NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F064778

Metagenome / Metatranscriptome Family F064778

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F064778
Family Type Metagenome / Metatranscriptome
Number of Sequences 128
Average Sequence Length 43 residues
Representative Sequence MEKAAFSAACERGKPPGVPGAANGAGYSDDGRKGQEITDL
Number of Associated Samples 106
Number of Associated Scaffolds 128

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.36 %
% of genes near scaffold ends (potentially truncated) 59.38 %
% of genes from short scaffolds (< 2000 bps) 87.50 %
Associated GOLD sequencing projects 105
AlphaFold2 3D model prediction Yes
3D model pTM-score0.16

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (66.406 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(12.500 % of family members)
Environment Ontology (ENVO) Unclassified
(22.656 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(46.094 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: No Secondary Structure distribution: α-helix: 5.88%    β-sheet: 0.00%    Coil/Unstructured: 94.12%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.16
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 128 Family Scaffolds
PF04380BMFP 32.81
PF14693Ribosomal_TL5_C 25.00
PF01790LGT 21.88
PF01386Ribosomal_L25p 10.16
PF02636Methyltransf_28 4.69
PF01195Pept_tRNA_hydro 3.12
PF01575MaoC_dehydratas 0.78
PF06071YchF-GTPase_C 0.78
PF02578Cu-oxidase_4 0.78

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 128 Family Scaffolds
COG2960Ubiquinone biosynthesis accessory factor UbiKCoenzyme transport and metabolism [H] 32.81
COG0682Prolipoprotein diacylglyceryltransferaseCell wall/membrane/envelope biogenesis [M] 21.88
COG1825Ribosomal protein L25 (general stress protein Ctc)Translation, ribosomal structure and biogenesis [J] 10.16
COG1565SAM-dependent methyltransferase, MidA familyGeneral function prediction only [R] 4.69
COG0193Peptidyl-tRNA hydrolaseTranslation, ribosomal structure and biogenesis [J] 3.12
COG0012Ribosome-binding ATPase YchF, GTP1/OBG familyTranslation, ribosomal structure and biogenesis [J] 0.78
COG1496Copper oxidase (laccase) domainInorganic ion transport and metabolism [P] 0.78


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms66.41 %
UnclassifiedrootN/A33.59 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000156|NODE_c0727473All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae7100Open in IMG/M
3300000597|AF_2010_repII_A1DRAFT_10024244All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1656Open in IMG/M
3300000793|AF_2010_repII_A001DRAFT_10123530Not Available541Open in IMG/M
3300000816|AF_2010_repII_A10DRAFT_1013335All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales864Open in IMG/M
3300001915|JGI24741J21665_1022783All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae969Open in IMG/M
3300002070|JGI24750J21931_1001636All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2749Open in IMG/M
3300003911|JGI25405J52794_10087702All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium687Open in IMG/M
3300003995|Ga0055438_10090870All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae851Open in IMG/M
3300004070|Ga0055488_10032405All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1051Open in IMG/M
3300004798|Ga0058859_10694086Not Available504Open in IMG/M
3300005163|Ga0066823_10063589Not Available694Open in IMG/M
3300005183|Ga0068993_10121073Not Available858Open in IMG/M
3300005204|Ga0068997_10019153Not Available1107Open in IMG/M
3300005204|Ga0068997_10019720All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1096Open in IMG/M
3300005218|Ga0068996_10038069All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium885Open in IMG/M
3300005288|Ga0065714_10457582Not Available549Open in IMG/M
3300005293|Ga0065715_10043139All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1080Open in IMG/M
3300005293|Ga0065715_10148517All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1758Open in IMG/M
3300005328|Ga0070676_10015055All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae4261Open in IMG/M
3300005329|Ga0070683_100281939All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1580Open in IMG/M
3300005332|Ga0066388_100319133All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae2199Open in IMG/M
3300005332|Ga0066388_101259546All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1271Open in IMG/M
3300005332|Ga0066388_105930337Not Available617Open in IMG/M
3300005332|Ga0066388_106347118All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium596Open in IMG/M
3300005332|Ga0066388_107841601Not Available534Open in IMG/M
3300005332|Ga0066388_108346928Not Available516Open in IMG/M
3300005336|Ga0070680_100192344All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1719Open in IMG/M
3300005339|Ga0070660_100172944All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1745Open in IMG/M
3300005339|Ga0070660_101388989Not Available596Open in IMG/M
3300005458|Ga0070681_10590887Not Available1024Open in IMG/M
3300005547|Ga0070693_100132926All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1558Open in IMG/M
3300005764|Ga0066903_102503166All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium999Open in IMG/M
3300005764|Ga0066903_102910258All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria928Open in IMG/M
3300005764|Ga0066903_103380760Not Available861Open in IMG/M
3300005764|Ga0066903_107507613Not Available562Open in IMG/M
3300005843|Ga0068860_101770764All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria639Open in IMG/M
3300006057|Ga0075026_100282311All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae901Open in IMG/M
3300006353|Ga0075370_10037259All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae2734Open in IMG/M
3300006603|Ga0074064_11588704All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae516Open in IMG/M
3300006914|Ga0075436_100188824All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1458Open in IMG/M
3300006954|Ga0079219_10240252All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1067Open in IMG/M
3300009092|Ga0105250_10192420Not Available859Open in IMG/M
3300009545|Ga0105237_10034469All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root14625125Open in IMG/M
3300010043|Ga0126380_10350919All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.1074Open in IMG/M
3300010046|Ga0126384_10130646All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1906Open in IMG/M
3300010046|Ga0126384_11266228All Organisms → cellular organisms → Bacteria683Open in IMG/M
3300010046|Ga0126384_11741999Not Available590Open in IMG/M
3300010362|Ga0126377_10207558All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1882Open in IMG/M
3300010373|Ga0134128_12022750Not Available634Open in IMG/M
3300010376|Ga0126381_100894482All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.1278Open in IMG/M
3300010396|Ga0134126_10117535All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root14623253Open in IMG/M
3300012357|Ga0137384_10525840All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.970Open in IMG/M
3300012477|Ga0157336_1024679Not Available567Open in IMG/M
3300012505|Ga0157339_1059015Not Available527Open in IMG/M
3300012507|Ga0157342_1010613Not Available944Open in IMG/M
3300012515|Ga0157338_1002056All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root14621536Open in IMG/M
3300012893|Ga0157284_10009966All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1653Open in IMG/M
3300012893|Ga0157284_10336929Not Available506Open in IMG/M
3300012896|Ga0157303_10059837All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria811Open in IMG/M
3300012960|Ga0164301_10096623All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1684Open in IMG/M
3300012971|Ga0126369_10343684All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1511Open in IMG/M
3300012971|Ga0126369_10567362All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root14621201Open in IMG/M
3300012971|Ga0126369_11822808Not Available697Open in IMG/M
3300012985|Ga0164308_10002945All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root14628915Open in IMG/M
3300012986|Ga0164304_10329860All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root14621058Open in IMG/M
3300012987|Ga0164307_10006163All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root14625621Open in IMG/M
3300012989|Ga0164305_11289925All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales638Open in IMG/M
3300013102|Ga0157371_10393071All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root14621014Open in IMG/M
3300013105|Ga0157369_10834923Not Available946Open in IMG/M
3300013105|Ga0157369_11078365All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales821Open in IMG/M
3300015077|Ga0173483_10776539Not Available550Open in IMG/M
3300015373|Ga0132257_101563293All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462843Open in IMG/M
3300015374|Ga0132255_100536404All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root14621723Open in IMG/M
3300017947|Ga0187785_10039796All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root14621731Open in IMG/M
3300017959|Ga0187779_10679488All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462695Open in IMG/M
3300017974|Ga0187777_10271767Not Available1154Open in IMG/M
3300019361|Ga0173482_10119706All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria984Open in IMG/M
3300019361|Ga0173482_10289074All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria716Open in IMG/M
3300021344|Ga0193719_10133650All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1075Open in IMG/M
3300022889|Ga0247785_1031962All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales619Open in IMG/M
3300022893|Ga0247787_1005112All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root14621492Open in IMG/M
3300022901|Ga0247788_1052040All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria762Open in IMG/M
3300023062|Ga0247791_1007119All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.1649Open in IMG/M
3300023062|Ga0247791_1024637All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.908Open in IMG/M
3300025900|Ga0207710_10001206All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root146213122Open in IMG/M
3300025913|Ga0207695_10199839All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root14621914Open in IMG/M
3300025921|Ga0207652_10020801All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root14625408Open in IMG/M
3300025921|Ga0207652_11078749Not Available703Open in IMG/M
3300025924|Ga0207694_10174373Not Available1742Open in IMG/M
3300025926|Ga0207659_11811461Not Available518Open in IMG/M
3300025938|Ga0207704_10375584All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root14621114Open in IMG/M
3300025957|Ga0210089_1054237Not Available518Open in IMG/M
3300026067|Ga0207678_10198766All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root14621714Open in IMG/M
3300026116|Ga0207674_10815083All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales900Open in IMG/M
3300026142|Ga0207698_12107842Not Available577Open in IMG/M
3300026715|Ga0207604_100713All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales816Open in IMG/M
3300026731|Ga0207523_100559All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales815Open in IMG/M
3300026765|Ga0207590_101470Not Available555Open in IMG/M
3300026995|Ga0208761_1021332Not Available619Open in IMG/M
3300027288|Ga0208525_1011681All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales968Open in IMG/M
3300027364|Ga0209967_1001836All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root14622728Open in IMG/M
3300027474|Ga0207457_101881Not Available546Open in IMG/M
3300027543|Ga0209999_1042789Not Available850Open in IMG/M
3300027775|Ga0209177_10350742Not Available578Open in IMG/M
3300027787|Ga0209074_10115236Not Available926Open in IMG/M
3300028713|Ga0307303_10182497Not Available515Open in IMG/M
3300028755|Ga0307316_10179326Not Available760Open in IMG/M
3300028811|Ga0307292_10214132Not Available794Open in IMG/M
3300028824|Ga0307310_10318910All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462759Open in IMG/M
3300031573|Ga0310915_10000056All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root146256530Open in IMG/M
3300031595|Ga0265313_10008643All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales6735Open in IMG/M
3300031720|Ga0307469_10839891All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462846Open in IMG/M
3300031751|Ga0318494_10119205All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1469Open in IMG/M
3300031820|Ga0307473_11215134Not Available561Open in IMG/M
3300031846|Ga0318512_10184407Not Available1017Open in IMG/M
3300031854|Ga0310904_10426136All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462874Open in IMG/M
3300031892|Ga0310893_10001989All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root14624864Open in IMG/M
3300031913|Ga0310891_10018554All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1709Open in IMG/M
3300032017|Ga0310899_10072267All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root14621326Open in IMG/M
3300032174|Ga0307470_11017366All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462660Open in IMG/M
3300032180|Ga0307471_100740693All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1148Open in IMG/M
3300032205|Ga0307472_100559139Not Available1000Open in IMG/M
3300032205|Ga0307472_100721549All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales899Open in IMG/M
3300032205|Ga0307472_100731126All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales894Open in IMG/M
3300032211|Ga0310896_10318233All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales809Open in IMG/M
3300033433|Ga0326726_10213625All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1785Open in IMG/M
3300033513|Ga0316628_102659287Not Available659Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil12.50%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil7.81%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil7.03%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands5.47%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil5.47%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil3.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.91%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere3.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil3.12%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere3.12%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.34%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.34%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil2.34%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.34%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere2.34%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.34%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.34%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.34%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.34%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.56%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.56%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.56%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.56%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.56%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.78%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.78%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.78%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.78%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.78%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.78%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.78%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.78%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.78%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.78%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.78%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.78%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.78%
Sugar Cane Bagasse Incubating BioreactorEngineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor0.78%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000156Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobicEngineeredOpen in IMG/M
3300000597Forest soil microbial communities from Amazon forest - 2010 replicate II A1EnvironmentalOpen in IMG/M
3300000793Forest soil microbial communities from Amazon forest - 2010 replicate II A001EnvironmentalOpen in IMG/M
3300000816Forest soil microbial communities from Amazon forest - 2010 replicate II A10EnvironmentalOpen in IMG/M
3300001915Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7Host-AssociatedOpen in IMG/M
3300002070Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4Host-AssociatedOpen in IMG/M
3300003911Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300003995Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2EnvironmentalOpen in IMG/M
3300004070Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D2EnvironmentalOpen in IMG/M
3300004798Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300005163Soil and rhizosphere microbial communities from Laval, Canada - mgHMBEnvironmentalOpen in IMG/M
3300005183Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1EnvironmentalOpen in IMG/M
3300005204Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D2EnvironmentalOpen in IMG/M
3300005218Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D2EnvironmentalOpen in IMG/M
3300005288Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1Host-AssociatedOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006057Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012EnvironmentalOpen in IMG/M
3300006353Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5Host-AssociatedOpen in IMG/M
3300006603Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009092Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012477Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610Host-AssociatedOpen in IMG/M
3300012505Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610Host-AssociatedOpen in IMG/M
3300012507Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610Host-AssociatedOpen in IMG/M
3300012515Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610Host-AssociatedOpen in IMG/M
3300012893Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1EnvironmentalOpen in IMG/M
3300012896Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2EnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300022889Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S096-311B-4EnvironmentalOpen in IMG/M
3300022893Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S126-311R-4EnvironmentalOpen in IMG/M
3300022901Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S156-409C-4EnvironmentalOpen in IMG/M
3300023062Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S081-202R-4EnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025957Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026715Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-SCHO22-A (SPAdes)EnvironmentalOpen in IMG/M
3300026731Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05A4-10 (SPAdes)EnvironmentalOpen in IMG/M
3300026765Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G09A1-11 (SPAdes)EnvironmentalOpen in IMG/M
3300026995Soil and rhizosphere microbial communities from Laval, Canada - mgLAB (SPAdes)EnvironmentalOpen in IMG/M
3300027288Soil and rhizosphere microbial communities from Laval, Canada - mgHMC (SPAdes)EnvironmentalOpen in IMG/M
3300027364Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027401Soil and rhizosphere microbial communities from Laval, Canada - mgLAC (SPAdes)EnvironmentalOpen in IMG/M
3300027474Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G09.2A5-11 (SPAdes)EnvironmentalOpen in IMG/M
3300027543Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300028713Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031595Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaGHost-AssociatedOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031892Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2EnvironmentalOpen in IMG/M
3300031913Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4EnvironmentalOpen in IMG/M
3300032017Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032211Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
NODE_072747353300000156Sugar Cane Bagasse Incubating BioreactorMEKGGFFAACARGKPPGVPGAANGAGYSGSFPKGQENRADP*
AF_2010_repII_A1DRAFT_1002424433300000597Forest SoilMEKGGFFAACARGKPPGVPGTANGAGYSGSFPKGQENRADP*
AF_2010_repII_A001DRAFT_1012353023300000793Forest SoilMEKGGFFAACARGKPPGVPGTANGAGYNGSFPKGQE
AF_2010_repII_A10DRAFT_101333523300000816Forest SoilMEKGDFFAACARGKPPGVPGAANGAGYSGSIPKGQENRADP*
JGI24741J21665_102278333300001915Corn RhizosphereFSAACERGKPPGVPGAANGAGYSDDGRKGQEITDLGR*
JGI24750J21931_100163623300002070Corn, Switchgrass And Miscanthus RhizosphereMEKAAFSAACERGKPPGVPGAANGAGYSXDGRKGQEITDLGR*
JGI25405J52794_1008770223300003911Tabebuia Heterophylla RhizosphereMEKAAFSAACERGKPPGVPGAANGPGYSDDRRKGQETTDRGR*
Ga0055438_1009087033300003995Natural And Restored WetlandsTNGKGGFSAACERGKPPGVPGAANEAGYSDDGRKGQEITDLGR*
Ga0055488_1003240523300004070Natural And Restored WetlandsMEKAASAACERGKPPGVPGAANEAGYSDDGRKGQEITDLGR*
Ga0058859_1069408613300004798Host-AssociatedMEKGGFFAACARGKPPGVPGAANGAGYSDDGRKGQEITDLGR*
Ga0066823_1006358913300005163SoilMEKGGFFAACARGKPPGVPGAANGAGYSGSIPKGQENRADT*
Ga0068993_1012107313300005183Natural And Restored WetlandsMEKAAFFAARVRGKPPGVPGAANRAGYSGGVRKGQEIRVR
Ga0068997_1001915313300005204Natural And Restored WetlandsMEKAAFFAAGVRGKPPGVPGAANRAGYSGGVRKGQEIRVRP
Ga0068997_1001972023300005204Natural And Restored WetlandsMEKAASAACERGKPPGVPGAANGAGYSEDGRKGQEITDLGR*
Ga0068996_1003806923300005218Natural And Restored WetlandsMEGGFSAACERGKPPGVPGAANGAGYSEDGRKGQEITDLGR*
Ga0065714_1045758213300005288Miscanthus RhizosphereMEKAAFSAACERGKPPGVPGAANGAGYSGDGRKGQEITNLGRQ*
Ga0065715_1004313933300005293Miscanthus RhizospherePMEKAAFSAACERGKPPGVPGAANGAGYSDDGRKGQEITDLGR*
Ga0065715_1014851713300005293Miscanthus RhizospherePSSKPMEKAAFSAACERGKPPGVPGAANGAGYSGDGRKGQEITNLGRQ*
Ga0070676_1001505563300005328Miscanthus RhizosphereLNPSSKPMEKAAFSAACERGKPPGVPGAANGAGYSDDGRKGQEITDLGR*
Ga0070683_10028193913300005329Corn RhizosphereMEKAAFSAACERGKPPGVPGAANGAGYSDDGRKGQEITDLGR*
Ga0066388_10031913323300005332Tropical Forest SoilMEKAAFSAACERGKPPGVPGAANGPGYSDGGRKGQETTDQAR*
Ga0066388_10125954623300005332Tropical Forest SoilMEKAAFSAACERGKPPGVPGAANGAGYSDDGRKGQETTGLGR*
Ga0066388_10593033723300005332Tropical Forest SoilMEKGGFFAACARGKPPGVPGTANGAGYSGSFPKGQENHADP*
Ga0066388_10634711823300005332Tropical Forest SoilMEKAAFSAACERGKPPGVPGAANGPGYSDDGRKGQETTDLGR*
Ga0066388_10784160123300005332Tropical Forest SoilMEKGGFFAACARGKPPGVPGAANGAGYSVSIPKGQENRADP*
Ga0066388_10834692823300005332Tropical Forest SoilMEKGGFFAACARGKPPGVPGTANGAGYNGSFPKGQENRTDP*
Ga0070680_10019234443300005336Corn RhizosphereMEKAAFSAACERGKPPGVPGAANGAGYSDDGRKGQEITDGH*
Ga0070660_10017294413300005339Corn RhizosphereEKAAFSAACERGKPPGVPGAANGAGYSDDGRKGQEITDLGR*
Ga0070660_10138898923300005339Corn RhizosphereMEKAAFSAACERGKPPGVPGAANGAGYSDDGRKGQEITDL
Ga0070681_1059088723300005458Corn RhizosphereMEKAAFSAACERGKPPGVPGAANGAGYSDDGRKGQEITDLGRMTSPQ
Ga0070693_10013292613300005547Corn, Switchgrass And Miscanthus RhizosphereMEKSGFFAACARGKPPGVPGAANGAGYSGSIPKGQENRADT*
Ga0066903_10250316623300005764Tropical Forest SoilMEKGGFFAAYERGKPPGVPGAANGAGYSGSIAKGQEKPADA*
Ga0066903_10291025823300005764Tropical Forest SoilMEKGGFFADCARGKPPGVPGAANGAGYSGTIRKGQENRPDP*
Ga0066903_10338076013300005764Tropical Forest SoilMEKAAFSAACERGKPPGVPGAANAAGYSGGGRKEQGTTPLS
Ga0066903_10750761323300005764Tropical Forest SoilMEKGGFFAACARGKPPGVPGAANGAGYSGSIPKGQESRADP*
Ga0068860_10177076433300005843Switchgrass RhizosphereKPMEKAAFSAACERGKPPGVPGAANGAGYSGDGRKGQEITNLGRQ*
Ga0075026_10028231113300006057WatershedsMEKGGFLAACARGKPPGVPGAANGAGYSGSIPKGQENRTGH*
Ga0075370_1003725943300006353Populus EndosphereMEKAAFSAACERGKPPGVPGAANGAGYSDDDRKGQEIADRSP*
Ga0074064_1158870423300006603SoilMFESSFKPMEKAAFFAAYERGKPPGVPGAANGAGYSGSIPKGQENRADT*
Ga0075436_10018882423300006914Populus RhizosphereMEKAAFSAACERGKPPGVPGAANGAGYSDDGRKGQETTGLRR*
Ga0079219_1024025233300006954Agricultural SoilMEKAAFSAACERGKPPGVPGTANAAVYSGGSAKGQETGGRRNGR*
Ga0105250_1019242013300009092Switchgrass RhizosphereMEKSGFFAACARGKPPGVPGAANGAGYSGSIPKGQENRADTQSG
Ga0105237_1003446953300009545Corn RhizosphereMEKGGFFAARARGKPPGVPGAANGAGYSGSIPKGQENRADT*
Ga0126380_1035091933300010043Tropical Forest SoilNPSSKSMEKGGFFAACARGKPPGVPGAANGAGYSGSIPKGQENRPDL*
Ga0126384_1013064643300010046Tropical Forest SoilMEKGGFFAACARGKPPGVPGAANGAGYSGSIPKGQETAQT
Ga0126384_1126622813300010046Tropical Forest SoilACERGKPPGVPGAANGPGYSDDGRKGQETADLGR*
Ga0126384_1174199913300010046Tropical Forest SoilKGGFFAACARGKPPGVPGAANGAGYSGSIPKGQESRADP*
Ga0126377_1020755843300010362Tropical Forest SoilMEKDGFFAACARGKPPGVPGAANGAGYSGSIPKGQETAQ
Ga0134128_1202275033300010373Terrestrial SoilEKAAFSAACERGKPPGVPGAANGAGYSGDGRKGQEITNLGRQ*
Ga0126381_10089448223300010376Tropical Forest SoilMEKGGFFAACERGKPPGVPGAANAAGYSGEGRKGQEIRASWR*
Ga0134126_1011753553300010396Terrestrial SoilMEKGGFFAACARGKPPGVPGAANGAGYSGSLPKGQENRADT*
Ga0137384_1052584023300012357Vadose Zone SoilMFESSFKPMEKAAFFAAYERGKPPGVPGAANGAGYSGGGRKGQEIHKRCR*
Ga0157336_102467923300012477Arabidopsis RhizosphereSAACERGKPPGVPGAANGAGYSGDGRKGQEITNLGRQ*
Ga0157339_105901513300012505Arabidopsis RhizosphereWTVAMLNPSSKPMEKAAFSAACERGKPPGVPGAANGAGYSGDGRKGQEITNLGRQ*
Ga0157342_101061323300012507Arabidopsis RhizosphereMEKGGFFAACARGKPPGVPGAANGAGYSGGIPKGQENRADT*
Ga0157338_100205633300012515Arabidopsis RhizosphereMEKSDFFAACARGKPPGVPGAANGAGYSGSIPKGQENRADT*
Ga0157284_1000996623300012893SoilMEKAAFSAACERGKPPGVPGAANGAGYSDDGRKGQEITDLNR*
Ga0157284_1033692913300012893SoilKSMEKAAFSAACERGKPPGVPGAANGAGYSDDDRKGQEIADRSP*
Ga0157303_1005983733300012896SoilLNPSSKPMEKAAFSAACERGKPPGVPGAANGAGYSGDGRKGQEITNLGRQ*
Ga0164301_1009662343300012960SoilMEKGGFFAAYARGKPPGVPGAADGAGYSGSIAKGQENRTDP*
Ga0126369_1034368413300012971Tropical Forest SoilAACERGKPPGVPGAANAAGYSGGGRKEQGTTPLSKTV*
Ga0126369_1056736213300012971Tropical Forest SoilKSMEKGGFFAACARGKPPGVPGAANGAVYTGEEGKGQEIRASR*
Ga0126369_1182280813300012971Tropical Forest SoilMEKAAFSAACERGKPPGVPGAANGAGYSGSFPKGQENR
Ga0164308_10002945113300012985SoilMEKAAFSAACERGKPPGVPGAANGAGYSYDGRKGQEITDLGR*
Ga0164304_1032986013300012986SoilNPSSKPMEKAAFSAACERGKPPGVPGAANGAGYSGDGRKGQEITNLGRQ*
Ga0164307_1000616393300012987SoilSLNPSSKPMEKAAFSAACERGKPPGVPGAANGAGYSDDGRKGQEITDLGR*
Ga0164305_1128992513300012989SoilPMEKAAFSAACERGKPPGVPGAANGAGYSGDGRKGQEITNLGRQ*
Ga0157371_1039307113300013102Corn RhizosphereWTVAMLNPSSKPMEKAAFSAACERGKPPGVPGAANGAGYSDDGRKGQEITDLGR*
Ga0157369_1083492323300013105Corn RhizosphereMEKGGFFAACARGKPPGVPGAANGAGYSGDGRKGQEIT
Ga0157369_1107836513300013105Corn RhizosphereMEKAAFSAASERGKPPGVPGAANGAGYSGDGRKGQEITNLGRQ*
Ga0173483_1077653923300015077SoilMGKAAFSAACERGKPPGVPGAANGAGYSDDGRKGQEITD
Ga0132257_10156329333300015373Arabidopsis RhizosphereDPSSKSMEKAAFSAACERGKPPGVPGAANGAGYSDDDRKGQEIADQSL*
Ga0132255_10053640443300015374Arabidopsis RhizosphereSKPMEKAAFSAACERGKPPGVPGAANGAGYSDDGRKGQEITDLGR*
Ga0187785_1003979643300017947Tropical PeatlandMEKGGFFAACARGKPPGVPGAANGAGYSGSIPKGQENRADP
Ga0187779_1067948823300017959Tropical PeatlandMEKAAFSAARERGKPPGVPGAANAAGYSGGGCKGQETAALTAS
Ga0187777_1027176723300017974Tropical PeatlandMEKAAIFAACERGKPPGVPGAANGAVYSGEVCKGQEIKDEAAVMAIQRS
Ga0173482_1011970623300019361SoilMEKAAFSAACERGKPPGVPGAANGAGYSDDGRKGQEITDLGR
Ga0173482_1028907433300019361SoilLNPSSKPMEKAAFSAACERGKPPGVPGAANGAGYSGDGRKGQEITNLGRQ
Ga0193719_1013365033300021344SoilMEKGGFLAACARGKPPGVPGAANGAGYSGSIPKGQENRTGH
Ga0247785_103196213300022889SoilSSKPMEKAAFSAACERGKPPGVPGAANGAGYSGDGRKGQEITNLGRQ
Ga0247787_100511223300022893SoilMEKAAFSAACERGKPPGVPGAANGAGYSGDGRKGQEITNLGRQ
Ga0247788_105204033300022901SoilPSSKPMEKAAFSAACERGKPPGVPGAANGAGYSGDGRKGQEITNLGRQ
Ga0247791_100711933300023062SoilMEKAAFSAACERGKPPGVPGAANGAGYSGDGRKGQEIT
Ga0247791_102463713300023062SoilSWTVAMLNPSSKPMEKAAFSAACERGKPPGVPGAANGAGYSDDGRKGQEITDLGR
Ga0207710_1000120633300025900Switchgrass RhizosphereMEKGGFFAARARGKPPGVPGAANGAGYSGSIPKGQENRADT
Ga0207695_1019983943300025913Corn RhizosphereSAACERGKPPGVPGAANGAGYSDDGRKGQEITDLGR
Ga0207652_1002080173300025921Corn RhizosphereSKPMEKAAFSAACERGKPPGVPGAANGAGYSDDGRKGQEITDLGR
Ga0207652_1107874913300025921Corn RhizosphereMEKAAFSAACERGKPPGVPGAANGAGYSDDGRKGQEITDGPLMTS
Ga0207694_1017437343300025924Corn RhizosphereMEKGGFFAACARGKPPGVPGAANGAGYSGSIPKGQENRAD
Ga0207659_1181146123300025926Miscanthus RhizosphereKPMEKAAFSAACERGKPPGVPGAANGAGYSGDGRKGQEITNLGRQ
Ga0207704_1037558423300025938Miscanthus RhizosphereMEKSGFFAACARGKPPGVPGAANGAGYSGSIPKGQENRADT
Ga0210089_105423713300025957Natural And Restored WetlandsGKGGFSAACERGKPPGVPGAANGAGYSEDGRKGQEITDLGR
Ga0207678_1019876613300026067Corn RhizosphereLNPSSKPMEKAAFSAACERGKPPGVPGAANGAGYSDDGRKGQEITDLGR
Ga0207674_1081508333300026116Corn RhizosphereGGFFATCARGKPPGVPGAANGAGYSGSIPKGQENRADT
Ga0207698_1210784213300026142Corn RhizosphereSKPMEKGGFFAARARGKPPGVPGAANGAGYSGSIPKGQENRADT
Ga0207604_10071313300026715SoilVAMLNPSSKPMEKAAFSAACERGKPPGVPGAANGAGYSGDGRKGQEITNLGRQ
Ga0207523_10055913300026731SoilSLNPSSKPMEKAAFSAACERGKPPGVPGAANGAGYSGDGRKGQEITNLGRQ
Ga0207590_10147023300026765SoilMEKAAFSAACERGKPPGVPGAANGAGYSGDGRKGQEITN
Ga0208761_102133213300026995SoilMEKGGFFAACARGKPPGVPGAANGAGYSGSIPKGQENRADTQSGGVFGRALGPLAGFFGLGF
Ga0208525_101168133300027288SoilLSKPMEKGGFFAACARGKPPGVPGAANGAGYSGSIPKGQENRADT
Ga0209967_100183643300027364Arabidopsis Thaliana RhizosphereMEKAAFSAACERGKPPGVPGAANGAGYSDDGRKGQEITGLGR
Ga0208637_100088743300027401SoilISWTVAMLNPSSKPMEKAAFSAACERGKPPGVPGAANGAGYSGDGRKGQEITNLGRQ
Ga0207457_10188123300027474SoilSKPMEKAAFSAACERGKPPGVPGAANGAGYSGDGRKGQEITNLGRQ
Ga0209999_104278923300027543Arabidopsis Thaliana RhizosphereMEKAAFSAACERGKPPGVPGAANGAGYSDDGRKAQEITGLGR
Ga0209177_1035074223300027775Agricultural SoilSWTVAISKSSSKPMEKAAFSAACERGKPPGVPGAANGAGYSGSIPKGQENRADT
Ga0209074_1011523613300027787Agricultural SoilMEKGGFFAACARGKPPGVPGAANGAGYSGSIPKGQENRADTQSGGVFGRA
Ga0307303_1018249713300028713SoilMEKAAFFAACVRGKPPGVPGAADGAGYSGGIPKGQENRA
Ga0307316_1017932623300028755SoilMEKGGFLAACARGKPPGVPGAANGAGYSGSIPKGQENRTG
Ga0307292_1021413213300028811SoilMEKGGFLAACARGKPPGVPGAANGAGYSGSIPKGQENR
Ga0307310_1031891013300028824SoilMEKAAFFAACVRGKPPGVPGAADGAGYSGGIPKGQENRAVRSQRVSSG
Ga0310915_10000056323300031573SoilMEKGGFFAACARGKPPGVPGTANGAGYSGSSPKGQENRADP
Ga0265313_1000864313300031595RhizosphereMEKAAFSAASNRGKPPGVPGAADGRVYSGGVLKGQ
Ga0307469_1083989113300031720Hardwood Forest SoilKPMEKAAFSAACERGKPPGVPGAANGPGYSDDGRKGQETTDLGR
Ga0318494_1011920513300031751SoilGGFFAACARGKPPGVPGTANGAGYSGSSPKGQENRADP
Ga0307473_1121513423300031820Hardwood Forest SoilSKPMEKAAFSAACERGKPPGVPGAANGPGYSDDGRKGQETRDLGR
Ga0318512_1018440713300031846SoilFFAACARGKPPGVPGTANGAGYSGSSPKGQENRADP
Ga0310904_1042613613300031854SoilSSKPMEKAAFSAACERGKPPGVPGAANGAGYSDDGRKGQEITDLGR
Ga0310893_1000198973300031892SoilMEKAAFSAACERGKPPGVPGAANGAGYSGDGRKGQEI
Ga0310891_1001855433300031913SoilMEKSDFFAACARGKPPGVPGAANGAGYSGSIPKGQENRADT
Ga0310899_1007226733300032017SoilSWTVAILNPSSKPMEKAAFSAACERGKPPGVPGAANGAGYSDDGRKGQEITDLGR
Ga0307470_1101736623300032174Hardwood Forest SoilMEKAAFSAACERGKPPGVPGAANGAGYSDDGSKGQEITDLGR
Ga0307471_10074069313300032180Hardwood Forest SoilMEKAALSAAHERGKPPGVLGAANAAGYTGGGGKGQETAIIAQKV
Ga0307472_10055913923300032205Hardwood Forest SoilMEKGGFFAACARGKPPGVPGAANGAGYSGSIPKGQENRADTQSGGLF
Ga0307472_10072154923300032205Hardwood Forest SoilMLKSSSKPMEKAALSAAHERGKPPGVPGAANAAGYSGGGRKGQETAIIAQKV
Ga0307472_10073112633300032205Hardwood Forest SoilPMEKGGFFAACARGKPPGVPGAANGAGYSGSIPKGQENRADT
Ga0310896_1031823313300032211SoilKPMEKAAFSAACERGKPPGVPGAANGAGYSDDGRKGQEITDLGR
Ga0326726_1021362513300033433Peat SoilAIVNPSSNPMEKAAFSAACERGKPPGVPGAATGAGYSGGRHKGQENHISGRKRA
Ga0316628_10265928723300033513SoilMEKAAFSAACERGKPPGVPGAANAPGYSGGGRKGQEIRTDP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.