| Basic Information | |
|---|---|
| Family ID | F065834 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 127 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MKRKNKIIVLLLLLGTILAFGCNKNYYSGTGKGSNCGCPSHKGMSGY |
| Number of Associated Samples | 109 |
| Number of Associated Scaffolds | 127 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 9.45 % |
| % of genes near scaffold ends (potentially truncated) | 47.24 % |
| % of genes from short scaffolds (< 2000 bps) | 69.29 % |
| Associated GOLD sequencing projects | 101 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.34 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.213 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (7.874 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.008 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (48.031 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 28.00% β-sheet: 0.00% Coil/Unstructured: 72.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 127 Family Scaffolds |
|---|---|---|
| PF13528 | Glyco_trans_1_3 | 18.11 |
| PF00155 | Aminotran_1_2 | 10.24 |
| PF13715 | CarbopepD_reg_2 | 6.30 |
| PF13620 | CarboxypepD_reg | 5.51 |
| PF04101 | Glyco_tran_28_C | 4.72 |
| PF14905 | OMP_b-brl_3 | 3.94 |
| PF00300 | His_Phos_1 | 1.57 |
| PF00406 | ADK | 1.57 |
| PF00892 | EamA | 0.79 |
| PF00355 | Rieske | 0.79 |
| PF15902 | Sortilin-Vps10 | 0.79 |
| PF00005 | ABC_tran | 0.79 |
| PF00378 | ECH_1 | 0.79 |
| PF10604 | Polyketide_cyc2 | 0.79 |
| PF01641 | SelR | 0.79 |
| PF05193 | Peptidase_M16_C | 0.79 |
| PF00781 | DAGK_cat | 0.79 |
| COG ID | Name | Functional Category | % Frequency in 127 Family Scaffolds |
|---|---|---|---|
| COG0563 | Adenylate kinase or related kinase | Nucleotide transport and metabolism [F] | 1.57 |
| COG1597 | Phosphatidylglycerol kinase, diacylglycerol kinase family | Lipid transport and metabolism [I] | 1.57 |
| COG0229 | Peptide methionine sulfoxide reductase MsrB | Posttranslational modification, protein turnover, chaperones [O] | 0.79 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.21 % |
| Unclassified | root | N/A | 0.79 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352025|deepsgr__Contig_126854 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 598 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c0851338 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 9127 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c2273709 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 868 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101881135 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2840 | Open in IMG/M |
| 3300000893|AP72_2010_repI_A001DRAFT_1004941 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 2571 | Open in IMG/M |
| 3300000955|JGI1027J12803_103399398 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 936 | Open in IMG/M |
| 3300001977|JGI24746J21847_1071035 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 507 | Open in IMG/M |
| 3300002090|JGI24806J26614_1001609 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Niastella → Niastella koreensis | 7965 | Open in IMG/M |
| 3300002100|JGI24809J26612_1013023 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 1645 | Open in IMG/M |
| 3300002100|JGI24809J26612_1018305 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea | 1258 | Open in IMG/M |
| 3300002906|JGI25614J43888_10038412 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea | 1492 | Open in IMG/M |
| 3300003453|ERB_1007678 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea | 7174 | Open in IMG/M |
| 3300003465|P52013CM_1064088 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea | 814 | Open in IMG/M |
| 3300004009|Ga0055437_10194322 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 647 | Open in IMG/M |
| 3300004157|Ga0062590_100843607 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 849 | Open in IMG/M |
| 3300004463|Ga0063356_100354577 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea | 1857 | Open in IMG/M |
| 3300004778|Ga0062383_10000755 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea | 8693 | Open in IMG/M |
| 3300004782|Ga0062382_10512213 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 578 | Open in IMG/M |
| 3300004808|Ga0062381_10040372 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales | 1287 | Open in IMG/M |
| 3300005093|Ga0062594_100044996 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea | 2199 | Open in IMG/M |
| 3300005180|Ga0066685_10531753 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea | 812 | Open in IMG/M |
| 3300005183|Ga0068993_10004781 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea | 2688 | Open in IMG/M |
| 3300005184|Ga0066671_10760688 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea | 622 | Open in IMG/M |
| 3300005293|Ga0065715_10583666 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 718 | Open in IMG/M |
| 3300005329|Ga0070683_100006531 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea | 9793 | Open in IMG/M |
| 3300005329|Ga0070683_100130712 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea | 2376 | Open in IMG/M |
| 3300005329|Ga0070683_102285182 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea | 519 | Open in IMG/M |
| 3300005331|Ga0070670_100088604 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 2660 | Open in IMG/M |
| 3300005336|Ga0070680_102013647 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 500 | Open in IMG/M |
| 3300005337|Ga0070682_101231114 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 633 | Open in IMG/M |
| 3300005347|Ga0070668_100471154 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 1083 | Open in IMG/M |
| 3300005355|Ga0070671_100314733 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 1334 | Open in IMG/M |
| 3300005356|Ga0070674_101378046 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 631 | Open in IMG/M |
| 3300005364|Ga0070673_101880099 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea | 567 | Open in IMG/M |
| 3300005367|Ga0070667_100160779 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 1978 | Open in IMG/M |
| 3300005441|Ga0070700_100594703 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 866 | Open in IMG/M |
| 3300005441|Ga0070700_100736652 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 787 | Open in IMG/M |
| 3300005457|Ga0070662_100631454 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 902 | Open in IMG/M |
| 3300005543|Ga0070672_100817247 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 821 | Open in IMG/M |
| 3300005657|Ga0073903_10134541 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea | 1144 | Open in IMG/M |
| 3300005659|Ga0073900_10006824 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea | 5580 | Open in IMG/M |
| 3300005659|Ga0073900_10247136 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 806 | Open in IMG/M |
| 3300005719|Ga0068861_100784584 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea | 893 | Open in IMG/M |
| 3300005719|Ga0068861_101803706 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea | 607 | Open in IMG/M |
| 3300005831|Ga0074471_10513055 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Niabella | 3360 | Open in IMG/M |
| 3300005833|Ga0074472_10511677 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 1870 | Open in IMG/M |
| 3300005834|Ga0068851_10507067 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 724 | Open in IMG/M |
| 3300005836|Ga0074470_11206772 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 2119 | Open in IMG/M |
| 3300005841|Ga0068863_100565761 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 1123 | Open in IMG/M |
| 3300005842|Ga0068858_100380645 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea | 1354 | Open in IMG/M |
| 3300005844|Ga0068862_100607061 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea | 1051 | Open in IMG/M |
| 3300005985|Ga0081539_10043285 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 2612 | Open in IMG/M |
| 3300006046|Ga0066652_100338907 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 1349 | Open in IMG/M |
| 3300006056|Ga0075163_10299841 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 1828 | Open in IMG/M |
| 3300006358|Ga0068871_100040664 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea | 3725 | Open in IMG/M |
| 3300006854|Ga0075425_100258396 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 2004 | Open in IMG/M |
| 3300006871|Ga0075434_101937393 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 595 | Open in IMG/M |
| 3300006871|Ga0075434_102661342 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 500 | Open in IMG/M |
| 3300007004|Ga0079218_10034721 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea | 2970 | Open in IMG/M |
| 3300007004|Ga0079218_12650584 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea | 597 | Open in IMG/M |
| 3300009095|Ga0079224_100197164 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea | 2904 | Open in IMG/M |
| 3300010154|Ga0127503_11296817 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 650 | Open in IMG/M |
| 3300010364|Ga0134066_10167665 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 703 | Open in IMG/M |
| 3300010400|Ga0134122_10082175 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2523 | Open in IMG/M |
| 3300010937|Ga0137776_1811047 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1602 | Open in IMG/M |
| 3300011119|Ga0105246_11138641 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 715 | Open in IMG/M |
| 3300011119|Ga0105246_12579016 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 502 | Open in IMG/M |
| 3300011444|Ga0137463_1000941 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 9648 | Open in IMG/M |
| 3300012202|Ga0137363_11012369 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 706 | Open in IMG/M |
| 3300012204|Ga0137374_10992460 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 608 | Open in IMG/M |
| 3300012212|Ga0150985_100148872 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 509 | Open in IMG/M |
| 3300012212|Ga0150985_102991782 | Not Available | 551 | Open in IMG/M |
| 3300012212|Ga0150985_105644275 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 885 | Open in IMG/M |
| 3300012212|Ga0150985_109861179 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → unclassified Flavobacterium → Flavobacterium sp. | 559 | Open in IMG/M |
| 3300012362|Ga0137361_11454019 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 608 | Open in IMG/M |
| 3300012469|Ga0150984_123365828 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea | 842 | Open in IMG/M |
| 3300012930|Ga0137407_10248874 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1610 | Open in IMG/M |
| 3300012948|Ga0126375_10538381 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 879 | Open in IMG/M |
| 3300012957|Ga0164303_10181523 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1147 | Open in IMG/M |
| 3300012958|Ga0164299_10416173 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 868 | Open in IMG/M |
| 3300012960|Ga0164301_10919996 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 680 | Open in IMG/M |
| 3300012984|Ga0164309_11234439 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 629 | Open in IMG/M |
| 3300012985|Ga0164308_10629497 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 916 | Open in IMG/M |
| 3300013297|Ga0157378_11896017 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 645 | Open in IMG/M |
| 3300013307|Ga0157372_12261191 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 625 | Open in IMG/M |
| 3300015372|Ga0132256_100031234 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 4823 | Open in IMG/M |
| 3300015373|Ga0132257_102291650 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 700 | Open in IMG/M |
| 3300015374|Ga0132255_100053920 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavisolibacter → Flavisolibacter ginsengisoli | 5253 | Open in IMG/M |
| 3300017695|Ga0180121_10294755 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 615 | Open in IMG/M |
| 3300017789|Ga0136617_11065684 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 611 | Open in IMG/M |
| 3300017927|Ga0187824_10009519 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea | 2773 | Open in IMG/M |
| 3300017927|Ga0187824_10038172 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1461 | Open in IMG/M |
| 3300018059|Ga0184615_10081301 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1816 | Open in IMG/M |
| 3300018068|Ga0184636_1322761 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 541 | Open in IMG/M |
| 3300018429|Ga0190272_10124541 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1716 | Open in IMG/M |
| 3300018429|Ga0190272_12373974 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 574 | Open in IMG/M |
| 3300018476|Ga0190274_10004983 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea | 7970 | Open in IMG/M |
| 3300018476|Ga0190274_10032485 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 3583 | Open in IMG/M |
| 3300019487|Ga0187893_10004319 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 27253 | Open in IMG/M |
| 3300021478|Ga0210402_10575213 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1045 | Open in IMG/M |
| 3300023092|Ga0247740_1001281 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 10916 | Open in IMG/M |
| 3300023272|Ga0247760_1051825 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1048 | Open in IMG/M |
| 3300025900|Ga0207710_10010870 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 3833 | Open in IMG/M |
| 3300025920|Ga0207649_10648620 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 815 | Open in IMG/M |
| 3300025923|Ga0207681_10785435 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 795 | Open in IMG/M |
| 3300025931|Ga0207644_11793589 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 513 | Open in IMG/M |
| 3300025933|Ga0207706_10142875 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2105 | Open in IMG/M |
| 3300025938|Ga0207704_11762067 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 532 | Open in IMG/M |
| 3300025942|Ga0207689_10012916 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 7131 | Open in IMG/M |
| 3300025961|Ga0207712_11760129 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 555 | Open in IMG/M |
| 3300025986|Ga0207658_10291569 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1402 | Open in IMG/M |
| 3300026023|Ga0207677_10020186 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 4040 | Open in IMG/M |
| 3300026088|Ga0207641_10055600 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea | 3361 | Open in IMG/M |
| 3300026095|Ga0207676_11082901 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300027694|Ga0209170_1007617 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 4262 | Open in IMG/M |
| 3300027831|Ga0209797_10003224 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavisolibacter → Flavisolibacter tropicus | 8123 | Open in IMG/M |
| 3300027831|Ga0209797_10012989 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea | 3866 | Open in IMG/M |
| 3300027840|Ga0209683_10001595 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 8679 | Open in IMG/M |
| 3300027886|Ga0209486_10901436 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 586 | Open in IMG/M |
| 3300028025|Ga0247723_1124886 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 625 | Open in IMG/M |
| 3300029239|Ga0168092_1000936 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 11819 | Open in IMG/M |
| 3300032004|Ga0307414_10245010 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 1486 | Open in IMG/M |
| 3300032004|Ga0307414_10255637 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavisolibacter → Flavisolibacter tropicus | 1459 | Open in IMG/M |
| 3300032012|Ga0310902_10004887 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium IBVUCB2 | 5066 | Open in IMG/M |
| 3300032143|Ga0315292_10516674 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1006 | Open in IMG/M |
| 3300033412|Ga0310810_10757525 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 888 | Open in IMG/M |
| 3300034197|Ga0370508_0262203 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 567 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 6.30% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.51% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 5.51% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 4.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.15% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.15% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 3.15% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 3.15% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.94% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 2.36% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.36% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.36% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.36% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.36% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.57% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 1.57% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.57% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.57% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.57% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 1.57% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.57% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.57% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.57% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.57% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.57% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.79% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.79% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.79% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.79% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.79% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.79% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Agricultural Soil | 0.79% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.79% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.79% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.79% |
| Ore Pile And Mine Drainage Contaminated Soil | Environmental → Terrestrial → Soil → Unclassified → Mine Drainage → Ore Pile And Mine Drainage Contaminated Soil | 0.79% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.79% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.79% |
| Volcano-Associated Fumarole | Environmental → Terrestrial → Volcanic → Fumaroles → Unclassified → Volcano-Associated Fumarole | 0.79% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.79% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.79% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.79% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.79% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.79% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.79% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.79% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.79% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.79% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.79% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.79% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.79% |
| Wastewater Effluent | Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent | 0.79% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000893 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A001 | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Host-Associated | Open in IMG/M |
| 3300002090 | Soil microbial communities from Manhattan, Kansas, USA - Sample 200um MDA | Environmental | Open in IMG/M |
| 3300002100 | Soil microbial communities from Manhattan, Kansas, USA - Sample 500um MDA | Environmental | Open in IMG/M |
| 3300002906 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm | Environmental | Open in IMG/M |
| 3300003453 | Combined Assembly of Gp0111477, Gp0111476 | Environmental | Open in IMG/M |
| 3300003465 | Ore pile and mine drainage contaminated soil microbial communities from Mina do Sossego, Brazil - P5 sample | Environmental | Open in IMG/M |
| 3300004009 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh | Environmental | Open in IMG/M |
| 3300004782 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh | Environmental | Open in IMG/M |
| 3300004808 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005183 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005657 | Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB14_bulk | Engineered | Open in IMG/M |
| 3300005659 | Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB5-Kit | Engineered | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005831 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.43_YBM | Environmental | Open in IMG/M |
| 3300005833 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK | Environmental | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006056 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 10/23/14 1A DNA | Engineered | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009095 | Agricultural soil microbial communities from Utah to study Nitrogen management - Steer compost 2015 | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017695 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ540 (21.06) (version 2) | Environmental | Open in IMG/M |
| 3300017789 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06) | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300018059 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex | Environmental | Open in IMG/M |
| 3300018068 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b2 | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019487 | White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300023092 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L148-409B-2 | Environmental | Open in IMG/M |
| 3300023272 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L171-409R-4 | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027694 | Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB14_bulk (SPAdes) | Engineered | Open in IMG/M |
| 3300027831 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027840 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300029239 | Activated sludge microbial communities from sewage treatment plant in Sweden - SWESTP22 - Henriksdal-surplus 129 | Engineered | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300034197 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02S_18 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| deepsgr_02037280 | 2199352025 | Soil | MKQNNKILVLLLLLGTIVAFGCNKNYYSGTGKGSNCGCPSHKGMT |
| ICChiseqgaiiDRAFT_085133813 | 3300000033 | Soil | MQFMTRKNNIWLLMLLFVILATACNRNYYSGNGKGSNCGCPSKKGMVGY* |
| ICChiseqgaiiDRAFT_22737093 | 3300000033 | Soil | MKNINKIALLLVFVATVVFAGCNKNYYSGNGKGGKNCGCPSVKQ* |
| INPhiseqgaiiFebDRAFT_1018811354 | 3300000364 | Soil | MKQNNKILVLLLLLGTIVAFGCNKNYYSGTGKGSNCGCPSHKGMTGD* |
| AP72_2010_repI_A001DRAFT_10049413 | 3300000893 | Forest Soil | MKQKSKIIVLLLMLGIIVASCNKNYYSGTGKGSNCGCPSHKGMVGY* |
| JGI1027J12803_1033993981 | 3300000955 | Soil | MRRKNNILILLLLLGTILAFGCNKNYYSGTGKGSNCGCPSHKGMV |
| JGI24746J21847_10710351 | 3300001977 | Corn, Switchgrass And Miscanthus Rhizosphere | MKNIRKMSLLLLLAGVIVLSACNRNYYSGTGKGSSCGCPSHKG |
| JGI24806J26614_10016097 | 3300002090 | Soil | MKRKNKIIVLLLLLGTILAFGCNKNYYSGTGKGSNCGCPSHKGMSGY* |
| JGI24809J26612_10130232 | 3300002100 | Soil | MNRKNKILALLLLLGTIVAFGCNKNYYSGTGKGSNCGCPSHKGMSGY* |
| JGI24809J26612_10183052 | 3300002100 | Soil | MNRKNKILALLLLLGTIVAFGCNKNYYSGTGKGSSCGCPSHKGMSGF* |
| JGI25614J43888_100384121 | 3300002906 | Grasslands Soil | FKEPGGQIMKTINKIALLLLVAGILLVTGCNRNYYSGTGKGSNCGCPSHKGMSGY* |
| ERB_10076786 | 3300003453 | Volcano-Associated Fumarole | MMKKNKIVLLVLLIGTILATACNKNYYSGNGKGGGNCGCPSHKGMTGY* |
| P52013CM_10640882 | 3300003465 | Ore Pile And Mine Drainage Contaminated Soil | MKNNQKLTLLLLLAGMIFLAACNRNYYSGTGKGSNCGCPSHKGMSGY* |
| Ga0055437_101943222 | 3300004009 | Natural And Restored Wetlands | MKTINKIALIVLVAGILVVAGCSRNYYSGTGKGSNCGCPSHKGMVGY |
| Ga0062590_1008436073 | 3300004157 | Soil | MKRRNKILVLLLLLGTILAFGCNKNYYSGTGKGSNCGCPSHKGMVGY* |
| Ga0063356_1003545771 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MKNINKIALLLLLTGMIFLSACSRNYYSGSGKGSNCGCPSHKGMSGY* |
| Ga0062383_100007554 | 3300004778 | Wetland Sediment | MKTTNKIAFLLLISTIMILAGCNKNYYSGSGKGGKNCGCPSHKGMTGY* |
| Ga0062382_105122131 | 3300004782 | Wetland Sediment | QFMKTFNKIALLLLVAGMILVTGCNKNYYSGSGKGGNNCGCPSHKGMTGY* |
| Ga0062381_100403722 | 3300004808 | Wetland Sediment | MKTFNKIALLLLVAGMILVTGCNKNYYSGSGKGGNNCGCPSHKGMTGY* |
| Ga0062594_1000449964 | 3300005093 | Soil | MKNIRKMSLLLLLAGVIVLSACNRNYYSGTGKGSSCGCPSHKGMSGY* |
| Ga0066685_105317531 | 3300005180 | Soil | KHKNKILALLLILGTIVAFSCNKNYYSGTGKGSNCGCPSHKGMAGY* |
| Ga0068993_100047811 | 3300005183 | Natural And Restored Wetlands | MKTINKIALIVLVAGILVVAGCSRNYYSGTGKGSNCGCPSHKGMVGY* |
| Ga0066671_107606882 | 3300005184 | Soil | MFRKNKILVLLLLLGTILAFGCNKNYYSGTGKGSNCGCPSHKGMTGY* |
| Ga0065715_105836661 | 3300005293 | Miscanthus Rhizosphere | MKRRNKILVILLLLGTILAFGCNKNYYSGTGKGSNCGCPSHKGMTGTKELAK |
| Ga0070683_1000065319 | 3300005329 | Corn Rhizosphere | MKRKNKIIVLLLLIGTVLAFGCNKNYYSGTGKGSNCGCPSHKGMVGY* |
| Ga0070683_1001307122 | 3300005329 | Corn Rhizosphere | MKRKNKIIVVLLLLGTILAFGCNKNYYSGTGKGSNCGCPSHKGMVGY* |
| Ga0070683_1022851822 | 3300005329 | Corn Rhizosphere | MKRKNKIIVLLLLMGTILAFGCNKNYYSGTGKGSNCGCPSHKGMTGY* |
| Ga0070670_1000886043 | 3300005331 | Switchgrass Rhizosphere | LEILFMKRKNKIIVLLLLLGTILALGCNKNYYSGTGKGSNCGCPSHKGMVGY* |
| Ga0070680_1020136471 | 3300005336 | Corn Rhizosphere | MKRKNKIIVLLLLMGTILAFGCNKNYYSGTGKGSNCGCPSHKGMV |
| Ga0070682_1012311141 | 3300005337 | Corn Rhizosphere | EILFMKRKNKIIVLLLLMGTILAFGCNKNYYSGTGKGSNCGCPSHKGMVGY* |
| Ga0070668_1004711542 | 3300005347 | Switchgrass Rhizosphere | MKRRNKILVILLLLGTILAFGCNKNYYSGTGKGSNCGCPSHKGMTGY* |
| Ga0070671_1003147332 | 3300005355 | Switchgrass Rhizosphere | MKGKNKIIVLLLLLGTILAFGCNKNYYSGTGKGSNCGCPSHKGMVGY* |
| Ga0070674_1013780461 | 3300005356 | Miscanthus Rhizosphere | MKNIRKMSLLLLLAGVIVLSACNRNYYSGTGKGSSCGCPSHKGMS |
| Ga0070673_1018800992 | 3300005364 | Switchgrass Rhizosphere | MKRKNIIIVLLLLLGTILAFGCNKNYYSGTGKGSNCGCPSHKGMT |
| Ga0070667_1001607793 | 3300005367 | Switchgrass Rhizosphere | MKTINKIALVLLVVGMMVAGCNKNYYSGTGKGSSCGCPSHKGMS |
| Ga0070700_1005947032 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRRNKILVLLLLLGTILAFGCNKNYYSGTGKGNNCGCPSHKGMTGY* |
| Ga0070700_1007366521 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | KMSLLLLLAGVIVLSACNRNYYSGTGKGSSCGCPSHKGMSGY* |
| Ga0070662_1006314544 | 3300005457 | Corn Rhizosphere | EILFMKRRNKILVLLLLLGTILAFGCNKNYYSGTGKGSNCGCPSHKGMVGY* |
| Ga0070672_1008172473 | 3300005543 | Miscanthus Rhizosphere | QKYTILLENSFNLEILFMKRRNKILVILLLLGTILAFGCNKNYYSGTGKGSNCGCPSHKGMTGY* |
| Ga0073903_101345412 | 3300005657 | Activated Sludge | MKTLSKIAIALLLVAFLAACNKNYYSGAGKGGKNCGCPSVR* |
| Ga0073900_100068245 | 3300005659 | Activated Sludge | MKSINKIVIALLLVMVLAACNRNYYSGSGKGGKNCGCPSTKGMSGY* |
| Ga0073900_102471363 | 3300005659 | Activated Sludge | MKTINKIVVALLVIVFLSACNKNYYSGSGKGGKNCGCPSHKGMTGY* |
| Ga0068861_1007845841 | 3300005719 | Switchgrass Rhizosphere | MKTINKIALVLLVVGMMVAGCNKNYYSGTGKGSSCGCPSHKGMSGY* |
| Ga0068861_1018037063 | 3300005719 | Switchgrass Rhizosphere | PKYTILLENSFNLEILFMKRRNKILVILLLLGTILAFGCNKNYYSGTGKGSNCGCPSHKGMTGY* |
| Ga0074471_105130553 | 3300005831 | Sediment (Intertidal) | MKTINKLAIILLVMMFLTACSKNYYSGSGKGGKNCGCPSHKGMSGY* |
| Ga0074472_105116772 | 3300005833 | Sediment (Intertidal) | MKTIHKIAMLLIVAGMLIISGCNKNYYSGSGKGGKNCGCPSHKGMSGY* |
| Ga0068851_105070671 | 3300005834 | Corn Rhizosphere | NSFNLEILFMKRKNKIIVLLLLLGTILALGCNKNYYSGTGKGSNCGCPSHKGMVGY* |
| Ga0074470_112067723 | 3300005836 | Sediment (Intertidal) | MKTINKIALVLLVAGMMIVAGCNRNYYSGTGKGSNCGCPSHKGMVGY* |
| Ga0068863_1005657611 | 3300005841 | Switchgrass Rhizosphere | FMKRKNKIIVLLLLLGTILALGCNKNYYSGTGKGSNCGCPSHKGMVGY* |
| Ga0068858_1003806453 | 3300005842 | Switchgrass Rhizosphere | MKTINKIALLLLLVGTMVAGCNKNYYSGTGKGSSCGCPSHKGMSGY* |
| Ga0068862_1006070612 | 3300005844 | Switchgrass Rhizosphere | MKRKNKIIVLLLLLGTILAFGCNKNYYSGTGKGSNCGCPSHKGMTGY* |
| Ga0081539_100432853 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MNRKNKILVLLLFLGTIVAFGCNKNYYSGTGKGSNCGCPSHKGMSGY* |
| Ga0066652_1003389073 | 3300006046 | Soil | YMKTINKIALLLLVVGMMVAGCNKNYYSGTGKGSSCGCPSHKGMSGY* |
| Ga0075163_102998412 | 3300006056 | Wastewater Effluent | MKNINKIAIALLLIVFLSACNKNYYSGSGKSSKGCGCPGQKGGSGW* |
| Ga0068871_1000406643 | 3300006358 | Miscanthus Rhizosphere | MKRKNKIIVLLLLMGTILASGCNKNYYSGTGKGSNCGCPSHKGMVGY* |
| Ga0075425_1002583963 | 3300006854 | Populus Rhizosphere | MKRKNNIFLLILLLGTILAFGCNKNYYSGTGKGSGCGCPSHKGMVGY* |
| Ga0075434_1019373932 | 3300006871 | Populus Rhizosphere | MNRKNKILVLMLLLGTIVAFGCNKNYYSGTGKGSNCGCPNHKGMSGY* |
| Ga0075434_1026613422 | 3300006871 | Populus Rhizosphere | MKRKNNIIILLLLLGTILAFGCNRNVYSGTGKGSNCGCPSHKGMVGY* |
| Ga0079218_100347213 | 3300007004 | Agricultural Soil | MKNIRKMSLLLLLAGMIFVSACNRNYYSGTGKGSNCGCPSHKGMSGY* |
| Ga0079218_126505842 | 3300007004 | Agricultural Soil | MKTIKKITLFLLLAGMVLVTSCNKNYYSGNGKGSNCGCPSTKGMSGY* |
| Ga0079224_1001971643 | 3300009095 | Agricultural Soil | MKNVNKFTWLLLLAGVLFLAACNRNYYSGTGKGSNCGCPSHKGMVGY* |
| Ga0127503_112968171 | 3300010154 | Soil | KNIIIVLLLLLGTILAFGCNKNYYSGTGKGSNCGCPSHKGMVGY* |
| Ga0134066_101676651 | 3300010364 | Grasslands Soil | NSFNLELHLMKQKNNIWLLILLIGTILAAGCNKNYYSGAGKGGNNCGCPSHKGMSGY* |
| Ga0134122_100821753 | 3300010400 | Terrestrial Soil | MKRKNKIIVLLLLLGTILAFGCNKNYYSGTGKGSNCGCPSHKGMVGYK* |
| Ga0137776_18110474 | 3300010937 | Sediment | EILIMKQKSKIIVLLLMLGIIVASCNKNYYSGTGKGSNCGCPSHKGMVGY* |
| Ga0105246_111386413 | 3300011119 | Miscanthus Rhizosphere | LEILFMKRRNKILVLLLLLGTILAFGCNKNYYSGTGKGSNCGCPSHKGMVGY* |
| Ga0105246_125790161 | 3300011119 | Miscanthus Rhizosphere | KIALVLLVVGMMVAGCNKNYYSGTGKGSSCGCPSHKGMSGY* |
| Ga0137463_100094110 | 3300011444 | Soil | MKRKNNIFLLILLLGTILAFGCNKNYYSGSGKGSGCGCPAHKGMVGY* |
| Ga0137363_110123691 | 3300012202 | Vadose Zone Soil | FRTSFKESRGQIMKTINKIALLLLVAGILLVTGCNRNYYSGTGKGSNCGCPSHKGMSGY* |
| Ga0137374_109924602 | 3300012204 | Vadose Zone Soil | MNRKNKILVLLLLLGTIVAFGCNKNYYSGTGKGSNCGCPNHKGMSGY* |
| Ga0150985_1001488722 | 3300012212 | Avena Fatua Rhizosphere | KNNIFLLILLIGTILAIGCNKNYYSGSGKGSGCGCPTHKGMVGY* |
| Ga0150985_1029917821 | 3300012212 | Avena Fatua Rhizosphere | KIIVLLLLLGTILAFGCNKNYYSGTGKGSNCGCPSHKGMVGY* |
| Ga0150985_1056442751 | 3300012212 | Avena Fatua Rhizosphere | RKNKIIVLLLLLGTILAFGCNKNYYSGTGKGSNCGCPSHKGMVGY* |
| Ga0150985_1098611793 | 3300012212 | Avena Fatua Rhizosphere | HSKRLLAILLIMGIFFAAGCSRNYYSGTGKGSNCGCPSHKGMSGY* |
| Ga0137361_114540191 | 3300012362 | Vadose Zone Soil | MRQKNKILVLLLLLGTIVAFGCNKNYYSGTGKGSNCGCPSHKGM |
| Ga0150984_1233658281 | 3300012469 | Avena Fatua Rhizosphere | YMKSINKIALLLLLAGMFLVSACNRNYYSGTGKGSNCGCPSHKGMSGY* |
| Ga0137407_102488742 | 3300012930 | Vadose Zone Soil | MKTTTKKIALLVLLTGMIILSACNKNYYSGSGKGSSCGCPSHKGMSGY* |
| Ga0126375_105383811 | 3300012948 | Tropical Forest Soil | NLEIQFMKGKNKIIVLLLLLGTILAFGCNKNYYSGTGKGSNCGCPSHKGMVGY* |
| Ga0164303_101815231 | 3300012957 | Soil | LFMKRRNKILVILLLLGTILAFGCNKNYYSGTGKGSNCGCPSHKGMTGY* |
| Ga0164299_104161731 | 3300012958 | Soil | RRNYILVLLLLLGTILAFGCNKNYYSGTGKGSNCGCPSHKGMVGY* |
| Ga0164301_109199961 | 3300012960 | Soil | ILFMKRRNYILVLLLLLGTILAFGCNKNYYSGTGKGSNCGCPSHKGMVGY* |
| Ga0164309_112344391 | 3300012984 | Soil | LFMKGKNKIIVLLLLLGTILAFGCNKNYYSGTGKGSNCGCPSHKGMVGY* |
| Ga0164308_106294971 | 3300012985 | Soil | VLLLLLGTILAFGCNKNYYSGTGKGNNCGCPSHKGMTGY* |
| Ga0157378_118960171 | 3300013297 | Miscanthus Rhizosphere | NSFNLEILFMKRRNKILVILLLLGTILAFGCNKNYYSGTGKGSNCGCPSHKGMTGY* |
| Ga0157372_122611913 | 3300013307 | Corn Rhizosphere | LFMKRRNKILVLLLLLGTILAFGCNKNYYSGTGKGSNCGCPSHKGMVGY* |
| Ga0132256_1000312344 | 3300015372 | Arabidopsis Rhizosphere | MKGKNKIIVLLLLMGTILASGCNKNYYSGTGKGSNCGCPSHKGMVGY* |
| Ga0132257_1022916501 | 3300015373 | Arabidopsis Rhizosphere | IRFMKTKNKIIVVLLLLGTILAFGCNKNYYSGTGKGSNCGCPSHKGMVGY* |
| Ga0132255_1000539201 | 3300015374 | Arabidopsis Rhizosphere | QNNKILVLLLLLGTIVAFSCNKNYYSGTGKGSNCGCPSHKGMTGY* |
| Ga0180121_102947552 | 3300017695 | Polar Desert Sand | MGQIMKIINKIAILLLLAGTVLFTACNKNYYSGSGKGGKNCGCPSNKGMTGY |
| Ga0136617_110656841 | 3300017789 | Polar Desert Sand | MKTINKIALLLLLAGTVMFTACNKNYYSGSGKGGKNCGCPSHKGMSGY |
| Ga0187824_100095191 | 3300017927 | Freshwater Sediment | MKHKNKMVLLLLVLGIIVASGCNRNYYSGTGKGSNCGCPSHKGMVGY |
| Ga0187824_100381723 | 3300017927 | Freshwater Sediment | LEILFMKRNNKLALILVILGIILAAGCNKNYYSGTGKGSNCGCPSHKGMVGY |
| Ga0184615_100813013 | 3300018059 | Groundwater Sediment | MKKKNNIFLLILLMGTILAFGCNKNYYSGNGKGSGCGCPTNH |
| Ga0184636_13227611 | 3300018068 | Groundwater Sediment | MKKKNNIFLLILLIGTILAFGCNKNYYSGNGKGSGCGCPTNH |
| Ga0190272_101245413 | 3300018429 | Soil | MKTINKIALLLLLAGMVVVSACNRNYYSGSGKGSNCGCPSQKGMSGY |
| Ga0190272_123739742 | 3300018429 | Soil | MTGGTYMKSINKLALLVLVAGMMLLASCNKNYYSGSGKGGKNCGCPNTKGMVGY |
| Ga0190274_100049833 | 3300018476 | Soil | MKNINKMTLLLSLAGMIFLSACSRNYYSGSGKGSNCGCPSHKGMSGY |
| Ga0190274_100324852 | 3300018476 | Soil | MKTISKIAVALLVIVFLAACNKNYYSGSGKGGKNCGCPSHKGMSGY |
| Ga0187893_1000431924 | 3300019487 | Microbial Mat On Rocks | MKNNQKLTLLLLLAGMIFLAACNRNYYSGTGKGSNCGCPSHKGMSGY |
| Ga0210402_105752133 | 3300021478 | Soil | MKQKNKIVLLLLILGIIVASGCNKNYYSGTGKGSNCGCPSHKGMTGY |
| Ga0247740_10012815 | 3300023092 | Plant Litter | MKNIKKIALFLLVAGMVVVSSCNKNYYSGSGKGGKNCGCPSHKGMSGY |
| Ga0247760_10518252 | 3300023272 | Plant Litter | MKTIQKIAVALGLIVLLAACNKNYYSGSGKGGKNCGCPSHKGMSGY |
| Ga0207710_100108704 | 3300025900 | Switchgrass Rhizosphere | MKTINKIALLLLLVGTMVAGCNKNYYSGTGKGSSCGCPSHKGMSGY |
| Ga0207649_106486201 | 3300025920 | Corn Rhizosphere | KNIIIVLLLLLGTILAFGCNKNYYSGTGKGSNCGCPSHKGMTGY |
| Ga0207681_107854351 | 3300025923 | Switchgrass Rhizosphere | MKTIHKIALFLLLAGMVIMTSCQRNYYSGTGKGSNCGCPSHKGMTGY |
| Ga0207644_117935892 | 3300025931 | Switchgrass Rhizosphere | NLEILFMKRKNKIIVLLLLMGTILAFGCNKNYYSGTGKGSNCGCPSHKGMVGY |
| Ga0207706_101428753 | 3300025933 | Corn Rhizosphere | LEILFMKRRNKILVLLLLLGTILAFGCNKNYYSGTGKGSNCGCPSHKGMVGY |
| Ga0207704_117620671 | 3300025938 | Miscanthus Rhizosphere | VLLLLMGTILAFGCNKNYYSGTGKGSNCGCPSHKGMVGY |
| Ga0207689_100129161 | 3300025942 | Miscanthus Rhizosphere | KRLLAILLIMGIFFAAGCSRNYYSGTGKGSNCGCPSHKGMSGY |
| Ga0207712_117601291 | 3300025961 | Switchgrass Rhizosphere | FGLRKGIRNKNMKSVHKIALLLVFAASILFAGCNKNYYSGSGKGGKNCGCPSHKGMTGY |
| Ga0207658_102915691 | 3300025986 | Switchgrass Rhizosphere | MRVNNKIIAILLIMGIFFAAGCSRNYYSGTGKGSNCGCPSHKGMSGYSP |
| Ga0207677_100201861 | 3300026023 | Miscanthus Rhizosphere | MKRRNKILVLLLLLGTILAFGCNKNYYSGTGKGSNCGCPSHKGMVG |
| Ga0207641_100556003 | 3300026088 | Switchgrass Rhizosphere | MKTINRIAILLLAAGIILVTSCNKNYYSGSGKGGKNCGCPSHKGMSGY |
| Ga0207676_110829011 | 3300026095 | Switchgrass Rhizosphere | NIRKMSLLLLLAGVIVLSACNRNYYSGTGKGSSCGCPSHKGMSGY |
| Ga0209170_10076174 | 3300027694 | Activated Sludge | MKSINKIVIALLLVMVLAACNRNYYSGSGKGGKNCGCPSTKGMSGY |
| Ga0209797_100032244 | 3300027831 | Wetland Sediment | MKTFNKIALLLLVAGMILVTGCNKNYYSGSGKGGNNCGCPSHKGMTGY |
| Ga0209797_100129894 | 3300027831 | Wetland Sediment | MKTTNKIAFLLLISTIMILAGCNKNYYSGSGKGGKNCGCPSHKGMTGY |
| Ga0209683_1000159510 | 3300027840 | Wetland Sediment | NKIAFLLLISTIMILAGCNKNYYSGSGKGGKNCGCPSHKGMTGY |
| Ga0209486_109014362 | 3300027886 | Agricultural Soil | MRTFNKIALFLLLAGMVLVTSCNKNYYSGTGKGSNCGCPSTKGMSGY |
| Ga0247723_11248861 | 3300028025 | Deep Subsurface Sediment | MKNINKIAIALLLILFLSACNKNYYSGSGKSSKGCGCPGQKGGSGW |
| Ga0168092_100093612 | 3300029239 | Activated Sludge | MKTINKIVVALLLIVFLAACNKNYYSGSGKGGKNCGCPSHKGMSGY |
| Ga0307414_102450103 | 3300032004 | Rhizosphere | MKKSIYILLLVIATITFASCNKNYYSGAGKGSNCGCPSKKGMVGY |
| Ga0307414_102556373 | 3300032004 | Rhizosphere | MKKSIYILLLVASTALFTSCSKNYYSGSGKKSDCGCP |
| Ga0310902_100048871 | 3300032012 | Soil | NSFKFRIQNMKTINKMTLLLSLAGIIFLSACSRNYYSGSGKGSSCGCPSHKGMSGY |
| Ga0315292_105166742 | 3300032143 | Sediment | MKNINKMTLLLLLAGMIFLSACSRNYYSGSGKGSNCGCPS |
| Ga0310810_107575253 | 3300033412 | Soil | MMKKNKIVVLLLLLGTIVAFGCNKNYYSGTGKGSNCGCPSHKGMTGY |
| Ga0370508_0262203_97_237 | 3300034197 | Untreated Peat Soil | MKNINKIAIALLLIVFLSACNKNYYSGSGKSSKGCGCPGQKGGSGW |
| ⦗Top⦘ |