NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F063303

Metagenome / Metatranscriptome Family F063303

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F063303
Family Type Metagenome / Metatranscriptome
Number of Sequences 129
Average Sequence Length 72 residues
Representative Sequence QEKINGGDSMFKNKDERFKKSMELEYAAHVGPGSYAQADRTVELDFKKTSGKVSSAFASTSLRGDSFLPGA
Number of Associated Samples 71
Number of Associated Scaffolds 129

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 0.81 %
% of genes near scaffold ends (potentially truncated) 93.80 %
% of genes from short scaffolds (< 2000 bps) 94.57 %
Associated GOLD sequencing projects 69
AlphaFold2 3D model prediction Yes
3D model pTM-score0.30

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (95.349 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater
(70.543 % of family members)
Environment Ontology (ENVO) Unclassified
(82.171 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(77.519 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 23.23%    β-sheet: 0.00%    Coil/Unstructured: 76.77%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.30
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 129 Family Scaffolds
PF00111Fer2 0.78
PF03016Exostosin 0.78



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.35 %
UnclassifiedrootN/A4.65 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004054|Ga0063232_10039290All Organisms → cellular organisms → Eukaryota → Haptista1212Open in IMG/M
3300004762|Ga0007749_1015303All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii686Open in IMG/M
3300005517|Ga0070374_10267498All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii871Open in IMG/M
3300009022|Ga0103706_10076009All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Haptolina → Haptolina ericina739Open in IMG/M
3300009187|Ga0114972_10279094All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii998Open in IMG/M
3300009543|Ga0115099_10907401All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii517Open in IMG/M
3300009592|Ga0115101_1284981All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii928Open in IMG/M
3300009592|Ga0115101_1430925All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii527Open in IMG/M
3300009608|Ga0115100_10148753All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii676Open in IMG/M
3300009608|Ga0115100_10931149All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii500Open in IMG/M
3300009608|Ga0115100_11244406All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii569Open in IMG/M
3300009790|Ga0115012_10496840All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii952Open in IMG/M
3300012706|Ga0157627_1091418All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii670Open in IMG/M
3300012740|Ga0157533_151039All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii647Open in IMG/M
3300012953|Ga0163179_12257944All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii503Open in IMG/M
3300013005|Ga0164292_10643109All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii681Open in IMG/M
3300016693|Ga0180038_1013567All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii733Open in IMG/M
3300018781|Ga0193380_1062564All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii574Open in IMG/M
3300018787|Ga0193124_1073216All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Haptolina → Haptolina ericina517Open in IMG/M
3300019027|Ga0192909_10303356All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Haptolina → Haptolina ericina504Open in IMG/M
3300020172|Ga0211729_10454826All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii753Open in IMG/M
3300021048|Ga0210245_108322All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii1163Open in IMG/M
3300024863|Ga0255246_1098766All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii682Open in IMG/M
3300027836|Ga0209230_10464904All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii720Open in IMG/M
3300027859|Ga0209503_10532916All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii584Open in IMG/M
3300027892|Ga0209550_10040828All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii3841Open in IMG/M
3300028134|Ga0256411_1286314All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii500Open in IMG/M
3300031127|Ga0073960_10044878All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii546Open in IMG/M
3300031202|Ga0228588_110573All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii671Open in IMG/M
3300031361|Ga0228538_105840All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii676Open in IMG/M
3300031522|Ga0307388_11224819All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii511Open in IMG/M
3300031579|Ga0308134_1129694All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii580Open in IMG/M
3300031737|Ga0307387_11129571All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii502Open in IMG/M
3300032463|Ga0314684_10280137All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii961Open in IMG/M
3300032463|Ga0314684_10285139All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii953Open in IMG/M
3300032463|Ga0314684_10477741All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii732Open in IMG/M
3300032463|Ga0314684_10513574All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Haptolina → Haptolina brevifila703Open in IMG/M
3300032463|Ga0314684_10570267All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii661Open in IMG/M
3300032463|Ga0314684_10609234All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii635Open in IMG/M
3300032463|Ga0314684_10861227All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii511Open in IMG/M
3300032470|Ga0314670_10319914All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii808Open in IMG/M
3300032470|Ga0314670_10556365All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii596Open in IMG/M
3300032470|Ga0314670_10569275All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii588Open in IMG/M
3300032470|Ga0314670_10634265All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii550Open in IMG/M
3300032481|Ga0314668_10343390All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii772Open in IMG/M
3300032481|Ga0314668_10532929All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii599Open in IMG/M
3300032491|Ga0314675_10285774All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii822Open in IMG/M
3300032491|Ga0314675_10424130All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Haptolina → Haptolina ericina663Open in IMG/M
3300032491|Ga0314675_10627282All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii525Open in IMG/M
3300032491|Ga0314675_10650629All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii513Open in IMG/M
3300032492|Ga0314679_10316404All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii713Open in IMG/M
3300032492|Ga0314679_10413889All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii611Open in IMG/M
3300032492|Ga0314679_10436912All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii592Open in IMG/M
3300032517|Ga0314688_10124216All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii1221Open in IMG/M
3300032517|Ga0314688_10231907All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii960Open in IMG/M
3300032519|Ga0314676_10336738All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii891Open in IMG/M
3300032519|Ga0314676_10606040All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii646Open in IMG/M
3300032519|Ga0314676_10611419All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii642Open in IMG/M
3300032519|Ga0314676_10703749All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii589Open in IMG/M
3300032521|Ga0314680_10530929All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii742Open in IMG/M
3300032521|Ga0314680_10731766All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii624Open in IMG/M
3300032522|Ga0314677_10238466All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii943Open in IMG/M
3300032522|Ga0314677_10469786All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii671Open in IMG/M
3300032522|Ga0314677_10563113All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii603Open in IMG/M
3300032615|Ga0314674_10328309All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii797Open in IMG/M
3300032615|Ga0314674_10549818All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii593Open in IMG/M
3300032616|Ga0314671_10349504All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii807Open in IMG/M
3300032617|Ga0314683_10526393All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii734Open in IMG/M
3300032617|Ga0314683_10912300All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii524Open in IMG/M
3300032650|Ga0314673_10319242All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii789Open in IMG/M
3300032650|Ga0314673_10412306All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii695Open in IMG/M
3300032650|Ga0314673_10509497All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii621Open in IMG/M
3300032651|Ga0314685_10778082All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii509Open in IMG/M
3300032666|Ga0314678_10206559All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii860Open in IMG/M
3300032666|Ga0314678_10241575All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii802Open in IMG/M
3300032666|Ga0314678_10383339All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii635Open in IMG/M
3300032666|Ga0314678_10582910All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii501Open in IMG/M
3300032707|Ga0314687_10172441All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii1104Open in IMG/M
3300032707|Ga0314687_10321044All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Haptolina → Haptolina ericina846Open in IMG/M
3300032707|Ga0314687_10662130All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Haptolina → Haptolina ericina580Open in IMG/M
3300032707|Ga0314687_10788233All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Haptolina → Haptolina ericina526Open in IMG/M
3300032708|Ga0314669_10303396All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii858Open in IMG/M
3300032708|Ga0314669_10550690All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii635Open in IMG/M
3300032708|Ga0314669_10795692All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii516Open in IMG/M
3300032711|Ga0314681_10288504All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii903Open in IMG/M
3300032711|Ga0314681_10373416All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Haptolina → Haptolina ericina797Open in IMG/M
3300032714|Ga0314686_10265654All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii852Open in IMG/M
3300032714|Ga0314686_10377903All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii705Open in IMG/M
3300032723|Ga0314703_10403257All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii559Open in IMG/M
3300032724|Ga0314695_1130908All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii932Open in IMG/M
3300032724|Ga0314695_1362723All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii551Open in IMG/M
3300032726|Ga0314698_10215362All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii871Open in IMG/M
3300032726|Ga0314698_10301005All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii731Open in IMG/M
3300032726|Ga0314698_10414311All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii608Open in IMG/M
3300032726|Ga0314698_10431452All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii594Open in IMG/M
3300032726|Ga0314698_10462963All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii569Open in IMG/M
3300032727|Ga0314693_10746357All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii525Open in IMG/M
3300032728|Ga0314696_10379935All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii731Open in IMG/M
3300032728|Ga0314696_10563193All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii583Open in IMG/M
3300032729|Ga0314697_10339202All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii670Open in IMG/M
3300032732|Ga0314711_10360534All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii753Open in IMG/M
3300032732|Ga0314711_10480043All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii639Open in IMG/M
3300032732|Ga0314711_10487854All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii633Open in IMG/M
3300032733|Ga0314714_10286792All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii925Open in IMG/M
3300032733|Ga0314714_10379537All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii796Open in IMG/M
3300032734|Ga0314706_10193218All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii964Open in IMG/M
3300032734|Ga0314706_10345319All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii721Open in IMG/M
3300032734|Ga0314706_10387691All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii676Open in IMG/M
3300032734|Ga0314706_10593486All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii529Open in IMG/M
3300032743|Ga0314707_10281557All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Haptolina → Haptolina ericina862Open in IMG/M
3300032744|Ga0314705_10513286All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii642Open in IMG/M
3300032746|Ga0314701_10219088All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii855Open in IMG/M
3300032748|Ga0314713_10515235All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii504Open in IMG/M
3300032749|Ga0314691_10149114All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii958Open in IMG/M
3300032751|Ga0314694_10163981All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii928Open in IMG/M
3300032751|Ga0314694_10291857All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii697Open in IMG/M
3300032752|Ga0314700_10261147All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii906Open in IMG/M
3300032752|Ga0314700_10357060All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii775Open in IMG/M
3300032755|Ga0314709_10505961All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii739Open in IMG/M
3300032755|Ga0314709_10563233All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Haptolina → Haptolina ericina693Open in IMG/M
3300032755|Ga0314709_10593799All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii670Open in IMG/M
3300033995|Ga0335003_0307240All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii709Open in IMG/M
3300033996|Ga0334979_0718638All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales520Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater70.54%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine7.75%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater5.43%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine4.65%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake3.10%
Defined MediumEngineered → Modeled → Simulated Communities (Microbial Mixture) → Unclassified → Unclassified → Defined Medium3.10%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment0.78%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.78%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.78%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.78%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.78%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater0.78%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water0.78%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004054Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (v2)EnvironmentalOpen in IMG/M
3300004762Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005517Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4)EnvironmentalOpen in IMG/M
3300009022Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S1EnvironmentalOpen in IMG/M
3300009187Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaGEnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009592Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009608Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009790Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 MetagenomeEnvironmentalOpen in IMG/M
3300012706Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES159 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012731Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES145 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012740Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES018 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300013005Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaGEnvironmentalOpen in IMG/M
3300016693Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES036 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300018781Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_123 - TARA_N000001992 (ERX1789655-ERR1719256)EnvironmentalOpen in IMG/M
3300018787Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001288 (ERX1789595-ERR1719164)EnvironmentalOpen in IMG/M
3300019027Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000678 (ERX1782477-ERR1711924)EnvironmentalOpen in IMG/M
3300019050Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782371-ERR1711865)EnvironmentalOpen in IMG/M
3300020172Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1EnvironmentalOpen in IMG/M
3300021048Chrysochromulina tobin associated microbial communities from unialgal haptophyte culture, Seattle, Washington, United States - P3_4mMEngineeredOpen in IMG/M
3300024863Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_0h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027836Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027859Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027892Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300028134Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_12 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031127Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E5_X_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031189Metatranscriptome of Chrysochromulina tobin associated microbial communities from unialgal haptophyte culture, Seattle, Washington, United States ? P3_L6_16mM_1 (Metagenome Metatranscriptome)EngineeredOpen in IMG/M
3300031202Metatranscriptome of Chrysochromulina tobin associated microbial communities from unialgal haptophyte culture, Seattle, Washington, United States ? P3_D6_8mM_1 (Metagenome Metatranscriptome)EngineeredOpen in IMG/M
3300031361Metatranscriptome of Chrysochromulina tobin associated microbial communities from unialgal haptophyte culture, Seattle, Washington, United States ? P5_L6_0mM_2 (Metagenome Metatranscriptome)EngineeredOpen in IMG/M
3300031522Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031579Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1120_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031737Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032463Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032470Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032481Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032491Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032492Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032517Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032519Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032521Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032522Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032615Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032616Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032617Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032650Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032651Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032666Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032707Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032708Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032711Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032714Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032723Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032724Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_28May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032726Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032727Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032728Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032729Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032732Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032733Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb12_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032734Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb9_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032743Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032744Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb9_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032746Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_28May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032748Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb12_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032749Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032751Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032752Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032755Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033995Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056EnvironmentalOpen in IMG/M
3300033996Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0063232_1003929033300004054Freshwater LakeGDSMFKNKDDRFKKSLELEYAAHVAPGSYSSDGHTIEKKVRQSRGKVSSAFASTSLRGDMFMGHRC*
Ga0007749_101530313300004762Freshwater LakeYDPNMPQEKIAGGESMFKNKDERFKKSMELEYAAHVGPGSYSQAEGTVELAFKKQSGKVSSAFASTSLRGDSFIPS*
Ga0070374_1026749823300005517Freshwater LakePQEKIAGGESMFKNKDERFKKSMELEYAAHVGPGSYSQAEGTVELAFKKQSGKVSSAFASTSLRGDSFIPS*
Ga0103706_1007600923300009022Ocean WaterSDKIAGGDSMFKNKDMRFKKSAELEQQAHVGPGSYTQTDYTVEKNYNNNVGKVSSAFASTVLRDSFV*
Ga0114972_1027909413300009187Freshwater LakeMPQEKIAGGESMFKNKDERFKKSMELEYAAHVGPGSYSQAEGTVELAFKKQSGKVSSAFASTSLRGDSFIPS*
Ga0115099_1090740113300009543MarineTPGAGEYDPAMAQEKIGGGDSMFKNKDERFKKSMELEYAAHVGPGSYSQADRTVELDFKKDSGKVSSAFASTSLRSDSFLPN*
Ga0115101_128498123300009592MarineGDSMFKNKDERFKKSMELEYAAHVGPGSYAQAQQTIEQDFKKSSGKVSSAFASTSLRADSFL*
Ga0115101_143092513300009592MarinePGAGEYDPAMAQEKIGGGDSMFKNRDERFKKSMELEYAAHVGPGSYSQADRTVELDFKKDSGKVSSAFASTSLRSDSFLPN*
Ga0115100_1014875313300009608MarineGGDSMFKNKDERFKKSMELEYAAHVGPGSYAQADKTVELDFKKQSGKVSSAFASTSLRADSFIGGA*
Ga0115100_1093114913300009608MarineEYDPAMAQEKIGGGDSMFKNKDERFKKSMELEYAAHVGPGSYSQADRTVELDFKKDSGKVSSAFASTSLRSDSFLPN*
Ga0115100_1124440613300009608MarineGGDSMFKNKDERFKKSMELEYAAHVGPGSYAQADRTVELDFKKSSGKVSSAFASTSLRADSFLPG*
Ga0115012_1049684023300009790MarineGAGEYDPATAQEKITGGESMFKNKDERFKKSMELEYSAHVGPGSYSQGDKTVELDFKKGSGKVSSAFASTSLRADSFLAA*
Ga0157627_109141813300012706FreshwaterEKIAGGESMFKNKDERFKKSMELEYAAHVGPGSYSQAEGTVELAFKKQSGKVSSAFASTSLRGDSFIPS*
Ga0157616_109879013300012731FreshwaterNKDERFKKSMELEYAAHVGPGSYSQAEGTVELAFKKQSGKVSSAFASTSLRGDSFIPS*
Ga0157533_15103913300012740FreshwaterESMFKNKDERFKKSMELEYAAHVGPGSYSQAEGTVELAFKKQSGKVSSAFASTSLRGDSFIPS*
Ga0163179_1225794413300012953SeawaterGGESMFKNKDERFKKSMELEYSAHVGPGSYSQGDRTVELDFKKAGGKVSSAFASTSLRSDSFQPGA*
Ga0164292_1064310913300013005FreshwaterIAGGESMFKNKDERFKKSMELEYAAHVGPGSYSQAEGTVELAFKKQSGKVSSAFASTSLRGDSFIPS*
Ga0180038_101356713300016693FreshwaterTPGAGEYDPNMPQEKIAGGESMFKNKDERFKKSMELEYAAHVGPGSYSQAEGTVELAFKKQSGKVSSAFASTSLRGDSFIPS
Ga0193380_106256413300018781MarineGAGEYDPAMAQEKIGGGDSMFKNKDERFKKSMELEYSAHVGPGSYSQSDKTVELDFKKVSGKVSSAFASTTLRADSFLPGA
Ga0193124_107321613300018787MarineGAGEYDPKASERIEGGDSMFKNKDMRFKKSAELEQQAHVGPGSYTQTDYTVEKNYNNNVGKISSAFASTVLRDSFV
Ga0192909_1030335613300019027MarineKASGDKIAGGDSMFKNKDMRFKKSAELEQQAHVGPGSYQQSEFTVEKTYNANVGKISSAFASTVLRDSFV
Ga0192966_1020002813300019050MarineMFKNKDERFKKSMELEYAAHVGPGSYAQADRTVELDFKKSSGKVSSAFASTSLRADSFLP
Ga0211729_1045482613300020172FreshwaterGGESMFKNKDERFKKSMELEYAAHVGPGSYSQAEGTVELAFKKQSGKVSSAFASTSLRGDSFIPS
Ga0210245_10832213300021048Defined MediumEYDPNMPQEKIAGGESMFKNKDERFKKSMELEYAAHVGPGSYSQAEGTVELAFKKQSGKVSSAFASTSLRGDSFIPS
Ga0255246_109876613300024863FreshwaterYDPNMPQEKIAGGESMFKNKDERFKKSMELEYAAHVGPGSYSQAEGTVELAFKKQSGKVSSAFASTSLRGDSFIPS
Ga0209230_1046490413300027836Freshwater And SedimentEKIAGGESMFKNKDERFKKSMELEYAAHVGPGSYSQAEGTVELAFKKQSGKVSSAFASTSLRGDSFIPS
Ga0209503_1053291613300027859MarineGEYDPATAQEKIGGGESMFKNKDERFKKSMELEYSAHVGPGSYSQGDRTVELDFKKAGGKVSSAFASTSLRSDSFQPGA
Ga0209550_1004082813300027892Freshwater LakeKIAGGESMFKNKDERFKKSMELEYAAHVGPGSYSQAEGTVELAFKKQSGKVSSAFASTSLRGDSFIPS
Ga0256411_128631413300028134SeawaterGAGEYDPQMAQEKIGGGDSMFKNKDERFKKSMELEYAAHVGPGSYSQSDKTVELDFKKSSGKVSSAFASTSLRADSFISS
Ga0073960_1004487813300031127MarineTMAQEKIGGGDSMFKNKDERFKKSMELEYSAHVGPGSYAQADKTVELDFKKVSGKVSSAFASTTLRADSFLPG
Ga0228576_11035013300031189Defined MediumMFKNKDERFKKSMELEYAAHVGPGSYSQAEGTVELAFKKQSGKVSSAFASTSLRGDSFIP
Ga0228588_11057313300031202Defined MediumPQEKIAGGESMFKNKDERFKKSMELEYAAHVGPGSYSQAEGTVELAFKKQSGKVSSAFASTSLRGDSFIPS
Ga0228538_10584013300031361Defined MediumPNMPQEKIAGGESMFKNKDERFKKSMELEYAAHVGPGSYSQAEGTVELAFKKQSGKVSSAFASTSLRGDSFIPS
Ga0307388_1122481913300031522MarineYDPAMAQEKIGGGDSMFKNKDERFKKSMELEYAAHVGPGSYSQADRTVELDFKKDSGKVSSAFASTSLRSDSFLPN
Ga0308134_112969413300031579MarineAGEYDPASAQEKIGGGDSMFKNKDERFKKSMELEYAAHVGPGSYAQGDRTVELDFKKSSGKVSSAFASTSLRADSFTPGA
Ga0307387_1112957113300031737MarineYDPAMAQEKIGGGDSMFKNKDERFKKSMELEYAAHVGPGSYSQADRTVELDFKKDSGKVSSAFASTSLRADSFLPG
Ga0314684_1028013713300032463SeawaterPGAGEYDPALPQEKISGADSMFKNKDERFKKSMELEYAAHVGPGSYSQADATMELDFKKQSGKVSSAFASTSLRADSFMAGP
Ga0314684_1028513913300032463SeawaterPGAGEYDPALPQEKISGADSMFKNKDERFKKSMELEYAAHVGPGSYSQADSTMELDFKKQSGKVSSAFASTSLRADSFMAGP
Ga0314684_1047774113300032463SeawaterYDPALAQEKIAGGDSMFKNKDERFKKSMELEYAAHVGPGSYSQSDKTVELDFKKTSGKVSSAFASTSLRADSFVGA
Ga0314684_1051357413300032463SeawaterGEYDPSMAQEKINGGDSMFKNKDERFKKSMELEYAAHVGPGSYAQVDQTVELEFKKTSGKVSSAFASTSLRADSFLPG
Ga0314684_1057026713300032463SeawaterGGDSMFKNKDERFKKSMELEYAAHVGPGSYAQADRTVELDFKKTSGKVSSAFASTSLRGDSFLPGA
Ga0314684_1060923423300032463SeawaterGDSMFKNKDERFKKSMELEYAAHVGPGSYAQADRTVELDFKKTSGKVSSAFASTSLRGDSFLPGA
Ga0314684_1086122713300032463SeawaterAMAQEKIGGGDSMFKNKDERFKKSMELEYAAHVGPGSYAQADRTVELDFKKSSGKVSSAFASTSLRADSFLPQA
Ga0314670_1031991413300032470SeawaterAMAQEKIGGGDSMFKNKDERFKKSMELEYAAHVGPGSYAQGDRTVELDFKKSSGKVSSAFASTSLRGDSFTPGA
Ga0314670_1055636513300032470SeawaterPKAQTPGAGEYDPKMAQEGISGGESMFKNKDERFKKSMELEYAAHVGPGSYAQADRTVEIEFKKSSGKVSSAFASTSLRGDSFLPG
Ga0314670_1056927513300032470SeawaterGEYDPAMAQEKISGGDSMFKNKDERFKKSMELEYAAHVGPGSYSQADRTVELDFKKGSGKVSSAFASTSLRADSFLPGP
Ga0314670_1063426513300032470SeawaterASAQEKIGGGDSMFKNKDERFKTSMELEYSAHVGPGSYAQADRTVELDFKKGSGKVSSAFASTSLRADSFLPG
Ga0314668_1034339013300032481SeawaterGEYDPAMAQEKIGGGDSMFKNKDERFKKSMELEYAAHVGPGSYAQGDRTVELDFKKSSGKVSSAFASTSLRGDSFTPGA
Ga0314668_1042590813300032481SeawaterGGDSMFKTKDERFKKSAELESYAHVGPGSYQQTNNTVEQSYNESTGKVSSAFASTVLRDQWLIQ
Ga0314668_1053292913300032481SeawaterKMAQEGISGGESMFKNKDERFKKSMELEYAAHVGPGSYAQADRTVELEFKKTSGKVSSAFASTSLRGDSFLPGN
Ga0314675_1027541623300032491SeawaterSMFKNKDERFKKSMELEYAAHVGPGSYAQADRTVELEFKKTSGKVSSAFASTSLRGDSFLPGN
Ga0314675_1028577423300032491SeawaterAGEYDPAMAQEKINGGDSMFKNKDERFKKSMELEYAAHVGPGSYAQADRTVELDFKKSSGKVSSAFASTSLRADSFLPGA
Ga0314675_1042413013300032491SeawaterSMFKTKDERFKKSAELESYAHVGPGSYQQTNNTVEQSYNESTGKVSSAFASTVLRDQWLI
Ga0314675_1062728213300032491SeawaterSMFKNKDERFKKSMELEYAAHVGPGSYAQADRTVELDFKKTSGKVSSAFASTSLRGDSFLPGA
Ga0314675_1065062913300032491SeawaterYDPQMAQEKIGGGDSMFKNKDERFKKSMELEYAAHVGPGSYSQADQTVELDFKKSSGKVSSAFASTSLRADSFISS
Ga0314679_1031640413300032492SeawaterQEKINGGDSMFKNKDERFKKSMELEYAAHVGPGSYAQGDRTVELDFKKSSGKVSSAFASTSLRGDSFTPGA
Ga0314679_1041388923300032492SeawaterAQTPGAGEYDPKMVQEGINGGDSMFKNKDERFKKSMELEYAAHVGPGSYAQADRTVELDFKKTSGKVSSAFASTSLRGDSFLPGA
Ga0314679_1043691213300032492SeawaterINGGDSMFKNKDERFKKSMELEYAAHVGPGSYAQADRTVELDFKKTSGKVSSAFASTSLRGDSFLPGA
Ga0314688_1012421613300032517SeawaterDSMFKNKDERFKKSMELEYAAHVGPGSYSQADSTMELDFKKQSGKVSSAFASTSLRADSFMAGP
Ga0314688_1023190713300032517SeawaterKIGGGESMFKNKDERFKKSMELEYAAHVGPGSYSQADATMELDFKKQSGKVSSAFASTSLRADSFMAGP
Ga0314676_1033673813300032519SeawaterSMFKNKDERFKKSMELEYAAHVGPGSYSQADSTLELDFKKQSGKVSSAFASTSLRADSFMAGP
Ga0314676_1060604013300032519SeawaterQEGINGGDSMFKNKDERFKKSMELEYAAHVGPGSYAQADRTVELDFKKTSGKVSSAFASTSLRGDSFLPGA
Ga0314676_1061141913300032519SeawaterAMAQEKINGGDSMFKNKDERFKKSMELEYAAHVGPGSYAQGDRTGELDFKKTSGKVSSAFASTSLRGDSFLPGA
Ga0314676_1070374913300032519SeawaterPGAGEYDPAMAQEKISGGDSMFKNKDERFKKSMELEYAAHVGPGSYSQADRTVELDFKKGSGKVSSAFASTSLRADSFLPGP
Ga0314680_1053092913300032521SeawaterSMFKNKDERFKKSMELEYAAHVGPGSYAQGDRTVELDFKKSSGKVSSAFASTSLRGDSFTPGA
Ga0314680_1073176613300032521SeawaterEYDPKMAQEGINGGDSMFKNKDERFKKSMELEYAAHVGPGSYAQADRTVELDFKKTSGKVSSAFASTSLRGDSFLPGA
Ga0314677_1023846613300032522SeawaterEKISGADSMFKNKDERFKKSMELEYAAHVGPGSYSQADATMELDFKKQSGKVSSAFASTSLRADSFMAGP
Ga0314677_1046978623300032522SeawaterDSMFKNKDERFKKSMELEYAAHVGPGSYAQADRTVELDFKKSSGKVSSAFASTSLRADSFLPGA
Ga0314677_1056311313300032522SeawaterISGGDSMFKNKDERFKKSMELEYAAHVGPGSYSQADRTVELDFKKGSGKVSSAFASTSLRADSFLPGP
Ga0314674_1032830913300032615SeawaterTPGAGEYDPAMAQEKIGGGDSMFKNKDERFKKSMELEYAAHVGPGSYAQGDRTVELDFKKSSGKVSSAFASTSLRGDSFTPGA
Ga0314674_1054981823300032615SeawaterDPKMAQEGINGGDSMFKNKDERFKKSMELEYAAHVGPGSYAQADRTVELDFKKTSGKVSSAFASTSLRGDSFLPGA
Ga0314671_1034950413300032616SeawaterQQTPGAGEYDPAMAQEKIGGGDSMFKNKDERFKKSMELEYAAHVGPGSYAQGDRTVELDFKKSSGKVSSAFASTSLRGDSFTPGA
Ga0314683_1052639313300032617SeawaterMFKNKDERFKKSMELEYAAHVGPGSYAQADRTVELDFKKSSGKVSSAFASTSLRADSFLPGN
Ga0314683_1091230013300032617SeawaterAMAQEKISGGESMFKNKDERFKKSMELEYAAHVGPGSYSQADRTVELDFKKGSGKVSSAFASTSLRADSFLPGP
Ga0314673_1031924213300032650SeawaterGGDSMFKNKDERFKKSMELEYAAHVGPGSYAQADRTVELDFKKSSGKVSSAFASTSLRADSFLPGN
Ga0314673_1041230613300032650SeawaterAQEKINGVDSTFKNKVVRFTYIMLLEYAAHVGPGSYSQSDKTVELDFKKTSGKVSSAFASTSLRADSFVGA
Ga0314673_1050949713300032650SeawaterDSMFKNKDERFKKSMELEYAAHVGPGSYAQADRTVEIEFKKSSGKVSSAFASTSLRGDSFLPG
Ga0314685_1077808213300032651SeawaterAMAQEKINGGDSMFKNKDERFKKSMELEYAAHVGPGSYAQGDRTVELDFKKSSGKVSSAFASTSLRADSFLPGA
Ga0314678_1020655913300032666SeawaterEYDPKMAQEGINGGDSMFKNKDERFKKSMELEYAAHVGPGSYAQADKTVELDFKKSSGKVSSAFASTSLRADSFLPGA
Ga0314678_1024157513300032666SeawaterKINGGDSMFKNKDERFKKSMELEYAAHVGPGSYAQADRTVELDFKKSSGKVSSAFASTSLRADSFLPGA
Ga0314678_1038333913300032666SeawaterGINGGDSMFKNKDERFKKSMELEYAAHVGPGSYAQADRTVELDFKKTSGKVSSAFASTSLRGDSFLPGA
Ga0314678_1058291013300032666SeawaterINGGDSMFKNKDERFKKSMELEYAAHVGPGSYAQADRTVELDFKKTSGKVSSAFASTSLRADSFLPG
Ga0314687_1017244113300032707SeawaterEYDPALPQEKISGADSMFKNKDERFKKSMELEYAAHVGPGSYSQADSTMELDFKKQSGKVSSAFASTSLRADSFMAGP
Ga0314687_1032104413300032707SeawaterSMFKNKDMRFKKSAELEQQAHVGPGSYQQTDFTVEKSYNTNVGKVSSAFASTVLRDSFV
Ga0314687_1066213013300032707SeawaterGGDSMFKSKDMRFKKSAEHEQQAHVGPGSYTQTDYTVEKSYNANVGKTSSAFASTVLRDSFV
Ga0314687_1078823313300032707SeawaterGAGEYDPKAAGDKIAGGESMFKNKDMRFKKSAELEQQAHVGPGSYTQTDYTVEKAYNQNVGKISSAFASTTLRDSFAT
Ga0314669_1030339623300032708SeawaterGEYDPKMAQEGISGGESMFKNKDERFKKSMELEYAAHVGPGSYAQADRTVELEFKKTSGKVSSAFASTSLRGDSFLPGN
Ga0314669_1055069013300032708SeawaterAQEGISGGESMFKNKDERFKKSMELEYAAHVGPGSYAQADRTVEIEFKKSSGKVSSAFASTSLRGDSFLPG
Ga0314669_1079569213300032708SeawaterGEYDPAMAQEKIGGGESMFKNKDERFKKSMELEYAAHVGPGSYSQADRTVELDFKSDSGKVSSAFASTSLRSDSFLPN
Ga0314681_1028850413300032711SeawaterGGDSMFKNKDERFKKSMELEYAAHVGPGSYSQADSTMELDFKKQSGKVSSAFASTSLRADSFMAGP
Ga0314681_1037341623300032711SeawaterGKIAGGDSMFKNKDMRFKKSAELEQQAHVGPGSYQQTDFTVEKSYNTNVGKVSSAFASTVLRDSFV
Ga0314686_1026565413300032714SeawaterAQEGINGGDSMFKNKYERFKKSMELEYAAHVGPGSYAQADKTVELDFKKSSGKVSSAFASTSLRADSFLPGA
Ga0314686_1037790323300032714SeawaterAQEKINGGDSMFKNKDERFKKSMELEYAAHVGPGSYAQVDKTVELEFKKTSGKVSSAFASTSLRADSFIGGA
Ga0314703_1040325713300032723SeawaterQEKINGGDSMFKNKDERFKKSMELEYAAHVGPGSYAQADRTVELDFKKTSGKVSSAFASTSLRGDSFLPGA
Ga0314695_113090813300032724SeawaterADSMFKNKDERFKKSMELEYAAHVGPGSYSQADATMELDFKKQSGKVSSAFASTSLRADSFMAGP
Ga0314695_136272313300032724SeawaterAQEKINGGDSMFKNKDERFKKSMELEYAAHVGPGSYAQADRTVELDFKKTSGKVSSAFASTSLRGDSFLPGA
Ga0314698_1021536213300032726SeawaterMAQEKIGGGDSMFKNKDERFKKSMELEYAAHVGPGSYAQGDRTVELDFKKSSGKVSSAFASTSLRGDSFTPGA
Ga0314698_1030100523300032726SeawaterAQEKINGGDSMFKNKDERFKKSMELEYAAHVGPGSYAQADRTVELDFKKSSGKVSSAFASTSLRADSFLPGN
Ga0314698_1041431123300032726SeawaterYDPAMAQEKINGGDSMFKNRDERFKKSMELEYAAHVGPGSYSQADRTVEIGFKKESGKVSSAFASTSLRADSFLPAA
Ga0314698_1043145213300032726SeawaterGAGEYDPQMAQEKIGGGDSMFKNKDERFKKSMELEYAAHVGPGSYAQGDRTVELDFKKTSGKVSSAFASTSLRADSFLPTG
Ga0314698_1046296313300032726SeawaterPASAQEKIGGGDSMFKNKDERFKKSMELEYSAHVGPGSYAQADRTVELDFKKGSGKVSSAFASTSLRADSFLPG
Ga0314693_1074635713300032727SeawaterMFKNKDERFKKSMELEYAAHVGPGSYSQADRTVEIAFKKESGKVSSSFASTSLRGDSFLPAA
Ga0314696_1037993513300032728SeawaterGEYDPAMAQEKIGGGDSMFKNKDERFKKSMELEYAAHVGPGSYAQVDKTVEVEFKKASGKVSSAFASTSLRADSFLPN
Ga0314696_1056319313300032728SeawaterGEYDPKMAQEDIAGGDSMFKNKDERFKKSMELEYAAHVGPGSYAQGDRTVELDFKKTSGKVSSAFASTSLRADSFLPTG
Ga0314697_1033920213300032729SeawaterGEYDPKMAQEGISGGESMFKNKDERFKKSMELEYAAHVGPGSYAQADRTVEIEFKKSSGKVSSAFASTSLRGDSFLPG
Ga0314697_1035611113300032729SeawaterFKNKDERFKKSMELEYAAHVGPGSYSQADRTVEIAFKKESGKVSSSFASTSLRGDSFLPA
Ga0314711_1036053413300032732SeawaterAQEGINGGDSMFKNKDERFKKSMELEYAAHVGPGSYAQADRTVELDFKKSSGKVSSAFASTSLRADSFLPGN
Ga0314711_1048004313300032732SeawaterNGGDSMFKNKDERFKKSMELEYAAHVGPGSYAQADRTVELDFKKTSGKVSSAFASTSLRGDSFLPGA
Ga0314711_1048785413300032732SeawaterKMAQEGISGGESMFKNKDERFKKSMELEYAAHVGPGSYAQGDRTVELDFKKSSGKVSSAFASTSLRADSFLPTG
Ga0314714_1028679213300032733SeawaterQEKISGADSMFKNKDERFKKSMELEYAAHVGPGSYSQADATMELDFKKQSGKVSSAFASTSLRADSFMAGP
Ga0314714_1037953723300032733SeawaterPKMAQEGINGGDSMFKNKDERFKKSMELEYAAHVGPGSYAQADRTVELDFKKSSGKVSSAFASTSLRADSFLPGN
Ga0314706_1019321813300032734SeawaterAGEYDPALPQEKISGADSMFKNKDERFKKSMELEYAAHVGPGSYSQADSTMELDFKKQSGKVSSAFASTSLRADSFMAGP
Ga0314706_1034531913300032734SeawaterGGDSMFKNKDERFKKSMELEYAAHVGPGSYAQGDRTVELDFKKSSGKVSSAFASTSLRGDSFTPGA
Ga0314706_1038769113300032734SeawaterEYDPAMAQEKIGGGDSMFKNKDERFKKSMELEYAAHVGPGSYAQADRTVELDFKKASGKVSSAFASTSLRADSFTAGP
Ga0314706_1059348613300032734SeawaterAMAQEKINGGDSMFKNKDERFKKSMELEYAAHVGPGSYAQADRTVELDFKKTSGKVSSAFASTSLRGDSFLPGA
Ga0314707_1028155723300032743SeawaterYDPKAAGDKIAGGESMFKNKDMRFKKSAELEQQAHVGPGSYQQTDFTVENSYNTNVGKVSSAFASTVLRDSFV
Ga0314705_1051328613300032744SeawaterGDSMFKNKDERFKKSMELEYAAHVGPGSYAQADRTVEIEFKKSSGKVSSAFASTSLRGDSFLPG
Ga0314701_1021908813300032746SeawaterMFKNKDERFKKSMELEYAAHVGPGSYSQADATMELDFKKQSGKVSSAFASTSLRADSFMAGP
Ga0314713_1051523513300032748SeawaterSMFKNKDERFKKSMELEYSAHVGPGSYAQADRTVELDFKKGSGKVSSAFASTSLRADSFLPG
Ga0314691_1014911413300032749SeawaterAGEYDPALPQEKISGADSMFKNKDERFKKSMELEYAAHVGPGSYSQADATMELDFKKQSGKVSSAFASTSLRADSFMAGP
Ga0314694_1016398113300032751SeawaterGAGEYDPALPQEKISGADSMFKNKDERFKKSMELEYAAHVGPGSYSQADSTMELDFKKQSGKVSSAFASTSLRADSFMAGP
Ga0314694_1029185713300032751SeawaterGGGDSMFKNKDECFKKSMELEYAAHVGPGSYAQGDRTVELDFKKSSGKVSSAFASTSLRGDSFTPGA
Ga0314700_1026114713300032752SeawaterGGDSMFKNKDERFKKSMELEYAAHVGPGSYSQADATMELDFKKQSGKVSSAFASTSLRADSFMAGP
Ga0314700_1035706023300032752SeawaterQTPGAGEYDPAMAQEKIGGGDSMFKNKDERFKKSMELEYAAHVGPGSYSQADRTVELDFKKDSGKVSSAFASTSLRADSFVSG
Ga0314709_1050596113300032755SeawaterQEGINGGDSMFKNKDERFKKSMELEYAAHVGPGSYAQADRTVELDFKKSSGKVSSAFASTSLRADSFLPGN
Ga0314709_1056323313300032755SeawaterDKINGGDSMFKNKDMRFKKSAELEQQAHVGPGSYTQTDFTVEKTYNNNVGKVSSAFASTVLRDSFVSA
Ga0314709_1059379923300032755SeawaterGEYDPASAQEKIAGGDSMFKNKDERFKKSMELEYAAHVGPGSYAQADRTVELDFKKASGKVSSAFASTSLRADSFTAGP
Ga0335003_0307240_3_2213300033995FreshwaterMPQEKIAGGESMFKNKDERFKKSMELEYAAHVGPGSYSQAEGTVELAFKKQSGKVSSAFASTSLRGDSFIPS
Ga0334979_0718638_50_2413300033996FreshwaterMFKNKDDRFKKSLELEYAAHVAPGSYSSDGHTIEKKVRQSRGKVSSAFASTSLRGDMFMGHRC


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.