Metagenome / Metatranscriptome Family F063111

Overview

Basic Information

• Family ID: F063111
• Family Type: Metagenome / Metatranscriptome
• Number of Sequences: 130
• Average Sequence Length: 45 residues
• Representative Sequence: MLTTSVAVVRKMLEAVAGSKPKRFSVSGTIAPEMPLAMQ
• Number of Associated Samples: 119
• Number of Associated Scaffolds: 130

Quality Assessment

• Transcriptomic Evidence: Yes
• Most common taxonomic group: Bacteria
• % of genes with valid RBS motifs: 92.31 %
• % of genes near scaffold ends (potentially truncated): 99.23 %
• % of genes from short scaffolds (< 2000 bps): 89.23 %
• Associated GOLD sequencing projects: 111
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.35

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Bacteria (73.077 % of family members)
• NCBI Taxonomy ID: 2
• Taxonomy: All Organisms → cellular organisms → Bacteria

Most Common Ecosystem

• GOLD Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (6.923 % of family members)
• Environment Ontology (ENVO): Unclassified (34.615 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant rhizosphere (38.462 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Fibrous
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 23.88%
  β-sheet: 0.00%
  Coil/Unstructured: 76.12%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 130 Family Scaffolds
PF00571	CBS	11.54
PF13561	adh_short_C2	5.38
PF01435	Peptidase_M48	4.62
PF01026	TatD_DNase	4.62
PF08239	SH3_3	3.85
PF00266	Aminotran_5	3.85
PF12697	Abhydrolase_6	3.08
PF00027	cNMP_binding	2.31
PF06347	SH3_4	2.31
PF07995	GSDH	2.31
PF02776	TPP_enzyme_N	1.54
PF14255	Cys_rich_CPXG	1.54
PF01264	Chorismate_synt	1.54
PF00106	adh_short	1.54
PF02729	OTCace_N	1.54
PF00072	Response_reg	1.54
PF12706	Lactamase_B_2	0.77
PF03235	DUF262	0.77
PF03965	Penicillinase_R	0.77
PF01171	ATP_bind_3	0.77
PF13499	EF-hand_7	0.77
PF00933	Glyco_hydro_3	0.77
PF02687	FtsX	0.77
PF13404	HTH_AsnC-type	0.77
PF08240	ADH_N	0.77
PF07730	HisKA_3	0.77
PF01797	Y1_Tnp	0.77
PF08335	GlnD_UR_UTase	0.77
PF13524	Glyco_trans_1_2	0.77
PF01814	Hemerythrin	0.77
PF07885	Ion_trans_2	0.77
PF00211	Guanylate_cyc	0.77
PF00486	Trans_reg_C	0.77
PF13545	HTH_Crp_2	0.77
PF00440	TetR_N	0.77
PF13610	DDE_Tnp_IS240	0.77
PF12221	HflK_N	0.77
PF00534	Glycos_transf_1	0.77
PF00775	Dioxygenase_C	0.77
PF01195	Pept_tRNA_hydro	0.77
PF00196	GerE	0.77
PF04993	TfoX_N	0.77
PF00873	ACR_tran	0.77
PF00582	Usp	0.77
PF00188	CAP	0.77
PF11303	DUF3105	0.77

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 130 Family Scaffolds
COG2133	Glucose/arabinose dehydrogenase, beta-propeller fold	Carbohydrate transport and metabolism [G]	2.31
COG0082	Chorismate synthase	Amino acid transport and metabolism [E]	1.54
COG4585	Signal transduction histidine kinase ComP	Signal transduction mechanisms [T]	0.77
COG0037	tRNA(Ile)-lysidine synthase TilS/MesJ	Translation, ribosomal structure and biogenesis [J]	0.77
COG4564	Signal transduction histidine kinase	Signal transduction mechanisms [T]	0.77
COG3851	Signal transduction histidine kinase UhpB, glucose-6-phosphate specific	Signal transduction mechanisms [T]	0.77
COG3850	Signal transduction histidine kinase NarQ, nitrate/nitrite-specific	Signal transduction mechanisms [T]	0.77
COG3682	Transcriptional regulator, CopY/TcrY family	Transcription [K]	0.77
COG3485	Protocatechuate 3,4-dioxygenase beta subunit	Secondary metabolites biosynthesis, transport and catabolism [Q]	0.77
COG3070	Transcriptional regulator of competence genes, TfoX/Sxy family	Transcription [K]	0.77
COG2844	UTP:GlnB (protein PII) uridylyltransferase	Signal transduction mechanisms [T]	0.77
COG2340	Spore germination protein YkwD and related proteins with CAP (CSP/antigen 5/PR1) domain	Cell cycle control, cell division, chromosome partitioning [D]	0.77
COG2114	Adenylate cyclase, class 3	Signal transduction mechanisms [T]	0.77
COG1943	REP element-mobilizing transposase RayT	Mobilome: prophages, transposons [X]	0.77
COG1846	DNA-binding transcriptional regulator, MarR family	Transcription [K]	0.77
COG1606	ATP-utilizing enzyme, PP-loop superfamily	General function prediction only [R]	0.77
COG1479	DNAse/DNA nickase specific for phosphorothioated or glycosylated phage DNA, GmrSD/DndB/SspE family, contains DUF262 and HNH nuclease domains	Defense mechanisms [V]	0.77
COG1472	Periplasmic beta-glucosidase and related glycosidases	Carbohydrate transport and metabolism [G]	0.77
COG0603	7-cyano-7-deazaguanine synthase (queuosine biosynthesis)	Translation, ribosomal structure and biogenesis [J]	0.77
COG0519	GMP synthase, PP-ATPase domain/subunit	Nucleotide transport and metabolism [F]	0.77
COG0482	tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domain	Translation, ribosomal structure and biogenesis [J]	0.77
COG0301	Adenylyl- and sulfurtransferase ThiI (thiamine and tRNA 4-thiouridine biosynthesis)	Translation, ribosomal structure and biogenesis [J]	0.77
COG0193	Peptidyl-tRNA hydrolase	Translation, ribosomal structure and biogenesis [J]	0.77

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	73.85 %
Unclassified	root	N/A	26.15 %

Level 2

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	73.85 %
Unclassified	root	N/A	26.15 %

Level 3

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	73.08 %
Unclassified	root	N/A	26.15 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	0.77 %

Level 4

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	40.00 %
Unclassified	root	N/A	26.15 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	4.62 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	2.31 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.77 %
unclassified Bacteria	no rank	All Organisms → cellular organisms → Bacteria → unclassified Bacteria	0.77 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	0.77 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.15 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	14.62 %
Verrucomicrobia	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	4.62 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	4.62 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	3.85 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2.31 %
Gemmatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	2.31 %
bacterium ADurb.Bin431	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.Bin431	0.77 %
Metazoa	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	0.77 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.77 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.15 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	4.62 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	3.08 %
Verrucomicrobiae	class	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae	3.08 %
unclassified Betaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria	3.08 %
unclassified Gemmatimonadetes	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes	2.31 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1.54 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1.54 %
Opitutae	class	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae	0.77 %
Chromatiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales	0.77 %
Sphingomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales	0.77 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.77 %
Rhodocyclales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	0.77 %
Eumetazoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa	0.77 %
bacterium ADurb.Bin431	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.Bin431	0.77 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.15 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	3.08 %
Verrucomicrobiales	order	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales	3.08 %
Rhodanobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae	2.31 %
Myxococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	2.31 %
unclassified Deltaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria	1.54 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1.54 %
Stappiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Stappiaceae	0.77 %
Erythrobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae	0.77 %
Opitutales	order	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales	0.77 %
Woeseiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae	0.77 %
Gemmatimonadetes bacterium 21-71-4	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 21-71-4	0.77 %
Bilateria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria	0.77 %
Xanthomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae	0.77 %
Oxalobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae	0.77 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.77 %
Rhodocyclales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	0.77 %
bacterium ADurb.Bin431	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.Bin431	0.77 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.15 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	3.08 %
Verrucomicrobiaceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae	2.31 %
Dokdonella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dokdonella	2.31 %
unclassified Myxococcales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales	1.54 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.54 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1.54 %
Tsuneonella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae → Tsuneonella	0.77 %
unclassified Woeseiaceae	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → unclassified Woeseiaceae	0.77 %
unclassified Verrucomicrobiales	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales	0.77 %
Arenimonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Arenimonas	0.77 %
Protostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia	0.77 %
Roseibium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Stappiaceae → Roseibium	0.77 %
Opitutaceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae	0.77 %
Gemmatimonadetes bacterium 21-71-4	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 21-71-4	0.77 %
Oxalobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae	0.77 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.77 %
Rhodocyclales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	0.77 %
bacterium ADurb.Bin431	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.Bin431	0.77 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.15 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	3.08 %
Dokdonella fugitiva	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dokdonella → Dokdonella fugitiva	1.54 %
Prosthecobacter	genus	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Prosthecobacter	1.54 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.54 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1.54 %
Tsuneonella troitsensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae → Tsuneonella → Tsuneonella troitsensis	0.77 %
unclassified Arenimonas	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Arenimonas → unclassified Arenimonas	0.77 %
Woeseiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → unclassified Woeseiaceae → Woeseiaceae bacterium	0.77 %
Dokdonella koreensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dokdonella → Dokdonella koreensis	0.77 %
Verrucomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium	0.77 %
Myxococcales bacterium 68-20	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium 68-20	0.77 %
unclassified Verrucomicrobiaceae	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae	0.77 %
Ecdysozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa	0.77 %
Myxococcales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	0.77 %
Opitutus	genus	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Opitutus	0.77 %
Roseibium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Stappiaceae → Roseibium	0.77 %
Gemmatimonadetes bacterium 21-71-4	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 21-71-4	0.77 %
Oxalobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae	0.77 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.77 %
Rhodocyclales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	0.77 %
bacterium ADurb.Bin431	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.Bin431	0.77 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.15 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	3.08 %
Dokdonella fugitiva	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dokdonella → Dokdonella fugitiva	1.54 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.54 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1.54 %
Verrucomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium	0.77 %
Arenimonas sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Arenimonas → unclassified Arenimonas → Arenimonas sp.	0.77 %
Prosthecobacter fusiformis	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Prosthecobacter → Prosthecobacter fusiformis	0.77 %
Opitutus terrae	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Opitutus → Opitutus terrae	0.77 %
Panarthropoda	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda	0.77 %
Tsuneonella troitsensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae → Tsuneonella → Tsuneonella troitsensis	0.77 %
Woeseiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → unclassified Woeseiaceae → Woeseiaceae bacterium	0.77 %
Dokdonella koreensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dokdonella → Dokdonella koreensis	0.77 %
Verrucomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium	0.77 %
Myxococcales bacterium 68-20	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium 68-20	0.77 %
Myxococcales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	0.77 %
Roseibium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Stappiaceae → Roseibium	0.77 %
Gemmatimonadetes bacterium 21-71-4	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 21-71-4	0.77 %
Oxalobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae	0.77 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.77 %
Rhodocyclales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	0.77 %
bacterium ADurb.Bin431	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.Bin431	0.77 %

Level 11

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.15 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	3.08 %
Dokdonella fugitiva	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dokdonella → Dokdonella fugitiva	1.54 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.54 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1.54 %
Opitutus terrae PB90-1	strain	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Opitutus → Opitutus terrae → Opitutus terrae PB90-1	0.77 %
Arthropoda	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda	0.77 %
Verrucomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium	0.77 %
Arenimonas sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Arenimonas → unclassified Arenimonas → Arenimonas sp.	0.77 %
Prosthecobacter fusiformis	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Prosthecobacter → Prosthecobacter fusiformis	0.77 %
Tsuneonella troitsensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae → Tsuneonella → Tsuneonella troitsensis	0.77 %
Woeseiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → unclassified Woeseiaceae → Woeseiaceae bacterium	0.77 %
Dokdonella koreensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dokdonella → Dokdonella koreensis	0.77 %
Verrucomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium	0.77 %
Myxococcales bacterium 68-20	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium 68-20	0.77 %
Myxococcales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	0.77 %
Roseibium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Stappiaceae → Roseibium	0.77 %
Gemmatimonadetes bacterium 21-71-4	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 21-71-4	0.77 %
Oxalobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae	0.77 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.77 %
Rhodocyclales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	0.77 %
bacterium ADurb.Bin431	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.Bin431	0.77 %

Level 12

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.15 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	3.08 %
Dokdonella fugitiva	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dokdonella → Dokdonella fugitiva	1.54 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.54 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1.54 %
Mandibulata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata	0.77 %
Opitutus terrae PB90-1	strain	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Opitutus → Opitutus terrae → Opitutus terrae PB90-1	0.77 %
Verrucomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium	0.77 %
Arenimonas sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Arenimonas → unclassified Arenimonas → Arenimonas sp.	0.77 %
Prosthecobacter fusiformis	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Prosthecobacter → Prosthecobacter fusiformis	0.77 %
Tsuneonella troitsensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae → Tsuneonella → Tsuneonella troitsensis	0.77 %
Woeseiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → unclassified Woeseiaceae → Woeseiaceae bacterium	0.77 %
Dokdonella koreensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dokdonella → Dokdonella koreensis	0.77 %
Verrucomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium	0.77 %
Myxococcales bacterium 68-20	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium 68-20	0.77 %
Myxococcales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	0.77 %
Roseibium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Stappiaceae → Roseibium	0.77 %
Gemmatimonadetes bacterium 21-71-4	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 21-71-4	0.77 %
Oxalobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae	0.77 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.77 %
Rhodocyclales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	0.77 %
bacterium ADurb.Bin431	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.Bin431	0.77 %

Level 13

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.15 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	3.08 %
Dokdonella fugitiva	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dokdonella → Dokdonella fugitiva	1.54 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.54 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1.54 %
Pancrustacea	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea	0.77 %
Opitutus terrae PB90-1	strain	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Opitutus → Opitutus terrae → Opitutus terrae PB90-1	0.77 %
Verrucomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium	0.77 %
Arenimonas sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Arenimonas → unclassified Arenimonas → Arenimonas sp.	0.77 %
Prosthecobacter fusiformis	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Prosthecobacter → Prosthecobacter fusiformis	0.77 %
Tsuneonella troitsensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae → Tsuneonella → Tsuneonella troitsensis	0.77 %
Woeseiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → unclassified Woeseiaceae → Woeseiaceae bacterium	0.77 %
Dokdonella koreensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dokdonella → Dokdonella koreensis	0.77 %
Verrucomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium	0.77 %
Myxococcales bacterium 68-20	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium 68-20	0.77 %
Myxococcales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	0.77 %
Roseibium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Stappiaceae → Roseibium	0.77 %
Gemmatimonadetes bacterium 21-71-4	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 21-71-4	0.77 %
Oxalobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae	0.77 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.77 %
Rhodocyclales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	0.77 %
bacterium ADurb.Bin431	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.Bin431	0.77 %

Level 14

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.15 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	3.08 %
Dokdonella fugitiva	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dokdonella → Dokdonella fugitiva	1.54 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.54 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1.54 %
Hexapoda	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda	0.77 %
Opitutus terrae PB90-1	strain	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Opitutus → Opitutus terrae → Opitutus terrae PB90-1	0.77 %
Verrucomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium	0.77 %
Arenimonas sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Arenimonas → unclassified Arenimonas → Arenimonas sp.	0.77 %
Prosthecobacter fusiformis	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Prosthecobacter → Prosthecobacter fusiformis	0.77 %
Tsuneonella troitsensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae → Tsuneonella → Tsuneonella troitsensis	0.77 %
Woeseiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → unclassified Woeseiaceae → Woeseiaceae bacterium	0.77 %
Dokdonella koreensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dokdonella → Dokdonella koreensis	0.77 %
Verrucomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium	0.77 %
Myxococcales bacterium 68-20	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium 68-20	0.77 %
Myxococcales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	0.77 %
Roseibium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Stappiaceae → Roseibium	0.77 %
Gemmatimonadetes bacterium 21-71-4	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 21-71-4	0.77 %
Oxalobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae	0.77 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.77 %
Rhodocyclales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	0.77 %
bacterium ADurb.Bin431	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.Bin431	0.77 %

Level 15

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.15 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	3.08 %
Dokdonella fugitiva	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dokdonella → Dokdonella fugitiva	1.54 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.54 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1.54 %
Insecta	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta	0.77 %
Opitutus terrae PB90-1	strain	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Opitutus → Opitutus terrae → Opitutus terrae PB90-1	0.77 %
Verrucomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium	0.77 %
Arenimonas sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Arenimonas → unclassified Arenimonas → Arenimonas sp.	0.77 %
Prosthecobacter fusiformis	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Prosthecobacter → Prosthecobacter fusiformis	0.77 %
Tsuneonella troitsensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae → Tsuneonella → Tsuneonella troitsensis	0.77 %
Woeseiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → unclassified Woeseiaceae → Woeseiaceae bacterium	0.77 %
Dokdonella koreensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dokdonella → Dokdonella koreensis	0.77 %
Verrucomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium	0.77 %
Myxococcales bacterium 68-20	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium 68-20	0.77 %
Myxococcales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	0.77 %
Roseibium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Stappiaceae → Roseibium	0.77 %
Gemmatimonadetes bacterium 21-71-4	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 21-71-4	0.77 %
Oxalobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae	0.77 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.77 %
Rhodocyclales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	0.77 %
bacterium ADurb.Bin431	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.Bin431	0.77 %

Level 16

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.15 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	3.08 %
Dokdonella fugitiva	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dokdonella → Dokdonella fugitiva	1.54 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.54 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1.54 %
Dicondylia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia	0.77 %
Opitutus terrae PB90-1	strain	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Opitutus → Opitutus terrae → Opitutus terrae PB90-1	0.77 %
Verrucomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium	0.77 %
Arenimonas sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Arenimonas → unclassified Arenimonas → Arenimonas sp.	0.77 %
Prosthecobacter fusiformis	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Prosthecobacter → Prosthecobacter fusiformis	0.77 %
Tsuneonella troitsensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae → Tsuneonella → Tsuneonella troitsensis	0.77 %
Woeseiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → unclassified Woeseiaceae → Woeseiaceae bacterium	0.77 %
Dokdonella koreensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dokdonella → Dokdonella koreensis	0.77 %
Verrucomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium	0.77 %
Myxococcales bacterium 68-20	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium 68-20	0.77 %
Myxococcales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	0.77 %
Roseibium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Stappiaceae → Roseibium	0.77 %
Gemmatimonadetes bacterium 21-71-4	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 21-71-4	0.77 %
Oxalobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae	0.77 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.77 %
Rhodocyclales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	0.77 %
bacterium ADurb.Bin431	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.Bin431	0.77 %

Level 17

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.15 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	3.08 %
Dokdonella fugitiva	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dokdonella → Dokdonella fugitiva	1.54 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.54 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1.54 %
Pterygota	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota	0.77 %
Opitutus terrae PB90-1	strain	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Opitutus → Opitutus terrae → Opitutus terrae PB90-1	0.77 %
Verrucomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium	0.77 %
Arenimonas sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Arenimonas → unclassified Arenimonas → Arenimonas sp.	0.77 %
Prosthecobacter fusiformis	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Prosthecobacter → Prosthecobacter fusiformis	0.77 %
Tsuneonella troitsensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae → Tsuneonella → Tsuneonella troitsensis	0.77 %
Woeseiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → unclassified Woeseiaceae → Woeseiaceae bacterium	0.77 %
Dokdonella koreensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dokdonella → Dokdonella koreensis	0.77 %
Verrucomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium	0.77 %
Myxococcales bacterium 68-20	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium 68-20	0.77 %
Myxococcales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	0.77 %
Roseibium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Stappiaceae → Roseibium	0.77 %
Gemmatimonadetes bacterium 21-71-4	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 21-71-4	0.77 %
Oxalobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae	0.77 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.77 %
Rhodocyclales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	0.77 %
bacterium ADurb.Bin431	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.Bin431	0.77 %

Level 18

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.15 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	3.08 %
Dokdonella fugitiva	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dokdonella → Dokdonella fugitiva	1.54 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.54 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1.54 %
Neoptera	infraclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	0.77 %
Opitutus terrae PB90-1	strain	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Opitutus → Opitutus terrae → Opitutus terrae PB90-1	0.77 %
Verrucomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium	0.77 %
Arenimonas sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Arenimonas → unclassified Arenimonas → Arenimonas sp.	0.77 %
Prosthecobacter fusiformis	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Prosthecobacter → Prosthecobacter fusiformis	0.77 %
Tsuneonella troitsensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae → Tsuneonella → Tsuneonella troitsensis	0.77 %
Woeseiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → unclassified Woeseiaceae → Woeseiaceae bacterium	0.77 %
Dokdonella koreensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dokdonella → Dokdonella koreensis	0.77 %
Verrucomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium	0.77 %
Myxococcales bacterium 68-20	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium 68-20	0.77 %
Myxococcales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	0.77 %
Roseibium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Stappiaceae → Roseibium	0.77 %
Gemmatimonadetes bacterium 21-71-4	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 21-71-4	0.77 %
Oxalobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae	0.77 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.77 %
Rhodocyclales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	0.77 %
bacterium ADurb.Bin431	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.Bin431	0.77 %

Level 19

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.15 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	3.08 %
Dokdonella fugitiva	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dokdonella → Dokdonella fugitiva	1.54 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.54 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1.54 %
Endopterygota	cohort	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota	0.77 %
Opitutus terrae PB90-1	strain	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Opitutus → Opitutus terrae → Opitutus terrae PB90-1	0.77 %
Verrucomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium	0.77 %
Arenimonas sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Arenimonas → unclassified Arenimonas → Arenimonas sp.	0.77 %
Prosthecobacter fusiformis	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Prosthecobacter → Prosthecobacter fusiformis	0.77 %
Tsuneonella troitsensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae → Tsuneonella → Tsuneonella troitsensis	0.77 %
Woeseiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → unclassified Woeseiaceae → Woeseiaceae bacterium	0.77 %
Dokdonella koreensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dokdonella → Dokdonella koreensis	0.77 %
Verrucomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium	0.77 %
Myxococcales bacterium 68-20	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium 68-20	0.77 %
Myxococcales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	0.77 %
Roseibium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Stappiaceae → Roseibium	0.77 %
Gemmatimonadetes bacterium 21-71-4	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 21-71-4	0.77 %
Oxalobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae	0.77 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.77 %
Rhodocyclales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	0.77 %
bacterium ADurb.Bin431	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.Bin431	0.77 %

Level 20

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.15 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	3.08 %
Dokdonella fugitiva	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dokdonella → Dokdonella fugitiva	1.54 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.54 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1.54 %
Coleoptera	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera	0.77 %
Opitutus terrae PB90-1	strain	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Opitutus → Opitutus terrae → Opitutus terrae PB90-1	0.77 %
Verrucomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium	0.77 %
Arenimonas sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Arenimonas → unclassified Arenimonas → Arenimonas sp.	0.77 %
Prosthecobacter fusiformis	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Prosthecobacter → Prosthecobacter fusiformis	0.77 %
Tsuneonella troitsensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae → Tsuneonella → Tsuneonella troitsensis	0.77 %
Woeseiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → unclassified Woeseiaceae → Woeseiaceae bacterium	0.77 %
Dokdonella koreensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dokdonella → Dokdonella koreensis	0.77 %
Verrucomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium	0.77 %
Myxococcales bacterium 68-20	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium 68-20	0.77 %
Myxococcales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	0.77 %
Roseibium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Stappiaceae → Roseibium	0.77 %
Gemmatimonadetes bacterium 21-71-4	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 21-71-4	0.77 %
Oxalobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae	0.77 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.77 %
Rhodocyclales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	0.77 %
bacterium ADurb.Bin431	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.Bin431	0.77 %

Level 21

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.15 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	3.08 %
Dokdonella fugitiva	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dokdonella → Dokdonella fugitiva	1.54 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.54 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1.54 %
Polyphaga	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga	0.77 %
Opitutus terrae PB90-1	strain	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Opitutus → Opitutus terrae → Opitutus terrae PB90-1	0.77 %
Verrucomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium	0.77 %
Arenimonas sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Arenimonas → unclassified Arenimonas → Arenimonas sp.	0.77 %
Prosthecobacter fusiformis	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Prosthecobacter → Prosthecobacter fusiformis	0.77 %
Tsuneonella troitsensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae → Tsuneonella → Tsuneonella troitsensis	0.77 %
Woeseiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → unclassified Woeseiaceae → Woeseiaceae bacterium	0.77 %
Dokdonella koreensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dokdonella → Dokdonella koreensis	0.77 %
Verrucomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium	0.77 %
Myxococcales bacterium 68-20	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium 68-20	0.77 %
Myxococcales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	0.77 %
Roseibium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Stappiaceae → Roseibium	0.77 %
Gemmatimonadetes bacterium 21-71-4	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 21-71-4	0.77 %
Oxalobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae	0.77 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.77 %
Rhodocyclales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	0.77 %
bacterium ADurb.Bin431	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.Bin431	0.77 %

Level 22

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.15 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	3.08 %
Dokdonella fugitiva	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dokdonella → Dokdonella fugitiva	1.54 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.54 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1.54 %
Cucujiformia	infraorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Cucujiformia	0.77 %
Opitutus terrae PB90-1	strain	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Opitutus → Opitutus terrae → Opitutus terrae PB90-1	0.77 %
Verrucomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium	0.77 %
Arenimonas sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Arenimonas → unclassified Arenimonas → Arenimonas sp.	0.77 %
Prosthecobacter fusiformis	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Prosthecobacter → Prosthecobacter fusiformis	0.77 %
Tsuneonella troitsensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae → Tsuneonella → Tsuneonella troitsensis	0.77 %
Woeseiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → unclassified Woeseiaceae → Woeseiaceae bacterium	0.77 %
Dokdonella koreensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dokdonella → Dokdonella koreensis	0.77 %
Verrucomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium	0.77 %
Myxococcales bacterium 68-20	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium 68-20	0.77 %
Myxococcales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	0.77 %
Roseibium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Stappiaceae → Roseibium	0.77 %
Gemmatimonadetes bacterium 21-71-4	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 21-71-4	0.77 %
Oxalobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae	0.77 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.77 %
Rhodocyclales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	0.77 %
bacterium ADurb.Bin431	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.Bin431	0.77 %

Level 23

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.15 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	3.08 %
Dokdonella fugitiva	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dokdonella → Dokdonella fugitiva	1.54 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.54 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1.54 %
Curculionoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Cucujiformia → Curculionoidea	0.77 %
Opitutus terrae PB90-1	strain	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Opitutus → Opitutus terrae → Opitutus terrae PB90-1	0.77 %
Verrucomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium	0.77 %
Arenimonas sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Arenimonas → unclassified Arenimonas → Arenimonas sp.	0.77 %
Prosthecobacter fusiformis	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Prosthecobacter → Prosthecobacter fusiformis	0.77 %
Tsuneonella troitsensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae → Tsuneonella → Tsuneonella troitsensis	0.77 %
Woeseiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → unclassified Woeseiaceae → Woeseiaceae bacterium	0.77 %
Dokdonella koreensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dokdonella → Dokdonella koreensis	0.77 %
Verrucomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium	0.77 %
Myxococcales bacterium 68-20	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium 68-20	0.77 %
Myxococcales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	0.77 %
Roseibium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Stappiaceae → Roseibium	0.77 %
Gemmatimonadetes bacterium 21-71-4	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 21-71-4	0.77 %
Oxalobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae	0.77 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.77 %
Rhodocyclales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	0.77 %
bacterium ADurb.Bin431	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.Bin431	0.77 %

Level 24

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.15 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	3.08 %
Dokdonella fugitiva	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dokdonella → Dokdonella fugitiva	1.54 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.54 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1.54 %
Curculionidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Cucujiformia → Curculionoidea → Curculionidae	0.77 %
Opitutus terrae PB90-1	strain	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Opitutus → Opitutus terrae → Opitutus terrae PB90-1	0.77 %
Verrucomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium	0.77 %
Arenimonas sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Arenimonas → unclassified Arenimonas → Arenimonas sp.	0.77 %
Prosthecobacter fusiformis	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Prosthecobacter → Prosthecobacter fusiformis	0.77 %
Tsuneonella troitsensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae → Tsuneonella → Tsuneonella troitsensis	0.77 %
Woeseiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → unclassified Woeseiaceae → Woeseiaceae bacterium	0.77 %
Dokdonella koreensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dokdonella → Dokdonella koreensis	0.77 %
Verrucomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium	0.77 %
Myxococcales bacterium 68-20	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium 68-20	0.77 %
Myxococcales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	0.77 %
Roseibium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Stappiaceae → Roseibium	0.77 %
Gemmatimonadetes bacterium 21-71-4	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 21-71-4	0.77 %
Oxalobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae	0.77 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.77 %
Rhodocyclales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	0.77 %
bacterium ADurb.Bin431	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.Bin431	0.77 %

Level 25

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.15 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	3.08 %
Dokdonella fugitiva	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dokdonella → Dokdonella fugitiva	1.54 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.54 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1.54 %
Entiminae	subfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Cucujiformia → Curculionoidea → Curculionidae → Entiminae	0.77 %
Opitutus terrae PB90-1	strain	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Opitutus → Opitutus terrae → Opitutus terrae PB90-1	0.77 %
Verrucomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium	0.77 %
Arenimonas sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Arenimonas → unclassified Arenimonas → Arenimonas sp.	0.77 %
Prosthecobacter fusiformis	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Prosthecobacter → Prosthecobacter fusiformis	0.77 %
Tsuneonella troitsensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae → Tsuneonella → Tsuneonella troitsensis	0.77 %
Woeseiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → unclassified Woeseiaceae → Woeseiaceae bacterium	0.77 %
Dokdonella koreensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dokdonella → Dokdonella koreensis	0.77 %
Verrucomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium	0.77 %
Myxococcales bacterium 68-20	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium 68-20	0.77 %
Myxococcales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	0.77 %
Roseibium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Stappiaceae → Roseibium	0.77 %
Gemmatimonadetes bacterium 21-71-4	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 21-71-4	0.77 %
Oxalobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae	0.77 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.77 %
Rhodocyclales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	0.77 %
bacterium ADurb.Bin431	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.Bin431	0.77 %

Level 26

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.15 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	3.08 %
Dokdonella fugitiva	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dokdonella → Dokdonella fugitiva	1.54 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.54 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1.54 %
Celeuthetini	tribe	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Cucujiformia → Curculionoidea → Curculionidae → Entiminae → Celeuthetini	0.77 %
Opitutus terrae PB90-1	strain	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Opitutus → Opitutus terrae → Opitutus terrae PB90-1	0.77 %
Verrucomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium	0.77 %
Arenimonas sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Arenimonas → unclassified Arenimonas → Arenimonas sp.	0.77 %
Prosthecobacter fusiformis	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Prosthecobacter → Prosthecobacter fusiformis	0.77 %
Tsuneonella troitsensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae → Tsuneonella → Tsuneonella troitsensis	0.77 %
Woeseiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → unclassified Woeseiaceae → Woeseiaceae bacterium	0.77 %
Dokdonella koreensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dokdonella → Dokdonella koreensis	0.77 %
Verrucomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium	0.77 %
Myxococcales bacterium 68-20	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium 68-20	0.77 %
Myxococcales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	0.77 %
Roseibium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Stappiaceae → Roseibium	0.77 %
Gemmatimonadetes bacterium 21-71-4	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 21-71-4	0.77 %
Oxalobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae	0.77 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.77 %
Rhodocyclales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	0.77 %
bacterium ADurb.Bin431	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.Bin431	0.77 %

Level 27

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.15 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	3.08 %
Dokdonella fugitiva	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dokdonella → Dokdonella fugitiva	1.54 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.54 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1.54 %
Syntrophus	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Cucujiformia → Curculionoidea → Curculionidae → Entiminae → Celeuthetini → Syntrophus	0.77 %
Opitutus terrae PB90-1	strain	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Opitutus → Opitutus terrae → Opitutus terrae PB90-1	0.77 %
Verrucomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium	0.77 %
Arenimonas sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Arenimonas → unclassified Arenimonas → Arenimonas sp.	0.77 %
Prosthecobacter fusiformis	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Prosthecobacter → Prosthecobacter fusiformis	0.77 %
Tsuneonella troitsensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae → Tsuneonella → Tsuneonella troitsensis	0.77 %
Woeseiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → unclassified Woeseiaceae → Woeseiaceae bacterium	0.77 %
Dokdonella koreensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dokdonella → Dokdonella koreensis	0.77 %
Verrucomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium	0.77 %
Myxococcales bacterium 68-20	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium 68-20	0.77 %
Myxococcales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	0.77 %
Roseibium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Stappiaceae → Roseibium	0.77 %
Gemmatimonadetes bacterium 21-71-4	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 21-71-4	0.77 %
Oxalobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae	0.77 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.77 %
Rhodocyclales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	0.77 %
bacterium ADurb.Bin431	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.Bin431	0.77 %

Associated Scaffolds

Scaffold	Taxonomy	Length
2199352024|deeps__Contig_162538	All Organisms → cellular organisms → Bacteria → Proteobacteria	1792
3300000956|JGI10216J12902_116979076	Not Available	653
3300002916|JGI25389J43894_1040963	Not Available	796
3300004016|Ga0058689_10096570	All Organisms → cellular organisms → Bacteria	619
3300004019|Ga0055439_10178481	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	671
3300004114|Ga0062593_103416299	All Organisms → cellular organisms → Bacteria	509
3300004183|Ga0066403_1051245	All Organisms → cellular organisms → Bacteria	692
3300004463|Ga0063356_101888270	Not Available	900
3300004480|Ga0062592_101579233	All Organisms → cellular organisms → Bacteria	633
3300005168|Ga0066809_10070936	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Arenimonas → unclassified Arenimonas → Arenimonas sp.	812
3300005327|Ga0070658_10190192	All Organisms → cellular organisms → Bacteria → Proteobacteria	1730
3300005438|Ga0070701_10193225	All Organisms → cellular organisms → Bacteria → Proteobacteria	1199
3300005440|Ga0070705_100685293	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	803
3300005456|Ga0070678_100650197	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	946
3300005459|Ga0068867_100294261	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dokdonella → Dokdonella fugitiva	1336
3300005535|Ga0070684_100713436	All Organisms → cellular organisms → Bacteria → Proteobacteria	935
3300005535|Ga0070684_101216692	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	708
3300005539|Ga0068853_101900031	All Organisms → cellular organisms → Bacteria	577
3300005552|Ga0066701_10973555	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	502
3300005555|Ga0066692_10199557	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1251
3300005556|Ga0066707_10821133	Not Available	574
3300005558|Ga0066698_10645795	Not Available	706
3300005598|Ga0066706_10878402	Not Available	700
3300005616|Ga0068852_100014496	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae	6071
3300005617|Ga0068859_102393931	All Organisms → cellular organisms → Bacteria	582
3300005841|Ga0068863_100403671	All Organisms → cellular organisms → Bacteria	1337
3300005985|Ga0081539_10421073	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	554
3300006163|Ga0070715_10645112	Not Available	626
3300006186|Ga0075369_10597662	All Organisms → cellular organisms → Bacteria	528
3300006865|Ga0073934_10009357	All Organisms → cellular organisms → Bacteria	12595
3300006871|Ga0075434_101302922	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	737
3300006871|Ga0075434_101714400	Not Available	636
3300006903|Ga0075426_11471270	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	518
3300006904|Ga0075424_100852345	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	972
3300006918|Ga0079216_11155260	All Organisms → cellular organisms → Bacteria	617
3300007004|Ga0079218_10751125	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium 68-20	926
3300009012|Ga0066710_102968282	Not Available	662
3300009095|Ga0079224_103140655	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	658
3300010401|Ga0134121_12959957	All Organisms → cellular organisms → Bacteria	522
3300011435|Ga0137426_1025301	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 21-71-4	1466
3300014875|Ga0180083_1066225	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	762
3300014879|Ga0180062_1001545	All Organisms → cellular organisms → Bacteria → Proteobacteria	4601
3300015256|Ga0180073_1015847	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Cucujiformia → Curculionoidea → Curculionidae → Entiminae → Celeuthetini → Syntrophus	1335
3300018027|Ga0184605_10392277	Not Available	621
3300018053|Ga0184626_10265149	Not Available	718
3300018422|Ga0190265_11813177	Not Available	718
3300018432|Ga0190275_13299239	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium	522
3300018433|Ga0066667_11056451	Not Available	702
3300018476|Ga0190274_13054270	All Organisms → cellular organisms → Bacteria	562
3300018476|Ga0190274_13846467	All Organisms → cellular organisms → Bacteria	508
3300018481|Ga0190271_11790199	Not Available	726
3300018920|Ga0190273_10886927	All Organisms → cellular organisms → Bacteria	720
3300020067|Ga0180109_1005279	All Organisms → cellular organisms → Bacteria	1323
3300020147|Ga0196976_1084823	Not Available	682
3300020192|Ga0163147_10182324	All Organisms → cellular organisms → Bacteria	1242
3300020202|Ga0196964_10446274	Not Available	628
3300020202|Ga0196964_10662783	All Organisms → cellular organisms → Bacteria	516
3300021559|Ga0210409_10365608	Not Available	1295
3300021953|Ga0213880_10115838	Not Available	711
3300022209|Ga0224497_10201681	All Organisms → cellular organisms → Bacteria	773
3300024056|Ga0124853_1338153	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1825
3300024330|Ga0137417_1221224	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1513
3300025310|Ga0209172_10571798	Not Available	509
3300025321|Ga0207656_10225567	All Organisms → cellular organisms → Bacteria → Proteobacteria	912
3300025321|Ga0207656_10299362	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	796
3300025708|Ga0209201_1096209	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.Bin431	1077
3300025793|Ga0210065_1018476	All Organisms → cellular organisms → Bacteria	1303
3300025907|Ga0207645_10870908	Not Available	612
3300025909|Ga0207705_10055131	All Organisms → cellular organisms → Bacteria → Proteobacteria	2866
3300025909|Ga0207705_10607612	All Organisms → cellular organisms → Bacteria → Proteobacteria	850
3300025917|Ga0207660_10243836	All Organisms → cellular organisms → Bacteria → Proteobacteria	1416
3300025919|Ga0207657_10981166	Not Available	649
3300025921|Ga0207652_10255218	All Organisms → cellular organisms → Bacteria → Proteobacteria	1581
3300025936|Ga0207670_10632664	All Organisms → cellular organisms → Bacteria	881
3300025938|Ga0207704_10271463	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	1284
3300025938|Ga0207704_11538379	All Organisms → cellular organisms → Bacteria	571
3300025938|Ga0207704_11812155	Not Available	525
3300025940|Ga0207691_10323478	All Organisms → cellular organisms → Bacteria	1322
3300025944|Ga0207661_11661533	All Organisms → cellular organisms → Bacteria → Proteobacteria	584
3300025949|Ga0207667_10577859	All Organisms → cellular organisms → Bacteria → Proteobacteria	1135
3300025972|Ga0207668_10379571	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1189
3300025972|Ga0207668_11253552	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dokdonella → Dokdonella fugitiva	667
3300026023|Ga0207677_11753099	All Organisms → cellular organisms → Bacteria → Proteobacteria	576
3300026088|Ga0207641_10105593	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dokdonella → Dokdonella koreensis	2488
3300026118|Ga0207675_102439676	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	535
3300026121|Ga0207683_11859294	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Opitutus → Opitutus terrae → Opitutus terrae PB90-1	551
3300026142|Ga0207698_10530952	Not Available	1150
3300026142|Ga0207698_10647464	All Organisms → cellular organisms → Bacteria → Proteobacteria	1046
3300026309|Ga0209055_1199128	All Organisms → cellular organisms → Bacteria	613
3300026319|Ga0209647_1161192	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	916
3300026326|Ga0209801_1013351	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	4180
3300026548|Ga0209161_10328137	Not Available	703
3300027181|Ga0208997_1002320	Not Available	2181
3300027395|Ga0209996_1007209	All Organisms → cellular organisms → Bacteria → Proteobacteria	1445
3300027533|Ga0208185_1000754	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	11708
3300027691|Ga0209485_1194271	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	629
3300027739|Ga0209575_10107118	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Prosthecobacter → Prosthecobacter fusiformis	1016
3300027754|Ga0209596_1130585	All Organisms → cellular organisms → Bacteria → Proteobacteria	1142
3300027802|Ga0209476_10049888	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	2228
3300027886|Ga0209486_11067316	All Organisms → cellular organisms → Bacteria	546
3300027910|Ga0209583_10288199	Not Available	740
3300027915|Ga0209069_10170063	All Organisms → cellular organisms → Bacteria → Proteobacteria	1095
3300027954|Ga0209859_1035340	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	832
3300027959|Ga0209477_1162850	Not Available	732
(restricted) 3300028559|Ga0247831_1035704	All Organisms → cellular organisms → Bacteria	2887
(restricted) 3300028571|Ga0247844_1325943	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Prosthecobacter	513
(restricted) 3300028581|Ga0247840_10032055	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	4717
(restricted) 3300028581|Ga0247840_10240043	All Organisms → cellular organisms → Bacteria	982
3300028590|Ga0247823_10227583	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Stappiaceae → Roseibium	1413
3300028599|Ga0265309_10911981	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → unclassified Woeseiaceae → Woeseiaceae bacterium	604
3300028600|Ga0265303_11687093	Not Available	530
3300031547|Ga0310887_10742103	Not Available	612
3300031553|Ga0315547_1244292	Not Available	544
3300031562|Ga0310886_10475497	Not Available	750
3300031720|Ga0307469_10736748	All Organisms → cellular organisms → Bacteria	898
3300031847|Ga0310907_10214787	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium	927
3300031852|Ga0307410_10051753	All Organisms → cellular organisms → Bacteria	2770
3300031911|Ga0307412_10277588	All Organisms → cellular organisms → Bacteria → Proteobacteria	1314
3300031943|Ga0310885_10830435	All Organisms → cellular organisms → Bacteria	526
3300031965|Ga0326597_10623263	Not Available	1149
3300032005|Ga0307411_10452738	All Organisms → cellular organisms → Bacteria	1074
3300032174|Ga0307470_11009476	Not Available	662
3300032180|Ga0307471_102619969	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	639
3300032256|Ga0315271_10073558	Not Available	2535
3300032829|Ga0335070_11715970	All Organisms → cellular organisms → Bacteria	569
3300033412|Ga0310810_11121736	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae → Tsuneonella → Tsuneonella troitsensis	651
3300033480|Ga0316620_10144047	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1899
3300033550|Ga0247829_10489874	All Organisms → cellular organisms → Bacteria	1017
3300034094|Ga0335014_0017544	All Organisms → cellular organisms → Bacteria → Proteobacteria	3902
3300034113|Ga0364937_053838	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	754

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Environmental	Environmental	68.46%
Host-Associated	Host-Associated	29.23%
Engineered	Engineered	2.31%

Class

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	46.15%
Plants	Host-Associated → Plants	29.23%
Aquatic	Environmental → Aquatic	22.31%
Wastewater	Engineered → Wastewater	2.31%

Category

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	44.62%
Rhizoplane	Host-Associated → Plants → Rhizoplane	16.15%
Rhizosphere	Host-Associated → Plants → Rhizosphere	11.54%
Freshwater	Environmental → Aquatic → Freshwater	9.23%
Sediment	Environmental → Aquatic → Sediment	6.92%
Marine	Environmental → Aquatic → Marine	4.62%
Thermal Springs	Environmental → Aquatic → Thermal Springs	1.54%
Activated Sludge	Engineered → Wastewater → Activated Sludge	1.54%
Rock-Dwelling (Subaerial Biofilms)	Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms)	0.77%
Floodplain	Environmental → Terrestrial → Floodplain	0.77%
Roots	Host-Associated → Plants → Roots	0.77%
Phyllosphere	Host-Associated → Plants → Phyllosphere	0.77%
Anaerobic Digestor	Engineered → Wastewater → Anaerobic Digestor	0.77%

Type

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	32.31%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	14.62%
Loam	Environmental → Terrestrial → Soil → Loam	7.69%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	6.92%
Lake	Environmental → Aquatic → Freshwater → Lake	6.15%
Soil	Host-Associated → Plants → Rhizosphere → Soil	6.15%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	5.38%
Sand	Environmental → Terrestrial → Soil → Sand	3.08%
Sediment	Environmental → Aquatic → Freshwater → Sediment	1.54%
Wetlands	Environmental → Aquatic → Marine → Wetlands	1.54%
Subtidal Zone	Environmental → Aquatic → Marine → Subtidal Zone	1.54%
Sediment	Environmental → Aquatic → Thermal Springs → Sediment	1.54%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	1.54%
Soil	Host-Associated → Plants → Rhizoplane → Soil	1.54%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified	1.54%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	0.77%
Pond	Environmental → Aquatic → Freshwater → Pond	0.77%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	0.77%
Sediment	Environmental → Aquatic → Marine → Sediment	0.77%
Unclassified	Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified	0.77%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	0.77%
Bulk Soil	Host-Associated → Plants → Roots → Bulk Soil	0.77%
Phylloplane/Leaf Surface	Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface	0.77%
Unclassified	Engineered → Wastewater → Anaerobic Digestor → Unclassified	0.77%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	14.62%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	10.00%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	10.00%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	6.92%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	6.92%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	6.15%
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	5.38%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	5.38%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	4.62%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	4.62%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	3.08%
Desert	Environmental → Terrestrial → Soil → Sand → Desert	2.31%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	1.54%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	1.54%
Sediment	Environmental → Aquatic → Marine → Subtidal Zone → Sediment	1.54%
Unclassified	Environmental → Aquatic → Thermal Springs → Sediment → Unclassified	1.54%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	1.54%
Unclassified	Host-Associated → Plants → Rhizoplane → Soil → Unclassified	1.54%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified	1.54%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	0.77%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	0.77%
Sediment	Environmental → Aquatic → Freshwater → Pond → Sediment	0.77%
Salt Marsh	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh	0.77%
Unclassified	Environmental → Aquatic → Marine → Sediment → Unclassified	0.77%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	0.77%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	0.77%
Unclassified	Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified	0.77%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	0.77%
Unclassified	Host-Associated → Plants → Roots → Bulk Soil → Unclassified	0.77%
Unclassified	Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified	0.77%
Unclassified	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified	0.77%

Habitat

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	6.92%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	6.15%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	5.38%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	4.62%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	3.85%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	3.85%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	3.85%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	3.85%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	3.08%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	3.08%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	3.08%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	3.08%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	3.08%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	2.31%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	2.31%
Soil	Environmental → Terrestrial → Soil → Sand → Desert → Soil	2.31%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	2.31%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	1.54%
Sediment	Environmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment	1.54%
Hot Spring Sediment	Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment	1.54%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	1.54%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	1.54%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.54%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	1.54%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	1.54%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	1.54%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere	1.54%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	1.54%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	1.54%
Activated Sludge	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge	1.54%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	0.77%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	0.77%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	0.77%
Freshwater Microbial Mat	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat	0.77%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	0.77%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	0.77%
Freshwater	Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater	0.77%
Salt Marsh Sediment	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment	0.77%
Sediment	Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment	0.77%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	0.77%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.77%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Agricultural Soil	0.77%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.77%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	0.77%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.77%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	0.77%
Exposed Rock	Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock	0.77%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	0.77%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	0.77%
Populus Endosphere	Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere	0.77%
Agave	Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave	0.77%
Anaerobic Digestor Sludge	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge	0.77%

Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OID	Sample Name	Habitat Type
2199352024	Bare-fallow DEEP SOIL	Environmental
3300000956	Soil microbial communities from Great Prairies - Kansas, Native Prairie soil	Environmental
3300002916	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm	Environmental
3300004016	Agave microbial communities from Guanajuato, Mexico - As.Ma.rz	Host-Associated
3300004019	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2	Environmental
3300004114	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5	Environmental
3300004183	Freshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metagenome 3_LOW4	Environmental
3300004463	Combined assembly of Arabidopsis thaliana microbial communities	Host-Associated
3300004480	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4	Environmental
3300005168	Soil and rhizosphere microbial communities from Laval, Canada - mgLPC	Environmental
3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Host-Associated
3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Environmental
3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Environmental
3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Host-Associated
3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Host-Associated
3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Environmental
3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Host-Associated
3300005552	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150	Environmental
3300005555	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141	Environmental
3300005556	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156	Environmental
3300005558	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147	Environmental
3300005598	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155	Environmental
3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Host-Associated
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated
3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Host-Associated
3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Environmental
3300006186	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Host-Associated
3300006865	Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG	Environmental
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated
3300006903	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5	Host-Associated
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated
3300006918	Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100	Environmental
3300007004	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost	Environmental
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental
3300009095	Agricultural soil microbial communities from Utah to study Nitrogen management - Steer compost 2015	Environmental
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental
3300011435	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT660_2	Environmental
3300014875	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_1_16_10D	Environmental
3300014879	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT45_16_10D	Environmental
3300015256	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT333_16_10D	Environmental
3300018027	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex	Environmental
3300018053	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1	Environmental
3300018422	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T	Environmental
3300018432	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T	Environmental
3300018433	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116	Environmental
3300018476	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T	Environmental
3300018481	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T	Environmental
3300018920	Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS	Environmental
3300020067	Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT47_16_1Ra (Metagenome Metatranscriptome)	Environmental
3300020147	Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_5-13C	Environmental
3300020192	Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica- Oligotrophic Lake LV.19.MP6.G1	Environmental
3300020202	Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_10	Environmental
3300021559	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M	Environmental
3300021953	Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R07	Environmental
3300022209	Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_13	Environmental
3300024056	Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (PacBio error correction)	Environmental
3300024330	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction)	Environmental
3300025310	Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes)	Environmental
3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)	Host-Associated
3300025708	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC055_MetaG (SPAdes)	Engineered
3300025793	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWB_D1 (SPAdes)	Environmental
3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)	Host-Associated
3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)	Host-Associated
3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)	Environmental
3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)	Host-Associated
3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)	Environmental
3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)	Environmental
3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)	Host-Associated
3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)	Host-Associated
3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)	Environmental
3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)	Host-Associated
3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)	Host-Associated
3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)	Host-Associated
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated
3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)	Host-Associated
3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)	Host-Associated
3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)	Host-Associated
3300026309	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes)	Environmental
3300026319	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes)	Environmental
3300026326	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)	Environmental
3300026548	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)	Environmental
3300027181	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M1 (SPAdes)	Environmental
3300027395	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes)	Host-Associated
3300027533	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 (SPAdes)	Environmental
3300027691	Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes)	Environmental
3300027739	Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Medium cellulose week 11 (SPAdes)	Environmental
3300027754	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes)	Environmental
3300027802	Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB14_precipitate (SPAdes)	Engineered
3300027886	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)	Environmental
3300027910	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes)	Environmental
3300027915	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)	Environmental
3300027954	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60 (SPAdes)	Environmental
3300027959	Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB14_supernatant (SPAdes)	Engineered
3300028559 (restricted)	Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_1m	Environmental
3300028571 (restricted)	Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch201714.5m_1	Environmental
3300028581 (restricted)	Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_17m	Environmental
3300028590	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day30	Environmental
3300028599	Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160524 (Illumina Assembly)	Environmental
3300028600	Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160317 (Illumina Assembly)	Environmental
3300031547	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4	Environmental
3300031553	Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-240	Environmental
3300031562	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3	Environmental
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental
3300031847	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4	Environmental
3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Host-Associated
3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Host-Associated
3300031943	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2	Environmental
3300031965	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185	Environmental
3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Host-Associated
3300032174	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05	Environmental
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental
3300032256	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top	Environmental
3300032829	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3	Environmental
3300033412	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC	Environmental
3300033480	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B	Environmental
3300033550	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4	Environmental
3300034094	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Sep2000-rr0077	Environmental
3300034113	Sediment microbial communities from East River floodplain, Colorado, United States - 7_s17	Environmental

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID	Sample Taxon ID	Habitat	Sequence
deeps_02995190	2199352024	Soil	MLLTSVAVVTMMLDAVAGSAPSRRSASGTSAPETPLTA
JGI10216J12902_1169790761	3300000956	Soil	MLTTSVAVVRKMLDAVAGSRPKRFSVSGIIAPQIPLTTHAP
JGI25389J43894_10409632	3300002916	Grasslands Soil	MLTTSVAVVRKMLEAVAGSKPRRFSVSGTIAPEMPLAMHE
Ga0058689_100965701	3300004016	Agave	MLATSLAVVRKMLEAVAGSAPNRFRVSGISAPAMPATVQLTVIAMNT
Ga0055439_101784811	3300004019	Natural And Restored Wetlands	MLTMSVAVVRKMLDAVAGSVPSRRKMRGTSVPDTPLTMQATTIA
Ga0062593_1034162992	3300004114	Soil	MLTTSVAVVRKMLEAVAGSAPSRRNVSGTSAPEMPLTTQLPIIARKTMSPRMGALGLCCMRA
Ga0066403_10512451	3300004183	Freshwater Sediment	MLTTSVMVVRKMLDAVAGSAPRRFSTKGMLVPAMPANMQLNDIA
Ga0063356_1018882703	3300004463	Arabidopsis Thaliana Rhizosphere	MLATSVAVVTTMLEAVAGSAPRRFNASGTSAPEMPLMAQLPIIAA
Ga0062592_1015792332	3300004480	Soil	MLATSVAVVRKMLDAVAGSAPRLRSVSGMSAPARPLTTQLAHI
Ga0066809_100709362	3300005168	Soil	MLTTSVIVVRKMLEAVAGSAPRRLSSKGIAVPATPAIMQLKAIALAV
Ga0070658_101901921	3300005327	Corn Rhizosphere	MSPMLETSVAVVTMILEAVAGSAPSFFSTSGTSAPETPERQQLPIIAIITTKP
Ga0070701_101932253	3300005438	Corn, Switchgrass And Miscanthus Rhizosphere	MRPMLDTSVAVVTMMLEAVAGSKPSLFNAMGTSAPEMPDRQQLPIIAII
Ga0070705_1006852932	3300005440	Corn, Switchgrass And Miscanthus Rhizosphere	MLTTSVAVVRKMLEAVAGSAPIRRKISGTTAPAMPLTTQLPVMAMSTTK
Ga0070678_1006501971	3300005456	Miscanthus Rhizosphere	MRPMLDTSVAVVTMMLEAVAGSKPSLFNAMGTSAPEMPDRQQLPIIAIIT
Ga0068867_1002942612	3300005459	Miscanthus Rhizosphere	MLTTSVAVVRKMLEAVAGSAPSRFSASGTAAPATPDNAQLPVIATNVIAASS
Ga0070684_1007134362	3300005535	Corn Rhizosphere	MLTTSVAVVRKMLDAIAGSAPMRLSPSGTAAPATPLATLDSDIAVKVISAS
Ga0070684_1012166921	3300005535	Corn Rhizosphere	MLLTSVAVVTMMLEAVAGSAPRRRSTSGTSAPETPLTAQLPIIARQTT
Ga0068853_1019000312	3300005539	Corn Rhizosphere	MLTTSVAVVRKMLEAVAGSAPARRSIMGTTAPAMPLTRQLQVMAMSTTKP
Ga0066701_109735551	3300005552	Soil	MLTTSVAVVRKMLEAVAGSKPRRFSVSGTIAPEMPLAMHEP
Ga0066692_101995571	3300005555	Soil	MLTTSVAVVRKMLEAVAGSKPRRFSVSGTIAPEMP
Ga0066707_108211331	3300005556	Soil	MLTTSVAVVRKMLEAVAGSKPRRFSVSGTIAPEMPLAMHEPIMARNTTN
Ga0066698_106457952	3300005558	Soil	MLTTSVAVVRKMLEAVAGSKPRRFSVSGTIAPEMPLAMHEPIMARNTT
Ga0066706_108784022	3300005598	Soil	MLTTSVAVVRKMLEAVAGSKPRRFSVSGTIAPEMPLAMHEPIMARNTTNASITGCA
Ga0068852_1000144961	3300005616	Corn Rhizosphere	MLETSVAVVTTMLEAVAGSAPSRFSASGTTAPDTPESAQLPIIAAFTTSASLSA
Ga0068859_1023939311	3300005617	Switchgrass Rhizosphere	MLTTSVAVVRKIDDAVAGSAPRRCSVVGTSTPEMPLITQAITI
Ga0068863_1004036711	3300005841	Switchgrass Rhizosphere	MLTTSVAVVRKMLEAVAGSKPRRFSVSGISAPERPLAMQEKTIARKTMN
Ga0081539_104210731	3300005985	Tabebuia Heterophylla Rhizosphere	MLDTSVAVVRKMLDAVAGSAPNRRSASGITAPMMPLIMHAAIIAITTITP
Ga0070715_106451122	3300006163	Corn, Switchgrass And Miscanthus Rhizosphere	MSPMLDTSVAVVTMMLDAVAGSKPSFFNTMGTRAPEMPDRQQLPIMAIITT
Ga0075369_105976621	3300006186	Populus Endosphere	MLATSVAVVTTMLEAVAGSAPRRLSVSGTIAPEMPLIAQLPI
Ga0073934_100093571	3300006865	Hot Spring Sediment	MLATSVAVVRKMLDAVAGSAPIFRSPSGMRAPEIPLTTQLPVMASSTTRLSMSAASNCWT
Ga0075434_1013029221	3300006871	Populus Rhizosphere	MLTTSVAVVRKMLEAVAGSAPKRFRVRGTIAPHMP
Ga0075434_1017144001	3300006871	Populus Rhizosphere	MLTQSVAVVRKMLDAVAGSNPIRFSATGTSTPDSPLAMHENTIA
Ga0075426_114712702	3300006903	Populus Rhizosphere	MLTQSVAVVRKMLDAVAGSKPIRFSATGTSTPDRPLAMHDSTIAA
Ga0075424_1008523452	3300006904	Populus Rhizosphere	MLTTSVAVVRKMLEAVAGSAPKRFRVRGTIAPHMPLA
Ga0079216_111552602	3300006918	Agricultural Soil	MLATSVAVVRKMLDAVAGSAPILLSVIGTSAPDTPLITQLKVMAIATIAP
Ga0079218_107511253	3300007004	Agricultural Soil	MLTTSEAVVRKMLEAVAGSAPSRRSASGTAAPAIPLATQAPIIARNTTSASD
Ga0066710_1029682821	3300009012	Grasslands Soil	MLTMSVAVVTKMLEAVAGSAPSFFRVSGTSAPQTLLTTQLP
Ga0079224_1031406551	3300009095	Agricultural Soil	MLATSVAVVRKMLDAVAGSAPSLRKVSGTSAPETPLTRQLV
Ga0134121_129599571	3300010401	Terrestrial Soil	MLTTSVAVVKKMLEAVAGSAPMRRKASGTTAPEIPLTVQLAAM
Ga0137426_10253011	3300011435	Soil	MLATSVAVVRKMLEAVAGSAPSFLSVSGTSAPETPLIMQLPIIA
Ga0180083_10662252	3300014875	Soil	MLTTSVAVVRKMLEAVAGSKPKRFNVIGIREPQSPLMMQAPTSAIHT
Ga0180062_10015456	3300014879	Soil	MLTTSVAVVRKMLEAVAGSKPKRFNVIGIREPQSPLMMQAPT
Ga0180073_10158473	3300015256	Soil	MLTTSVAVVRKMLEAVAGSKPKRFNVIGIREPQSPLMMQAPTS
Ga0184605_103922772	3300018027	Groundwater Sediment	MLTTSVAVVRKMLEAVAGSKPRRFSVSGTIAPAMPLAMHEPT
Ga0184626_102651491	3300018053	Groundwater Sediment	MLTTSVAVVRKMLEAVAGSKPKRFSVSGTIAPEMPLAMQ
Ga0190265_118131773	3300018422	Soil	MLATSVAVVRKMLEAVAGSAPSLRSPSGMSAPEIPLTTQLAVIAS
Ga0190275_132992391	3300018432	Soil	MLTTSVVVVRKILEAVAGSAPKRFSVSGMRAPEIP
Ga0066667_110564511	3300018433	Grasslands Soil	MLTTSVAVVRKMLEAVAGSKPRRFSVSGTIAPEMPLAMHEPIMARNTTNASIT
Ga0190274_130542701	3300018476	Soil	MLATSVAVVTKMLEAVAGSAPRRLSASGTSAPETPLIAQLPIIANVTTTPRMNA
Ga0190274_138464672	3300018476	Soil	MLATSVAVVRKMLEAVAGSAPIRRRIMGTTAPEMPLIVQLPIMARV
Ga0190271_117901991	3300018481	Soil	MLATSVAVVTTMLEEVAGSAPRRFSASGTSAPEIPLIAQLPIIARQTTTPSITACGESCETA
Ga0190273_108869271	3300018920	Soil	MLAMSVAVVRKMLDAVAGSAPSFRKVIGISAPEMPLMTQLP
Ga0180109_10052791	3300020067	Groundwater Sediment	MLTTSVAVVRKILEAVAGSRPKRFNVIGIRAPHTPLVTHAPTSAAHTTR
Ga0196976_10848231	3300020147	Soil	MLTTSVAVVRKIADAVAGSWPKRFSVSGISAPDRPLAMHAPTMAR
Ga0163147_101823241	3300020192	Freshwater Microbial Mat	MLATSVAVVRKMLEAVAGSSPSRFSVKGIRAPERPL
Ga0196964_104462742	3300020202	Soil	MLTTSVAVVRKMLEAVAGSKPKRFSVSGMIAPETPLAMHEAIIAR
Ga0196964_106627831	3300020202	Soil	MLTTSVAVVRKMLDAVAGSRPKRFSVSGMMAPEMPLAMQEAIMA
Ga0210409_103656081	3300021559	Soil	MLQQSVAVVRKMLDAVAGSAPIRRRMSGTSAPAIPLIAHDAVIANHTQRPSMTGL
Ga0213880_101158382	3300021953	Exposed Rock	MLDTSVAVVTMMLEAVAGSAPKRFSARGTRAPETPLTQQLPII
Ga0224497_102016812	3300022209	Sediment	MLATSVAVVRKMLDAVAGSAPMRRSVRGMSAPARPLT
Ga0124853_13381531	3300024056	Freshwater Wetlands	MLTTSVAVVRKILEAVAGSAPKRLSVNGTMAPEIPLATQLP
Ga0137417_12212241	3300024330	Vadose Zone Soil	MLTTSVAVVRKMLEAVAGSMLEAVAGSKPRRFSVSG
Ga0209172_105717982	3300025310	Hot Spring Sediment	MLATSVAVVRKMLDAVAGSAPIFRSPSGMRAPEIPLTTQLPVMASATIDASA
Ga0207656_102255671	3300025321	Corn Rhizosphere	MLTTSVAVVRKMLEAIAGSAPMRFSPSGTAAPATPLATL
Ga0207656_102993621	3300025321	Corn Rhizosphere	MLLTSVAVVTMMLEAVAGSAPRRRSTSGTSAPETPLTAQLPIIARQTTTP
Ga0209201_10962092	3300025708	Anaerobic Digestor Sludge	MLATSVAVVRKMLEAVAGSAPSRRSRIGTSVPKMPLTTQAPAMAARTINPSEK
Ga0210065_10184761	3300025793	Natural And Restored Wetlands	MLTTSVAVVRKMLDAVAGSAPSFWSVIGTSTPVIPLATHAPVI
Ga0207645_108709081	3300025907	Miscanthus Rhizosphere	MLTTSVAVVRKMLDAVAGSKPKRFSVSGMIAPEMPLAMHEEI
Ga0207705_100551311	3300025909	Corn Rhizosphere	MSPMLETSVAVVTMILEAVAGSAPSFFSTSGTSAPETPERQQLPIIAIITTKPSINACGL
Ga0207705_106076122	3300025909	Corn Rhizosphere	MLTTSVAVVRKMLDAIAGSAPMRFSPSGTAAPATPLATLDS
Ga0207660_102438363	3300025917	Corn Rhizosphere	MLTTSVAVVRKMLDAVAGSRPMRFSVIGISAPHSPL
Ga0207657_109811662	3300025919	Corn Rhizosphere	MLETSVAVVTTMLEAVAGSAPSRFSASGTTAPDTPE
Ga0207652_102552183	3300025921	Corn Rhizosphere	MLETSVAVVTMMLEAVAGSAPRRFSAIGTSAPETPLSAQLPIIAAFTTRASLSAC
Ga0207670_106326643	3300025936	Switchgrass Rhizosphere	MLATSVAVVTKMLEAVAGSAPMRFNASGTMAPEMPLIAQLPVIASTTTMPNIAACSDFWETASR
Ga0207704_102714631	3300025938	Miscanthus Rhizosphere	MLTTSVAVVRKMLEAVAGSAPARRSIMGTTAPAMPLTRQL
Ga0207704_115383791	3300025938	Miscanthus Rhizosphere	MLATSVAVVRKILEAVAGSAPSRLRARGMSAPATPLITQLAI
Ga0207704_118121551	3300025938	Miscanthus Rhizosphere	MIVASNSSKPMLATSVAVVTKMLEAVAGSAPKRFNPSGTSAPEMPLMAQLP
Ga0207691_103234782	3300025940	Miscanthus Rhizosphere	MLATSVAVVTKMLEAVAGSAPMRFNASGTMAPEMPLIAQLPVIASTTTMPNIAAC
Ga0207661_116615331	3300025944	Corn Rhizosphere	MLTTSVAVVRKMLDAIAGSAPMRLSPSGTAAPATPLA
Ga0207667_105778593	3300025949	Corn Rhizosphere	MLLTSVAVVTMMLEAVAGSAPSRRSTSGTSAPETPLTAQLPIIARQTTTPSEIAWGTSWNRASTY
Ga0207668_103795713	3300025972	Switchgrass Rhizosphere	MLTTSVAVVRKIDEAVAGSAPSRFSVVGTSTPETPLITQAITIARSVMTASIH
Ga0207668_112535522	3300025972	Switchgrass Rhizosphere	MLTTSVAVVRKMLEAVAGSAPSRFSASGTAAPATPDNAQLPVIAT
Ga0207677_117530991	3300026023	Miscanthus Rhizosphere	MLTTSVAVVRKMLDAIAGSAPMRFSPSGTAAPATPLATLDSDIAAKV
Ga0207641_101055933	3300026088	Switchgrass Rhizosphere	MLTTSVAVVRKMLDAVAGSAPSRFSPSGTAAPAMPDMAQLPAIAT
Ga0207675_1024396763	3300026118	Switchgrass Rhizosphere	MLTVSVAVVKNMLDAIAGSAPTRLRHSGTAAPAMPLTTLLRV
Ga0207683_118592942	3300026121	Miscanthus Rhizosphere	MLTTSVAVVRKMLDAVAGSAPRRRSPSGTAAPAMPDTAQLPAMATNVISA
Ga0207698_105309522	3300026142	Corn Rhizosphere	MLQTSVAVVRKMLEAVAGSAPSRRRISGMSAPATPLTAHEAVIAN
Ga0207698_106474641	3300026142	Corn Rhizosphere	MSPMLETSVAVVTMILEAVAGSAPSLFSTSGTSAPEMPDRQ
Ga0209055_11991281	3300026309	Soil	MLTTSVAVVRKMLEAVAGSKPRRFSVSGTIAPEMPLAMHEPIM
Ga0209647_11611923	3300026319	Grasslands Soil	MLTQSVAVVRKMLDAVAGSKPILFSVIGTSAPERPLAMH
Ga0209801_10133511	3300026326	Soil	MLTTSVAVVRKMLEAVAGSKPRRFSVSGTIAPEMPLAMHEPIMA
Ga0209161_103281372	3300026548	Soil	MLTTSVAVVRKMLEAVAGSKPRRFSVSGTIAPEMPLAMHEPIMARNTTNASITGC
Ga0208997_10023204	3300027181	Forest Soil	MLTTSVAVVRKMLEAVAGSKPRRFSVSGTIAPAMPLAMHEPTMARN
Ga0209996_10072093	3300027395	Arabidopsis Thaliana Rhizosphere	MLTTSVAVVRKMLEAVAGSAPIFLSVSGTIAPEMPLAMQ
Ga0208185_10007541	3300027533	Soil	MLTTSVAVVRKILEAVAGSKPKRFNVIGIREPQSPLMMQAPTSAIHTTTASAM
Ga0209485_11942711	3300027691	Agricultural Soil	MLTTSVAVVRKMLDAVAGSAPKRFSVNGTIAPHTPLATQLATSASHTTRP
Ga0209575_101071181	3300027739	Freshwater	MLTTSVAVVRKMLEAVAGSAPSFLKVRGINAPQRPLTMQLV
Ga0209596_11305853	3300027754	Freshwater Lake	MLATSVAVVKKILEAVQGSAPSRFKTNGMNAPERPLIM
Ga0209476_100498884	3300027802	Activated Sludge	MLATSVAVVTMMLDAVAGSAPSRLSARGTTAPETPLTAQLPIMARQTATPSHRAWADSWE
Ga0209486_110673161	3300027886	Agricultural Soil	MLTTSVAVVRKIDEAVAGSAPSRFSVVGTSTPETPLIMQA
Ga0209583_102881991	3300027910	Watersheds	MLVTSVAVVTMMLDAVAGSAPKRFNASGTRAPEIPLMQQLPIIARVT
Ga0209069_101700633	3300027915	Watersheds	MLVTSVAVVTMMLEAVAGSAPKRFNASGTRAPEIPLMQQLPT
Ga0209859_10353402	3300027954	Groundwater Sand	MLVTSVAVVRKMLEAVAGSNPSLLSVSGIIAPEIPLA
Ga0209477_11628501	3300027959	Activated Sludge	MLATSVAVVTMMLDAVAGSAPSRLSARGTTAPETPLTAQLPIMARQTATPSHRAWADS
(restricted) Ga0247831_10357041	3300028559	Freshwater	MLTTSVAVVRKMLEAVAGSAPSFLRMIGMIAPETPLTEQLPTIA
(restricted) Ga0247844_13259431	3300028571	Freshwater	MLITSVAVVRKMLDAVAGSAPKRRKIRGIKAPQRPLTTQ
(restricted) Ga0247840_100320554	3300028581	Freshwater	MLTTSVAVVRKMLEAVAGSAPSFLRMIGMIAPETPLTEQLPTIARKTTPES
(restricted) Ga0247840_102400431	3300028581	Freshwater	MLTMSVAVVKKILLAVAGSAPKRRSTSGIMAPQRPLMMQLAVMAMKT
Ga0247823_102275831	3300028590	Soil	MLATSVAVVRKMLDAVAGSAPTRRSARGISAPAIPLMMQLAVIASATI
Ga0265309_109119812	3300028599	Sediment	MLTTSVAVVRKILEAVAGSAPSLFSVKGTITPVTPLATQ
Ga0265303_116870932	3300028600	Sediment	MLATSVAVVKKILEAVAGSAPNFFKPMGTMAPDIPLTTQLPIIAHNT
Ga0310887_107421031	3300031547	Soil	MLTTSVAVVRKMLDAVAGSKPKRFSVSGMIAPEMPLAMHEEIM
Ga0315547_12442921	3300031553	Salt Marsh Sediment	MLTTSVAVVRNILDAVTGSAPKRLNVRGTITPAMPLAMQAPVIASS
Ga0310886_104754971	3300031562	Soil	MRPMLETSVAVVTMILDAVAGSAPRRFSTSGTSAPEMPERQQLPII
Ga0307469_107367482	3300031720	Hardwood Forest Soil	MLTTSVAVVRKMLEAVAGSKPKRFSVSGTSAPDTPLATQAPTM
Ga0310907_102147872	3300031847	Soil	MLTTSVAVVRKIDEAVAGSAPNRCSVVGTNTPEIP
Ga0307410_100517534	3300031852	Rhizosphere	MLAMSLAVVRKMLEAVAGSAPRRLRVSGMSAPEMPATVQLATIATATT
Ga0307412_102775881	3300031911	Rhizosphere	MLTTSVAVVRKMLDAVAGSRPKRLSVSGMMAPEMPLAM
Ga0310885_108304352	3300031943	Soil	MLTTSVAVVRKIDEAVAGSAPSRFSVVGTSTPETPLITQAITIARRV
Ga0326597_106232631	3300031965	Soil	MLATSVAVVTKMLDAVAGSKLNFFRVIGTNAPKIPLMTQL
Ga0307411_104527381	3300032005	Rhizosphere	MLAMSLAVVRKILEAVAGSAPSRFKVSGMRAPEMPATVQLATMDT
Ga0307470_110094761	3300032174	Hardwood Forest Soil	MLTQSVAVVRKMLEAVAGSKPIRFSATGTSTPESP
Ga0307471_1026199691	3300032180	Hardwood Forest Soil	MLTMSVAVVRKMLEAVAGSAPRRLRPIGTSAPEIPLAIQLP
Ga0315271_100735582	3300032256	Sediment	MLQTSVIVVRKILEAVAGSAPSRFSTSGMVVPAIPATMQLNDIATMVINPR
Ga0335070_117159701	3300032829	Soil	MLATSVAVVRKMLEAVAGSNPSFFRVSGIRAPAIPLTTQLAIM
Ga0310810_111217363	3300033412	Soil	MLATSLAVVRKMLEAVAGSAPSRFSTIGISAPAIPDTVQAMTIARKTTE
Ga0316620_101440471	3300033480	Soil	MLTTSVAVVRKMLDAVAGSVPKRLSVSGTRAPEMPLMV
Ga0247829_104898741	3300033550	Soil	MLATSVAVVRKMLDAVAGSAPTRRSARGISAPAIPLMMQ
Ga0335014_0017544_3707_3889	3300034094	Freshwater	MLATSVAVVRKMLDAVAGSAPNFRKISGIVAPETPLTMQLPIIARNTINAKAKARSLDCQ
Ga0364937_053838_577_753	3300034113	Sediment	MLTTSVAVVRKMLEAVAGSKPKRFNVIGIREPQSPLMMQAPTNAIHTTTASAMAFGLP