| Basic Information | |
|---|---|
| Family ID | F063111 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 130 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MLTTSVAVVRKMLEAVAGSKPKRFSVSGTIAPEMPLAMQ |
| Number of Associated Samples | 119 |
| Number of Associated Scaffolds | 130 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 92.31 % |
| % of genes near scaffold ends (potentially truncated) | 99.23 % |
| % of genes from short scaffolds (< 2000 bps) | 89.23 % |
| Associated GOLD sequencing projects | 111 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.35 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (73.077 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (6.923 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.615 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (38.462 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 23.88% β-sheet: 0.00% Coil/Unstructured: 76.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 130 Family Scaffolds |
|---|---|---|
| PF00571 | CBS | 11.54 |
| PF13561 | adh_short_C2 | 5.38 |
| PF01435 | Peptidase_M48 | 4.62 |
| PF01026 | TatD_DNase | 4.62 |
| PF08239 | SH3_3 | 3.85 |
| PF00266 | Aminotran_5 | 3.85 |
| PF12697 | Abhydrolase_6 | 3.08 |
| PF00027 | cNMP_binding | 2.31 |
| PF06347 | SH3_4 | 2.31 |
| PF07995 | GSDH | 2.31 |
| PF02776 | TPP_enzyme_N | 1.54 |
| PF14255 | Cys_rich_CPXG | 1.54 |
| PF01264 | Chorismate_synt | 1.54 |
| PF00106 | adh_short | 1.54 |
| PF02729 | OTCace_N | 1.54 |
| PF00072 | Response_reg | 1.54 |
| PF12706 | Lactamase_B_2 | 0.77 |
| PF03235 | DUF262 | 0.77 |
| PF03965 | Penicillinase_R | 0.77 |
| PF01171 | ATP_bind_3 | 0.77 |
| PF13499 | EF-hand_7 | 0.77 |
| PF00933 | Glyco_hydro_3 | 0.77 |
| PF02687 | FtsX | 0.77 |
| PF13404 | HTH_AsnC-type | 0.77 |
| PF08240 | ADH_N | 0.77 |
| PF07730 | HisKA_3 | 0.77 |
| PF01797 | Y1_Tnp | 0.77 |
| PF08335 | GlnD_UR_UTase | 0.77 |
| PF13524 | Glyco_trans_1_2 | 0.77 |
| PF01814 | Hemerythrin | 0.77 |
| PF07885 | Ion_trans_2 | 0.77 |
| PF00211 | Guanylate_cyc | 0.77 |
| PF00486 | Trans_reg_C | 0.77 |
| PF13545 | HTH_Crp_2 | 0.77 |
| PF00440 | TetR_N | 0.77 |
| PF13610 | DDE_Tnp_IS240 | 0.77 |
| PF12221 | HflK_N | 0.77 |
| PF00534 | Glycos_transf_1 | 0.77 |
| PF00775 | Dioxygenase_C | 0.77 |
| PF01195 | Pept_tRNA_hydro | 0.77 |
| PF00196 | GerE | 0.77 |
| PF04993 | TfoX_N | 0.77 |
| PF00873 | ACR_tran | 0.77 |
| PF00582 | Usp | 0.77 |
| PF00188 | CAP | 0.77 |
| PF11303 | DUF3105 | 0.77 |
| COG ID | Name | Functional Category | % Frequency in 130 Family Scaffolds |
|---|---|---|---|
| COG2133 | Glucose/arabinose dehydrogenase, beta-propeller fold | Carbohydrate transport and metabolism [G] | 2.31 |
| COG0082 | Chorismate synthase | Amino acid transport and metabolism [E] | 1.54 |
| COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.77 |
| COG0037 | tRNA(Ile)-lysidine synthase TilS/MesJ | Translation, ribosomal structure and biogenesis [J] | 0.77 |
| COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.77 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.77 |
| COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.77 |
| COG3682 | Transcriptional regulator, CopY/TcrY family | Transcription [K] | 0.77 |
| COG3485 | Protocatechuate 3,4-dioxygenase beta subunit | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.77 |
| COG3070 | Transcriptional regulator of competence genes, TfoX/Sxy family | Transcription [K] | 0.77 |
| COG2844 | UTP:GlnB (protein PII) uridylyltransferase | Signal transduction mechanisms [T] | 0.77 |
| COG2340 | Spore germination protein YkwD and related proteins with CAP (CSP/antigen 5/PR1) domain | Cell cycle control, cell division, chromosome partitioning [D] | 0.77 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.77 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.77 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.77 |
| COG1606 | ATP-utilizing enzyme, PP-loop superfamily | General function prediction only [R] | 0.77 |
| COG1479 | DNAse/DNA nickase specific for phosphorothioated or glycosylated phage DNA, GmrSD/DndB/SspE family, contains DUF262 and HNH nuclease domains | Defense mechanisms [V] | 0.77 |
| COG1472 | Periplasmic beta-glucosidase and related glycosidases | Carbohydrate transport and metabolism [G] | 0.77 |
| COG0603 | 7-cyano-7-deazaguanine synthase (queuosine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 0.77 |
| COG0519 | GMP synthase, PP-ATPase domain/subunit | Nucleotide transport and metabolism [F] | 0.77 |
| COG0482 | tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domain | Translation, ribosomal structure and biogenesis [J] | 0.77 |
| COG0301 | Adenylyl- and sulfurtransferase ThiI (thiamine and tRNA 4-thiouridine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 0.77 |
| COG0193 | Peptidyl-tRNA hydrolase | Translation, ribosomal structure and biogenesis [J] | 0.77 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 73.85 % |
| Unclassified | root | N/A | 26.15 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352024|deeps__Contig_162538 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1792 | Open in IMG/M |
| 3300000956|JGI10216J12902_116979076 | Not Available | 653 | Open in IMG/M |
| 3300002916|JGI25389J43894_1040963 | Not Available | 796 | Open in IMG/M |
| 3300004016|Ga0058689_10096570 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300004019|Ga0055439_10178481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 671 | Open in IMG/M |
| 3300004114|Ga0062593_103416299 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300004183|Ga0066403_1051245 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300004463|Ga0063356_101888270 | Not Available | 900 | Open in IMG/M |
| 3300004480|Ga0062592_101579233 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300005168|Ga0066809_10070936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Arenimonas → unclassified Arenimonas → Arenimonas sp. | 812 | Open in IMG/M |
| 3300005327|Ga0070658_10190192 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1730 | Open in IMG/M |
| 3300005438|Ga0070701_10193225 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1199 | Open in IMG/M |
| 3300005440|Ga0070705_100685293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 803 | Open in IMG/M |
| 3300005456|Ga0070678_100650197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 946 | Open in IMG/M |
| 3300005459|Ga0068867_100294261 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dokdonella → Dokdonella fugitiva | 1336 | Open in IMG/M |
| 3300005535|Ga0070684_100713436 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 935 | Open in IMG/M |
| 3300005535|Ga0070684_101216692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 708 | Open in IMG/M |
| 3300005539|Ga0068853_101900031 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300005552|Ga0066701_10973555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 502 | Open in IMG/M |
| 3300005555|Ga0066692_10199557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1251 | Open in IMG/M |
| 3300005556|Ga0066707_10821133 | Not Available | 574 | Open in IMG/M |
| 3300005558|Ga0066698_10645795 | Not Available | 706 | Open in IMG/M |
| 3300005598|Ga0066706_10878402 | Not Available | 700 | Open in IMG/M |
| 3300005616|Ga0068852_100014496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 6071 | Open in IMG/M |
| 3300005617|Ga0068859_102393931 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300005841|Ga0068863_100403671 | All Organisms → cellular organisms → Bacteria | 1337 | Open in IMG/M |
| 3300005985|Ga0081539_10421073 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 554 | Open in IMG/M |
| 3300006163|Ga0070715_10645112 | Not Available | 626 | Open in IMG/M |
| 3300006186|Ga0075369_10597662 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300006865|Ga0073934_10009357 | All Organisms → cellular organisms → Bacteria | 12595 | Open in IMG/M |
| 3300006871|Ga0075434_101302922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 737 | Open in IMG/M |
| 3300006871|Ga0075434_101714400 | Not Available | 636 | Open in IMG/M |
| 3300006903|Ga0075426_11471270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 518 | Open in IMG/M |
| 3300006904|Ga0075424_100852345 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 972 | Open in IMG/M |
| 3300006918|Ga0079216_11155260 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300007004|Ga0079218_10751125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium 68-20 | 926 | Open in IMG/M |
| 3300009012|Ga0066710_102968282 | Not Available | 662 | Open in IMG/M |
| 3300009095|Ga0079224_103140655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 658 | Open in IMG/M |
| 3300010401|Ga0134121_12959957 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300011435|Ga0137426_1025301 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 21-71-4 | 1466 | Open in IMG/M |
| 3300014875|Ga0180083_1066225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 762 | Open in IMG/M |
| 3300014879|Ga0180062_1001545 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4601 | Open in IMG/M |
| 3300015256|Ga0180073_1015847 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Cucujiformia → Curculionoidea → Curculionidae → Entiminae → Celeuthetini → Syntrophus | 1335 | Open in IMG/M |
| 3300018027|Ga0184605_10392277 | Not Available | 621 | Open in IMG/M |
| 3300018053|Ga0184626_10265149 | Not Available | 718 | Open in IMG/M |
| 3300018422|Ga0190265_11813177 | Not Available | 718 | Open in IMG/M |
| 3300018432|Ga0190275_13299239 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 522 | Open in IMG/M |
| 3300018433|Ga0066667_11056451 | Not Available | 702 | Open in IMG/M |
| 3300018476|Ga0190274_13054270 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300018476|Ga0190274_13846467 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300018481|Ga0190271_11790199 | Not Available | 726 | Open in IMG/M |
| 3300018920|Ga0190273_10886927 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300020067|Ga0180109_1005279 | All Organisms → cellular organisms → Bacteria | 1323 | Open in IMG/M |
| 3300020147|Ga0196976_1084823 | Not Available | 682 | Open in IMG/M |
| 3300020192|Ga0163147_10182324 | All Organisms → cellular organisms → Bacteria | 1242 | Open in IMG/M |
| 3300020202|Ga0196964_10446274 | Not Available | 628 | Open in IMG/M |
| 3300020202|Ga0196964_10662783 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300021559|Ga0210409_10365608 | Not Available | 1295 | Open in IMG/M |
| 3300021953|Ga0213880_10115838 | Not Available | 711 | Open in IMG/M |
| 3300022209|Ga0224497_10201681 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300024056|Ga0124853_1338153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1825 | Open in IMG/M |
| 3300024330|Ga0137417_1221224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1513 | Open in IMG/M |
| 3300025310|Ga0209172_10571798 | Not Available | 509 | Open in IMG/M |
| 3300025321|Ga0207656_10225567 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 912 | Open in IMG/M |
| 3300025321|Ga0207656_10299362 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 796 | Open in IMG/M |
| 3300025708|Ga0209201_1096209 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.Bin431 | 1077 | Open in IMG/M |
| 3300025793|Ga0210065_1018476 | All Organisms → cellular organisms → Bacteria | 1303 | Open in IMG/M |
| 3300025907|Ga0207645_10870908 | Not Available | 612 | Open in IMG/M |
| 3300025909|Ga0207705_10055131 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2866 | Open in IMG/M |
| 3300025909|Ga0207705_10607612 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 850 | Open in IMG/M |
| 3300025917|Ga0207660_10243836 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1416 | Open in IMG/M |
| 3300025919|Ga0207657_10981166 | Not Available | 649 | Open in IMG/M |
| 3300025921|Ga0207652_10255218 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1581 | Open in IMG/M |
| 3300025936|Ga0207670_10632664 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300025938|Ga0207704_10271463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 1284 | Open in IMG/M |
| 3300025938|Ga0207704_11538379 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300025938|Ga0207704_11812155 | Not Available | 525 | Open in IMG/M |
| 3300025940|Ga0207691_10323478 | All Organisms → cellular organisms → Bacteria | 1322 | Open in IMG/M |
| 3300025944|Ga0207661_11661533 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 584 | Open in IMG/M |
| 3300025949|Ga0207667_10577859 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1135 | Open in IMG/M |
| 3300025972|Ga0207668_10379571 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1189 | Open in IMG/M |
| 3300025972|Ga0207668_11253552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dokdonella → Dokdonella fugitiva | 667 | Open in IMG/M |
| 3300026023|Ga0207677_11753099 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 576 | Open in IMG/M |
| 3300026088|Ga0207641_10105593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dokdonella → Dokdonella koreensis | 2488 | Open in IMG/M |
| 3300026118|Ga0207675_102439676 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 535 | Open in IMG/M |
| 3300026121|Ga0207683_11859294 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Opitutus → Opitutus terrae → Opitutus terrae PB90-1 | 551 | Open in IMG/M |
| 3300026142|Ga0207698_10530952 | Not Available | 1150 | Open in IMG/M |
| 3300026142|Ga0207698_10647464 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1046 | Open in IMG/M |
| 3300026309|Ga0209055_1199128 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300026319|Ga0209647_1161192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales | 916 | Open in IMG/M |
| 3300026326|Ga0209801_1013351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4180 | Open in IMG/M |
| 3300026548|Ga0209161_10328137 | Not Available | 703 | Open in IMG/M |
| 3300027181|Ga0208997_1002320 | Not Available | 2181 | Open in IMG/M |
| 3300027395|Ga0209996_1007209 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1445 | Open in IMG/M |
| 3300027533|Ga0208185_1000754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 11708 | Open in IMG/M |
| 3300027691|Ga0209485_1194271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 629 | Open in IMG/M |
| 3300027739|Ga0209575_10107118 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Prosthecobacter → Prosthecobacter fusiformis | 1016 | Open in IMG/M |
| 3300027754|Ga0209596_1130585 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1142 | Open in IMG/M |
| 3300027802|Ga0209476_10049888 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 2228 | Open in IMG/M |
| 3300027886|Ga0209486_11067316 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300027910|Ga0209583_10288199 | Not Available | 740 | Open in IMG/M |
| 3300027915|Ga0209069_10170063 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1095 | Open in IMG/M |
| 3300027954|Ga0209859_1035340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 832 | Open in IMG/M |
| 3300027959|Ga0209477_1162850 | Not Available | 732 | Open in IMG/M |
| (restricted) 3300028559|Ga0247831_1035704 | All Organisms → cellular organisms → Bacteria | 2887 | Open in IMG/M |
| (restricted) 3300028571|Ga0247844_1325943 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Prosthecobacter | 513 | Open in IMG/M |
| (restricted) 3300028581|Ga0247840_10032055 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 4717 | Open in IMG/M |
| (restricted) 3300028581|Ga0247840_10240043 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
| 3300028590|Ga0247823_10227583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Stappiaceae → Roseibium | 1413 | Open in IMG/M |
| 3300028599|Ga0265309_10911981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → unclassified Woeseiaceae → Woeseiaceae bacterium | 604 | Open in IMG/M |
| 3300028600|Ga0265303_11687093 | Not Available | 530 | Open in IMG/M |
| 3300031547|Ga0310887_10742103 | Not Available | 612 | Open in IMG/M |
| 3300031553|Ga0315547_1244292 | Not Available | 544 | Open in IMG/M |
| 3300031562|Ga0310886_10475497 | Not Available | 750 | Open in IMG/M |
| 3300031720|Ga0307469_10736748 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
| 3300031847|Ga0310907_10214787 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium | 927 | Open in IMG/M |
| 3300031852|Ga0307410_10051753 | All Organisms → cellular organisms → Bacteria | 2770 | Open in IMG/M |
| 3300031911|Ga0307412_10277588 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1314 | Open in IMG/M |
| 3300031943|Ga0310885_10830435 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300031965|Ga0326597_10623263 | Not Available | 1149 | Open in IMG/M |
| 3300032005|Ga0307411_10452738 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
| 3300032174|Ga0307470_11009476 | Not Available | 662 | Open in IMG/M |
| 3300032180|Ga0307471_102619969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 639 | Open in IMG/M |
| 3300032256|Ga0315271_10073558 | Not Available | 2535 | Open in IMG/M |
| 3300032829|Ga0335070_11715970 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300033412|Ga0310810_11121736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae → Tsuneonella → Tsuneonella troitsensis | 651 | Open in IMG/M |
| 3300033480|Ga0316620_10144047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1899 | Open in IMG/M |
| 3300033550|Ga0247829_10489874 | All Organisms → cellular organisms → Bacteria | 1017 | Open in IMG/M |
| 3300034094|Ga0335014_0017544 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3902 | Open in IMG/M |
| 3300034113|Ga0364937_053838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 754 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.15% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 5.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.62% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.85% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 3.85% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.85% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.08% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.08% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.08% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.08% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.08% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.31% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.31% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 2.31% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.31% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.54% |
| Sediment | Environmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment | 1.54% |
| Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 1.54% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.54% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.54% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.54% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.54% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.54% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.54% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.54% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 1.54% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.77% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.77% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.77% |
| Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat | 0.77% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.77% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.77% |
| Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 0.77% |
| Salt Marsh Sediment | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment | 0.77% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.77% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.77% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.77% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Agricultural Soil | 0.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.77% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.77% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.77% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.77% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.77% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.77% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.77% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.77% |
| Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 0.77% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 0.77% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002916 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm | Environmental | Open in IMG/M |
| 3300004016 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz | Host-Associated | Open in IMG/M |
| 3300004019 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004183 | Freshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metagenome 3_LOW4 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006186 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Host-Associated | Open in IMG/M |
| 3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009095 | Agricultural soil microbial communities from Utah to study Nitrogen management - Steer compost 2015 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011435 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT660_2 | Environmental | Open in IMG/M |
| 3300014875 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_1_16_10D | Environmental | Open in IMG/M |
| 3300014879 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT45_16_10D | Environmental | Open in IMG/M |
| 3300015256 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT333_16_10D | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300020067 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT47_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020147 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_5-13C | Environmental | Open in IMG/M |
| 3300020192 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica- Oligotrophic Lake LV.19.MP6.G1 | Environmental | Open in IMG/M |
| 3300020202 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_10 | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021953 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R07 | Environmental | Open in IMG/M |
| 3300022209 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_13 | Environmental | Open in IMG/M |
| 3300024056 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025310 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025708 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC055_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025793 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300027181 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027533 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 (SPAdes) | Environmental | Open in IMG/M |
| 3300027691 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027739 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Medium cellulose week 11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027802 | Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB14_precipitate (SPAdes) | Engineered | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027954 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300027959 | Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB14_supernatant (SPAdes) | Engineered | Open in IMG/M |
| 3300028559 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_1m | Environmental | Open in IMG/M |
| 3300028571 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch201714.5m_1 | Environmental | Open in IMG/M |
| 3300028581 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_17m | Environmental | Open in IMG/M |
| 3300028590 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day30 | Environmental | Open in IMG/M |
| 3300028599 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160524 (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300028600 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160317 (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031553 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-240 | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300034094 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Sep2000-rr0077 | Environmental | Open in IMG/M |
| 3300034113 | Sediment microbial communities from East River floodplain, Colorado, United States - 7_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| deeps_02995190 | 2199352024 | Soil | MLLTSVAVVTMMLDAVAGSAPSRRSASGTSAPETPLTA |
| JGI10216J12902_1169790761 | 3300000956 | Soil | MLTTSVAVVRKMLDAVAGSRPKRFSVSGIIAPQIPLTTHAP |
| JGI25389J43894_10409632 | 3300002916 | Grasslands Soil | MLTTSVAVVRKMLEAVAGSKPRRFSVSGTIAPEMPLAMHE |
| Ga0058689_100965701 | 3300004016 | Agave | MLATSLAVVRKMLEAVAGSAPNRFRVSGISAPAMPATVQLTVIAMNT |
| Ga0055439_101784811 | 3300004019 | Natural And Restored Wetlands | MLTMSVAVVRKMLDAVAGSVPSRRKMRGTSVPDTPLTMQATTIA |
| Ga0062593_1034162992 | 3300004114 | Soil | MLTTSVAVVRKMLEAVAGSAPSRRNVSGTSAPEMPLTTQLPIIARKTMSPRMGALGLCCMRA |
| Ga0066403_10512451 | 3300004183 | Freshwater Sediment | MLTTSVMVVRKMLDAVAGSAPRRFSTKGMLVPAMPANMQLNDIA |
| Ga0063356_1018882703 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MLATSVAVVTTMLEAVAGSAPRRFNASGTSAPEMPLMAQLPIIAA |
| Ga0062592_1015792332 | 3300004480 | Soil | MLATSVAVVRKMLDAVAGSAPRLRSVSGMSAPARPLTTQLAHI |
| Ga0066809_100709362 | 3300005168 | Soil | MLTTSVIVVRKMLEAVAGSAPRRLSSKGIAVPATPAIMQLKAIALAV |
| Ga0070658_101901921 | 3300005327 | Corn Rhizosphere | MSPMLETSVAVVTMILEAVAGSAPSFFSTSGTSAPETPERQQLPIIAIITTKP |
| Ga0070701_101932253 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MRPMLDTSVAVVTMMLEAVAGSKPSLFNAMGTSAPEMPDRQQLPIIAII |
| Ga0070705_1006852932 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MLTTSVAVVRKMLEAVAGSAPIRRKISGTTAPAMPLTTQLPVMAMSTTK |
| Ga0070678_1006501971 | 3300005456 | Miscanthus Rhizosphere | MRPMLDTSVAVVTMMLEAVAGSKPSLFNAMGTSAPEMPDRQQLPIIAIIT |
| Ga0068867_1002942612 | 3300005459 | Miscanthus Rhizosphere | MLTTSVAVVRKMLEAVAGSAPSRFSASGTAAPATPDNAQLPVIATNVIAASS |
| Ga0070684_1007134362 | 3300005535 | Corn Rhizosphere | MLTTSVAVVRKMLDAIAGSAPMRLSPSGTAAPATPLATLDSDIAVKVISAS |
| Ga0070684_1012166921 | 3300005535 | Corn Rhizosphere | MLLTSVAVVTMMLEAVAGSAPRRRSTSGTSAPETPLTAQLPIIARQTT |
| Ga0068853_1019000312 | 3300005539 | Corn Rhizosphere | MLTTSVAVVRKMLEAVAGSAPARRSIMGTTAPAMPLTRQLQVMAMSTTKP |
| Ga0066701_109735551 | 3300005552 | Soil | MLTTSVAVVRKMLEAVAGSKPRRFSVSGTIAPEMPLAMHEP |
| Ga0066692_101995571 | 3300005555 | Soil | MLTTSVAVVRKMLEAVAGSKPRRFSVSGTIAPEMP |
| Ga0066707_108211331 | 3300005556 | Soil | MLTTSVAVVRKMLEAVAGSKPRRFSVSGTIAPEMPLAMHEPIMARNTTN |
| Ga0066698_106457952 | 3300005558 | Soil | MLTTSVAVVRKMLEAVAGSKPRRFSVSGTIAPEMPLAMHEPIMARNTT |
| Ga0066706_108784022 | 3300005598 | Soil | MLTTSVAVVRKMLEAVAGSKPRRFSVSGTIAPEMPLAMHEPIMARNTTNASITGCA |
| Ga0068852_1000144961 | 3300005616 | Corn Rhizosphere | MLETSVAVVTTMLEAVAGSAPSRFSASGTTAPDTPESAQLPIIAAFTTSASLSA |
| Ga0068859_1023939311 | 3300005617 | Switchgrass Rhizosphere | MLTTSVAVVRKIDDAVAGSAPRRCSVVGTSTPEMPLITQAITI |
| Ga0068863_1004036711 | 3300005841 | Switchgrass Rhizosphere | MLTTSVAVVRKMLEAVAGSKPRRFSVSGISAPERPLAMQEKTIARKTMN |
| Ga0081539_104210731 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MLDTSVAVVRKMLDAVAGSAPNRRSASGITAPMMPLIMHAAIIAITTITP |
| Ga0070715_106451122 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MSPMLDTSVAVVTMMLDAVAGSKPSFFNTMGTRAPEMPDRQQLPIMAIITT |
| Ga0075369_105976621 | 3300006186 | Populus Endosphere | MLATSVAVVTTMLEAVAGSAPRRLSVSGTIAPEMPLIAQLPI |
| Ga0073934_100093571 | 3300006865 | Hot Spring Sediment | MLATSVAVVRKMLDAVAGSAPIFRSPSGMRAPEIPLTTQLPVMASSTTRLSMSAASNCWT |
| Ga0075434_1013029221 | 3300006871 | Populus Rhizosphere | MLTTSVAVVRKMLEAVAGSAPKRFRVRGTIAPHMP |
| Ga0075434_1017144001 | 3300006871 | Populus Rhizosphere | MLTQSVAVVRKMLDAVAGSNPIRFSATGTSTPDSPLAMHENTIA |
| Ga0075426_114712702 | 3300006903 | Populus Rhizosphere | MLTQSVAVVRKMLDAVAGSKPIRFSATGTSTPDRPLAMHDSTIAA |
| Ga0075424_1008523452 | 3300006904 | Populus Rhizosphere | MLTTSVAVVRKMLEAVAGSAPKRFRVRGTIAPHMPLA |
| Ga0079216_111552602 | 3300006918 | Agricultural Soil | MLATSVAVVRKMLDAVAGSAPILLSVIGTSAPDTPLITQLKVMAIATIAP |
| Ga0079218_107511253 | 3300007004 | Agricultural Soil | MLTTSEAVVRKMLEAVAGSAPSRRSASGTAAPAIPLATQAPIIARNTTSASD |
| Ga0066710_1029682821 | 3300009012 | Grasslands Soil | MLTMSVAVVTKMLEAVAGSAPSFFRVSGTSAPQTLLTTQLP |
| Ga0079224_1031406551 | 3300009095 | Agricultural Soil | MLATSVAVVRKMLDAVAGSAPSLRKVSGTSAPETPLTRQLV |
| Ga0134121_129599571 | 3300010401 | Terrestrial Soil | MLTTSVAVVKKMLEAVAGSAPMRRKASGTTAPEIPLTVQLAAM |
| Ga0137426_10253011 | 3300011435 | Soil | MLATSVAVVRKMLEAVAGSAPSFLSVSGTSAPETPLIMQLPIIA |
| Ga0180083_10662252 | 3300014875 | Soil | MLTTSVAVVRKMLEAVAGSKPKRFNVIGIREPQSPLMMQAPTSAIHT |
| Ga0180062_10015456 | 3300014879 | Soil | MLTTSVAVVRKMLEAVAGSKPKRFNVIGIREPQSPLMMQAPT |
| Ga0180073_10158473 | 3300015256 | Soil | MLTTSVAVVRKMLEAVAGSKPKRFNVIGIREPQSPLMMQAPTS |
| Ga0184605_103922772 | 3300018027 | Groundwater Sediment | MLTTSVAVVRKMLEAVAGSKPRRFSVSGTIAPAMPLAMHEPT |
| Ga0184626_102651491 | 3300018053 | Groundwater Sediment | MLTTSVAVVRKMLEAVAGSKPKRFSVSGTIAPEMPLAMQ |
| Ga0190265_118131773 | 3300018422 | Soil | MLATSVAVVRKMLEAVAGSAPSLRSPSGMSAPEIPLTTQLAVIAS |
| Ga0190275_132992391 | 3300018432 | Soil | MLTTSVVVVRKILEAVAGSAPKRFSVSGMRAPEIP |
| Ga0066667_110564511 | 3300018433 | Grasslands Soil | MLTTSVAVVRKMLEAVAGSKPRRFSVSGTIAPEMPLAMHEPIMARNTTNASIT |
| Ga0190274_130542701 | 3300018476 | Soil | MLATSVAVVTKMLEAVAGSAPRRLSASGTSAPETPLIAQLPIIANVTTTPRMNA |
| Ga0190274_138464672 | 3300018476 | Soil | MLATSVAVVRKMLEAVAGSAPIRRRIMGTTAPEMPLIVQLPIMARV |
| Ga0190271_117901991 | 3300018481 | Soil | MLATSVAVVTTMLEEVAGSAPRRFSASGTSAPEIPLIAQLPIIARQTTTPSITACGESCETA |
| Ga0190273_108869271 | 3300018920 | Soil | MLAMSVAVVRKMLDAVAGSAPSFRKVIGISAPEMPLMTQLP |
| Ga0180109_10052791 | 3300020067 | Groundwater Sediment | MLTTSVAVVRKILEAVAGSRPKRFNVIGIRAPHTPLVTHAPTSAAHTTR |
| Ga0196976_10848231 | 3300020147 | Soil | MLTTSVAVVRKIADAVAGSWPKRFSVSGISAPDRPLAMHAPTMAR |
| Ga0163147_101823241 | 3300020192 | Freshwater Microbial Mat | MLATSVAVVRKMLEAVAGSSPSRFSVKGIRAPERPL |
| Ga0196964_104462742 | 3300020202 | Soil | MLTTSVAVVRKMLEAVAGSKPKRFSVSGMIAPETPLAMHEAIIAR |
| Ga0196964_106627831 | 3300020202 | Soil | MLTTSVAVVRKMLDAVAGSRPKRFSVSGMMAPEMPLAMQEAIMA |
| Ga0210409_103656081 | 3300021559 | Soil | MLQQSVAVVRKMLDAVAGSAPIRRRMSGTSAPAIPLIAHDAVIANHTQRPSMTGL |
| Ga0213880_101158382 | 3300021953 | Exposed Rock | MLDTSVAVVTMMLEAVAGSAPKRFSARGTRAPETPLTQQLPII |
| Ga0224497_102016812 | 3300022209 | Sediment | MLATSVAVVRKMLDAVAGSAPMRRSVRGMSAPARPLT |
| Ga0124853_13381531 | 3300024056 | Freshwater Wetlands | MLTTSVAVVRKILEAVAGSAPKRLSVNGTMAPEIPLATQLP |
| Ga0137417_12212241 | 3300024330 | Vadose Zone Soil | MLTTSVAVVRKMLEAVAGSMLEAVAGSKPRRFSVSG |
| Ga0209172_105717982 | 3300025310 | Hot Spring Sediment | MLATSVAVVRKMLDAVAGSAPIFRSPSGMRAPEIPLTTQLPVMASATIDASA |
| Ga0207656_102255671 | 3300025321 | Corn Rhizosphere | MLTTSVAVVRKMLEAIAGSAPMRFSPSGTAAPATPLATL |
| Ga0207656_102993621 | 3300025321 | Corn Rhizosphere | MLLTSVAVVTMMLEAVAGSAPRRRSTSGTSAPETPLTAQLPIIARQTTTP |
| Ga0209201_10962092 | 3300025708 | Anaerobic Digestor Sludge | MLATSVAVVRKMLEAVAGSAPSRRSRIGTSVPKMPLTTQAPAMAARTINPSEK |
| Ga0210065_10184761 | 3300025793 | Natural And Restored Wetlands | MLTTSVAVVRKMLDAVAGSAPSFWSVIGTSTPVIPLATHAPVI |
| Ga0207645_108709081 | 3300025907 | Miscanthus Rhizosphere | MLTTSVAVVRKMLDAVAGSKPKRFSVSGMIAPEMPLAMHEEI |
| Ga0207705_100551311 | 3300025909 | Corn Rhizosphere | MSPMLETSVAVVTMILEAVAGSAPSFFSTSGTSAPETPERQQLPIIAIITTKPSINACGL |
| Ga0207705_106076122 | 3300025909 | Corn Rhizosphere | MLTTSVAVVRKMLDAIAGSAPMRFSPSGTAAPATPLATLDS |
| Ga0207660_102438363 | 3300025917 | Corn Rhizosphere | MLTTSVAVVRKMLDAVAGSRPMRFSVIGISAPHSPL |
| Ga0207657_109811662 | 3300025919 | Corn Rhizosphere | MLETSVAVVTTMLEAVAGSAPSRFSASGTTAPDTPE |
| Ga0207652_102552183 | 3300025921 | Corn Rhizosphere | MLETSVAVVTMMLEAVAGSAPRRFSAIGTSAPETPLSAQLPIIAAFTTRASLSAC |
| Ga0207670_106326643 | 3300025936 | Switchgrass Rhizosphere | MLATSVAVVTKMLEAVAGSAPMRFNASGTMAPEMPLIAQLPVIASTTTMPNIAACSDFWETASR |
| Ga0207704_102714631 | 3300025938 | Miscanthus Rhizosphere | MLTTSVAVVRKMLEAVAGSAPARRSIMGTTAPAMPLTRQL |
| Ga0207704_115383791 | 3300025938 | Miscanthus Rhizosphere | MLATSVAVVRKILEAVAGSAPSRLRARGMSAPATPLITQLAI |
| Ga0207704_118121551 | 3300025938 | Miscanthus Rhizosphere | MIVASNSSKPMLATSVAVVTKMLEAVAGSAPKRFNPSGTSAPEMPLMAQLP |
| Ga0207691_103234782 | 3300025940 | Miscanthus Rhizosphere | MLATSVAVVTKMLEAVAGSAPMRFNASGTMAPEMPLIAQLPVIASTTTMPNIAAC |
| Ga0207661_116615331 | 3300025944 | Corn Rhizosphere | MLTTSVAVVRKMLDAIAGSAPMRLSPSGTAAPATPLA |
| Ga0207667_105778593 | 3300025949 | Corn Rhizosphere | MLLTSVAVVTMMLEAVAGSAPSRRSTSGTSAPETPLTAQLPIIARQTTTPSEIAWGTSWNRASTY |
| Ga0207668_103795713 | 3300025972 | Switchgrass Rhizosphere | MLTTSVAVVRKIDEAVAGSAPSRFSVVGTSTPETPLITQAITIARSVMTASIH |
| Ga0207668_112535522 | 3300025972 | Switchgrass Rhizosphere | MLTTSVAVVRKMLEAVAGSAPSRFSASGTAAPATPDNAQLPVIAT |
| Ga0207677_117530991 | 3300026023 | Miscanthus Rhizosphere | MLTTSVAVVRKMLDAIAGSAPMRFSPSGTAAPATPLATLDSDIAAKV |
| Ga0207641_101055933 | 3300026088 | Switchgrass Rhizosphere | MLTTSVAVVRKMLDAVAGSAPSRFSPSGTAAPAMPDMAQLPAIAT |
| Ga0207675_1024396763 | 3300026118 | Switchgrass Rhizosphere | MLTVSVAVVKNMLDAIAGSAPTRLRHSGTAAPAMPLTTLLRV |
| Ga0207683_118592942 | 3300026121 | Miscanthus Rhizosphere | MLTTSVAVVRKMLDAVAGSAPRRRSPSGTAAPAMPDTAQLPAMATNVISA |
| Ga0207698_105309522 | 3300026142 | Corn Rhizosphere | MLQTSVAVVRKMLEAVAGSAPSRRRISGMSAPATPLTAHEAVIAN |
| Ga0207698_106474641 | 3300026142 | Corn Rhizosphere | MSPMLETSVAVVTMILEAVAGSAPSLFSTSGTSAPEMPDRQ |
| Ga0209055_11991281 | 3300026309 | Soil | MLTTSVAVVRKMLEAVAGSKPRRFSVSGTIAPEMPLAMHEPIM |
| Ga0209647_11611923 | 3300026319 | Grasslands Soil | MLTQSVAVVRKMLDAVAGSKPILFSVIGTSAPERPLAMH |
| Ga0209801_10133511 | 3300026326 | Soil | MLTTSVAVVRKMLEAVAGSKPRRFSVSGTIAPEMPLAMHEPIMA |
| Ga0209161_103281372 | 3300026548 | Soil | MLTTSVAVVRKMLEAVAGSKPRRFSVSGTIAPEMPLAMHEPIMARNTTNASITGC |
| Ga0208997_10023204 | 3300027181 | Forest Soil | MLTTSVAVVRKMLEAVAGSKPRRFSVSGTIAPAMPLAMHEPTMARN |
| Ga0209996_10072093 | 3300027395 | Arabidopsis Thaliana Rhizosphere | MLTTSVAVVRKMLEAVAGSAPIFLSVSGTIAPEMPLAMQ |
| Ga0208185_10007541 | 3300027533 | Soil | MLTTSVAVVRKILEAVAGSKPKRFNVIGIREPQSPLMMQAPTSAIHTTTASAM |
| Ga0209485_11942711 | 3300027691 | Agricultural Soil | MLTTSVAVVRKMLDAVAGSAPKRFSVNGTIAPHTPLATQLATSASHTTRP |
| Ga0209575_101071181 | 3300027739 | Freshwater | MLTTSVAVVRKMLEAVAGSAPSFLKVRGINAPQRPLTMQLV |
| Ga0209596_11305853 | 3300027754 | Freshwater Lake | MLATSVAVVKKILEAVQGSAPSRFKTNGMNAPERPLIM |
| Ga0209476_100498884 | 3300027802 | Activated Sludge | MLATSVAVVTMMLDAVAGSAPSRLSARGTTAPETPLTAQLPIMARQTATPSHRAWADSWE |
| Ga0209486_110673161 | 3300027886 | Agricultural Soil | MLTTSVAVVRKIDEAVAGSAPSRFSVVGTSTPETPLIMQA |
| Ga0209583_102881991 | 3300027910 | Watersheds | MLVTSVAVVTMMLDAVAGSAPKRFNASGTRAPEIPLMQQLPIIARVT |
| Ga0209069_101700633 | 3300027915 | Watersheds | MLVTSVAVVTMMLEAVAGSAPKRFNASGTRAPEIPLMQQLPT |
| Ga0209859_10353402 | 3300027954 | Groundwater Sand | MLVTSVAVVRKMLEAVAGSNPSLLSVSGIIAPEIPLA |
| Ga0209477_11628501 | 3300027959 | Activated Sludge | MLATSVAVVTMMLDAVAGSAPSRLSARGTTAPETPLTAQLPIMARQTATPSHRAWADS |
| (restricted) Ga0247831_10357041 | 3300028559 | Freshwater | MLTTSVAVVRKMLEAVAGSAPSFLRMIGMIAPETPLTEQLPTIA |
| (restricted) Ga0247844_13259431 | 3300028571 | Freshwater | MLITSVAVVRKMLDAVAGSAPKRRKIRGIKAPQRPLTTQ |
| (restricted) Ga0247840_100320554 | 3300028581 | Freshwater | MLTTSVAVVRKMLEAVAGSAPSFLRMIGMIAPETPLTEQLPTIARKTTPES |
| (restricted) Ga0247840_102400431 | 3300028581 | Freshwater | MLTMSVAVVKKILLAVAGSAPKRRSTSGIMAPQRPLMMQLAVMAMKT |
| Ga0247823_102275831 | 3300028590 | Soil | MLATSVAVVRKMLDAVAGSAPTRRSARGISAPAIPLMMQLAVIASATI |
| Ga0265309_109119812 | 3300028599 | Sediment | MLTTSVAVVRKILEAVAGSAPSLFSVKGTITPVTPLATQ |
| Ga0265303_116870932 | 3300028600 | Sediment | MLATSVAVVKKILEAVAGSAPNFFKPMGTMAPDIPLTTQLPIIAHNT |
| Ga0310887_107421031 | 3300031547 | Soil | MLTTSVAVVRKMLDAVAGSKPKRFSVSGMIAPEMPLAMHEEIM |
| Ga0315547_12442921 | 3300031553 | Salt Marsh Sediment | MLTTSVAVVRNILDAVTGSAPKRLNVRGTITPAMPLAMQAPVIASS |
| Ga0310886_104754971 | 3300031562 | Soil | MRPMLETSVAVVTMILDAVAGSAPRRFSTSGTSAPEMPERQQLPII |
| Ga0307469_107367482 | 3300031720 | Hardwood Forest Soil | MLTTSVAVVRKMLEAVAGSKPKRFSVSGTSAPDTPLATQAPTM |
| Ga0310907_102147872 | 3300031847 | Soil | MLTTSVAVVRKIDEAVAGSAPNRCSVVGTNTPEIP |
| Ga0307410_100517534 | 3300031852 | Rhizosphere | MLAMSLAVVRKMLEAVAGSAPRRLRVSGMSAPEMPATVQLATIATATT |
| Ga0307412_102775881 | 3300031911 | Rhizosphere | MLTTSVAVVRKMLDAVAGSRPKRLSVSGMMAPEMPLAM |
| Ga0310885_108304352 | 3300031943 | Soil | MLTTSVAVVRKIDEAVAGSAPSRFSVVGTSTPETPLITQAITIARRV |
| Ga0326597_106232631 | 3300031965 | Soil | MLATSVAVVTKMLDAVAGSKLNFFRVIGTNAPKIPLMTQL |
| Ga0307411_104527381 | 3300032005 | Rhizosphere | MLAMSLAVVRKILEAVAGSAPSRFKVSGMRAPEMPATVQLATMDT |
| Ga0307470_110094761 | 3300032174 | Hardwood Forest Soil | MLTQSVAVVRKMLEAVAGSKPIRFSATGTSTPESP |
| Ga0307471_1026199691 | 3300032180 | Hardwood Forest Soil | MLTMSVAVVRKMLEAVAGSAPRRLRPIGTSAPEIPLAIQLP |
| Ga0315271_100735582 | 3300032256 | Sediment | MLQTSVIVVRKILEAVAGSAPSRFSTSGMVVPAIPATMQLNDIATMVINPR |
| Ga0335070_117159701 | 3300032829 | Soil | MLATSVAVVRKMLEAVAGSNPSFFRVSGIRAPAIPLTTQLAIM |
| Ga0310810_111217363 | 3300033412 | Soil | MLATSLAVVRKMLEAVAGSAPSRFSTIGISAPAIPDTVQAMTIARKTTE |
| Ga0316620_101440471 | 3300033480 | Soil | MLTTSVAVVRKMLDAVAGSVPKRLSVSGTRAPEMPLMV |
| Ga0247829_104898741 | 3300033550 | Soil | MLATSVAVVRKMLDAVAGSAPTRRSARGISAPAIPLMMQ |
| Ga0335014_0017544_3707_3889 | 3300034094 | Freshwater | MLATSVAVVRKMLDAVAGSAPNFRKISGIVAPETPLTMQLPIIARNTINAKAKARSLDCQ |
| Ga0364937_053838_577_753 | 3300034113 | Sediment | MLTTSVAVVRKMLEAVAGSKPKRFNVIGIREPQSPLMMQAPTNAIHTTTASAMAFGLP |
| ⦗Top⦘ |