWKKEHRKLSQIQIENFDFNDYLFHRENRS |
| Ga0302132_102931821 | 3300031605 | Marine | MKTPLLKKIAPYLIRRKKEHRKLSQIQIENFDLNDY |
| Ga0302132_104650082 | 3300031605 | Marine | RIIMKTPLLKKIAPYLIRRRKEHRKLSQIQIENFDLNDFLFHRENRS |
| Ga0302119_100353942 | 3300031606 | Marine | MKTPLLKKIAPYLIRRKKEHRKLSQIQIENFDFNDYLFHRENRS |
| Ga0302119_100850912 | 3300031606 | Marine | MKTSLLKKLAPCFTQRERKHRKLTQIQIENFDLNDFLFYRENRS |
| Ga0302119_101467791 | 3300031606 | Marine | MKIPLLKKLAPYLTRRGKNHRKLSQIQIENFDLNDFLFYRENRS |
| Ga0302123_103321532 | 3300031623 | Marine | MKIPLLKKLAPCFTQREKKHQKLSQIQIENFDLNDFLFYRENRS |
| Ga0302123_104410381 | 3300031623 | Marine | KLAPYLTRRGKKHRKLSQIQIENFDLNDFLFYRENRS |
| Ga0302118_100897842 | 3300031627 | Marine | MKTPLLKKIAPYLTRWKKEHRKLSQIQIENFDLNDFLFHRENRL |
| Ga0308013_100104293 | 3300031721 | Marine | MKTPLLKKIAPYLTRRKKEHRKLSQIQIENFDLNDYLFHRENRS |
| Ga0315331_106539002 | 3300031774 | Seawater | KTIMKIPFVKKLVPILTKQGEKHRQLSQIQIENFDLNDFSFYRENRL |
| Ga0315331_106640922 | 3300031774 | Seawater | MKIPFVKKLVPILTKQGEKHRQLSQIQIENFDLNDFSFYSE |
| Ga0315326_109108952 | 3300031775 | Seawater | IKLVPILTKQGEKHRQLSQIQIENFDLNDFSFYSENRL |
| Ga0310121_100531652 | 3300031801 | Marine | MKIPLLKKLAPYLTQRGKKHRKLSQIQIENFDLNDFLFYRENRS |
| Ga0315316_101886102 | 3300032011 | Seawater | MKIPFVIKLVPFLTKRGKKHRQLSQIQIENFDLNDFSFYRENRL |
| Ga0315324_103531571 | 3300032019 | Seawater | MKTSLLKKLAPCFTRREKKHRKLSQIQIENFDLNDFLFH |
| Ga0315327_108733781 | 3300032032 | Seawater | MKIPFVIKLVPILTKQGEKHRQLSQIQIENFDLNDFS |
| Ga0315336_10898182 | 3300032132 | Seawater | MKLPLLKKLAPCLTRRGKKHRKLSQIQIENFDLNDFLFHRENRS |
| Ga0310345_110230742 | 3300032278 | Seawater | MKTSLLKKLAPCLTRRGKKHRKISQVQIENFDLNDFLFYRENRS |
| Ga0372840_174155_488_640 | 3300034695 | Seawater | SKRKTIMKIPLLKKLAPCLTRRGKKHRKISQIQIENFDLNDFLFYRENRS |
| ⦗Top⦘ |