NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F062794

Metagenome / Metatranscriptome Family F062794

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F062794
Family Type Metagenome / Metatranscriptome
Number of Sequences 130
Average Sequence Length 78 residues
Representative Sequence MDTFYKPPMQRDDECKALETNYMNCMFQKALNDNVMNNRCRLDSVLWFHLECPKHAAKFDDPLEFKRKWRDFFT
Number of Associated Samples 118
Number of Associated Scaffolds 130

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 0.82 %
% of genes near scaffold ends (potentially truncated) 59.23 %
% of genes from short scaffolds (< 2000 bps) 93.85 %
Associated GOLD sequencing projects 113
AlphaFold2 3D model prediction Yes
3D model pTM-score0.71

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (93.077 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(21.538 % of family members)
Environment Ontology (ENVO) Unclassified
(60.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(52.308 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 47.06%    β-sheet: 0.00%    Coil/Unstructured: 52.94%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.71
Powered by PDBe Molstar

Structural matches with SCOPe domains

SCOP familySCOP domainRepresentative PDBTM-score
a.128.1.2: Squalene synthased3vj8a_3vj80.59352
a.51.1.1: Cytochrome c oxidase subunit hd7cohh_7coh0.57545
d.142.2.2: Adenylation domain of NAD+-dependent DNA ligased3jsla_3jsl0.57248
f.40.1.1: V-type ATP synthase subunit Cd1v9ma_1v9m0.56964
a.211.1.1: HD domaind2para_2par0.55579

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 130 Family Scaffolds
PF01176eIF-1a 1.54

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 130 Family Scaffolds
COG0361Translation initiation factor IF-1Translation, ribosomal structure and biogenesis [J] 1.54

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms93.08 %
UnclassifiedrootN/A6.92 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001355|JGI20158J14315_10133220All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae787Open in IMG/M
3300001355|JGI20158J14315_10169535All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Oxytrichinae → Oxytricha → Oxytricha trifallax648Open in IMG/M
3300002408|B570J29032_108974176All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae555Open in IMG/M
3300002835|B570J40625_101217221All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Oxytrichinae → Oxytricha → Oxytricha trifallax630Open in IMG/M
3300004777|Ga0007827_10081405All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae735Open in IMG/M
3300004788|Ga0007742_10600277All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Oxytrichinae → Oxytricha → Oxytricha trifallax555Open in IMG/M
3300004790|Ga0007758_10702553All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Oxytrichinae → Oxytricha → Oxytricha trifallax552Open in IMG/M
3300005069|Ga0071350_1029000All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella1456Open in IMG/M
3300005516|Ga0066831_10123449All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae703Open in IMG/M
3300005988|Ga0075160_10361356All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Oxytrichinae → Oxytricha → Oxytricha trifallax790Open in IMG/M
3300006037|Ga0075465_10095486All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Oxytrichinae → Oxytricha → Oxytricha trifallax656Open in IMG/M
3300006037|Ga0075465_10105939All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Oxytrichinae → Oxytricha → Oxytricha trifallax625Open in IMG/M
3300006397|Ga0075488_1452293All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae518Open in IMG/M
3300007561|Ga0102914_1216395All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Oxytrichinae → Oxytricha → Oxytricha trifallax588Open in IMG/M
3300007629|Ga0102895_1177303All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Oxytrichinae → Oxytricha → Oxytricha trifallax554Open in IMG/M
3300007725|Ga0102951_1145144All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae669Open in IMG/M
3300008928|Ga0103711_10058474All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Peniculida → Parameciidae → Paramecium → Paramecium tetraurelia562Open in IMG/M
3300008999|Ga0102816_1123680All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Oxytrichinae → Oxytricha → Oxytricha trifallax796Open in IMG/M
3300009002|Ga0102810_1131155All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae775Open in IMG/M
3300009160|Ga0114981_10595040All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Peniculida → Parameciidae → Paramecium → Paramecium tetraurelia588Open in IMG/M
3300009172|Ga0114995_10299438All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae885Open in IMG/M
3300009172|Ga0114995_10308911All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Oxytrichinae → Oxytricha → Oxytricha trifallax870Open in IMG/M
3300009432|Ga0115005_10824973All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Oxytrichinae → Oxytricha → Oxytricha trifallax747Open in IMG/M
3300009434|Ga0115562_1311413All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae538Open in IMG/M
3300009436|Ga0115008_10629964All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae774Open in IMG/M
3300009495|Ga0115571_1186786All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae853Open in IMG/M
3300009606|Ga0115102_10699639All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae558Open in IMG/M
3300009705|Ga0115000_10414304All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Oxytrichinae → Oxytricha → Oxytricha trifallax857Open in IMG/M
3300009785|Ga0115001_10400677All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae857Open in IMG/M
3300012523|Ga0129350_1184960All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae560Open in IMG/M
3300012954|Ga0163111_11142139All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Oxytrichinae → Oxytricha → Oxytricha trifallax758Open in IMG/M
3300012965|Ga0129346_1259527All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae718Open in IMG/M
3300012966|Ga0129341_1020752All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae678Open in IMG/M
3300013295|Ga0170791_10693774All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Oxytrichinae → Oxytricha → Oxytricha trifallax526Open in IMG/M
3300015360|Ga0163144_11697144All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Oxytrichinae → Oxytricha → Oxytricha trifallax541Open in IMG/M
3300017107|Ga0186524_116271All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae620Open in IMG/M
3300017210|Ga0186339_114247All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae682Open in IMG/M
3300017788|Ga0169931_10581662All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Oxytrichinae → Oxytricha → Oxytricha trifallax766Open in IMG/M
3300018739|Ga0192974_1068021All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae583Open in IMG/M
3300018739|Ga0192974_1073796All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae551Open in IMG/M
3300018770|Ga0193530_1087051All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae580Open in IMG/M
3300018874|Ga0192977_1103807All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae562Open in IMG/M
3300018903|Ga0193244_1015662All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1281Open in IMG/M
3300018961|Ga0193531_10254921All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae630Open in IMG/M
3300018980|Ga0192961_10188912All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Peniculida → Parameciidae → Paramecium → Paramecium tetraurelia621Open in IMG/M
3300018982|Ga0192947_10153439All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae768Open in IMG/M
3300018996|Ga0192916_10149154All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae699Open in IMG/M
3300019017|Ga0193569_10309261All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae650Open in IMG/M
3300019020|Ga0193538_10262529All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae553Open in IMG/M
3300019021|Ga0192982_10182934All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae743Open in IMG/M
3300019024|Ga0193535_10256551All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae540Open in IMG/M
3300019036|Ga0192945_10140262All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae776Open in IMG/M
3300019036|Ga0192945_10155726All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae736Open in IMG/M
3300019048|Ga0192981_10278362All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Peniculida → Parameciidae → Paramecium → Paramecium tetraurelia631Open in IMG/M
3300019049|Ga0193082_10791629All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae535Open in IMG/M
3300019050|Ga0192966_10181585All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae752Open in IMG/M
3300020074|Ga0194113_10721664All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Oxytrichinae → Oxytricha → Oxytricha trifallax689Open in IMG/M
3300020172|Ga0211729_10486552All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Oxytrichinae → Oxytricha → Oxytricha trifallax647Open in IMG/M
3300020183|Ga0194115_10342591All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Peniculida → Parameciidae → Paramecium → Paramecium tetraurelia664Open in IMG/M
3300020193|Ga0194131_10370938All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Oxytrichinae → Oxytricha → Oxytricha trifallax643Open in IMG/M
3300021169|Ga0206687_1115193All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Peniculida → Parameciidae → Paramecium → Paramecium tetraurelia636Open in IMG/M
3300021342|Ga0206691_1339995All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae556Open in IMG/M
3300021350|Ga0206692_1354753All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Peniculida → Parameciidae → Paramecium → Paramecium tetraurelia546Open in IMG/M
3300021889|Ga0063089_1024983All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae539Open in IMG/M
3300024343|Ga0244777_10629772All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Oxytrichinae → Oxytricha → Oxytricha trifallax647Open in IMG/M
3300024346|Ga0244775_11212012All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Peniculida → Parameciidae → Paramecium → Paramecium tetraurelia588Open in IMG/M
3300025385|Ga0207956_1019232All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae938Open in IMG/M
3300025449|Ga0208106_1070776All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Peniculida → Parameciidae → Paramecium → Paramecium tetraurelia594Open in IMG/M
3300025626|Ga0209716_1168806All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae550Open in IMG/M
3300025684|Ga0209652_1079488All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1017Open in IMG/M
3300026448|Ga0247594_1061264All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Oxytrichinae → Oxytricha → Oxytricha trifallax650Open in IMG/M
3300026465|Ga0247588_1085361All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Oxytrichinae → Oxytricha → Oxytricha trifallax629Open in IMG/M
3300027159|Ga0208020_1050609All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae775Open in IMG/M
3300027687|Ga0209710_1141647All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae885Open in IMG/M
3300027780|Ga0209502_10254131All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae779Open in IMG/M
3300027781|Ga0209175_10212538All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae825Open in IMG/M
3300027782|Ga0209500_10312911All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Oxytrichinae → Oxytricha → Oxytricha trifallax660Open in IMG/M
3300027786|Ga0209812_10149504All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Oxytrichinae → Oxytricha → Oxytricha trifallax1098Open in IMG/M
3300027791|Ga0209830_10476823All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae515Open in IMG/M
3300027883|Ga0209713_10176750All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella1444Open in IMG/M
3300027885|Ga0209450_10210456All Organisms → cellular organisms → Eukaryota1377Open in IMG/M
3300028137|Ga0256412_1254484All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Oxytrichinae → Oxytricha → Oxytricha trifallax647Open in IMG/M
3300028282|Ga0256413_1226221All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Peniculida → Parameciidae → Paramecium → Paramecium tetraurelia668Open in IMG/M
3300028335|Ga0247566_1056136All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Peniculida → Parameciidae → Paramecium → Paramecium tetraurelia656Open in IMG/M
3300030564|Ga0210256_10241901All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae603Open in IMG/M
3300030699|Ga0307398_10425986All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae729Open in IMG/M
3300030709|Ga0307400_10635891All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae666Open in IMG/M
3300030709|Ga0307400_10724961All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae617Open in IMG/M
3300030709|Ga0307400_10818541All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae574Open in IMG/M
3300030741|Ga0265459_12901983All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Oxytrichinae → Oxytricha → Oxytricha trifallax597Open in IMG/M
3300030961|Ga0151491_1019765All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae627Open in IMG/M
3300031036|Ga0073978_1609667All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae604Open in IMG/M
3300031231|Ga0170824_101264743All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Oxytrichinae → Oxytricha → Oxytricha trifallax568Open in IMG/M
3300031569|Ga0307489_10345786Not Available975Open in IMG/M
3300031717|Ga0307396_10453514All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae615Open in IMG/M
3300031725|Ga0307381_10287177All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae590Open in IMG/M
3300031734|Ga0307397_10439347All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae605Open in IMG/M
3300031734|Ga0307397_10600031All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae517Open in IMG/M
3300031737|Ga0307387_10671250All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae650Open in IMG/M
3300031738|Ga0307384_10595417All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae529Open in IMG/M
3300031739|Ga0307383_10541668All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae583Open in IMG/M
3300031750|Ga0307389_11198061All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae508Open in IMG/M
3300031752|Ga0307404_10413151All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae565Open in IMG/M
3300032463|Ga0314684_10727054All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Oxytrichinae → Oxytricha → Oxytricha trifallax569Open in IMG/M
3300032470|Ga0314670_10459886All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae666Open in IMG/M
3300032481|Ga0314668_10361406All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Oxytrichinae → Oxytricha → Oxytricha trifallax750Open in IMG/M
3300032491|Ga0314675_10447339All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Oxytrichinae → Oxytricha → Oxytricha trifallax643Open in IMG/M
3300032517|Ga0314688_10426026All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Oxytrichinae → Oxytricha → Oxytricha trifallax720Open in IMG/M
3300032518|Ga0314689_10501390All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae634Open in IMG/M
3300032520|Ga0314667_10561797All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Oxytrichinae → Oxytricha → Oxytricha trifallax632Open in IMG/M
3300032521|Ga0314680_10542427All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Oxytrichinae → Oxytricha → Oxytricha trifallax733Open in IMG/M
3300032521|Ga0314680_10929541All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Oxytrichinae → Oxytricha → Oxytricha trifallax545Open in IMG/M
3300032522|Ga0314677_10510464All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Oxytrichinae → Oxytricha → Oxytricha trifallax640Open in IMG/M
3300032540|Ga0314682_10532053All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae646Open in IMG/M
3300032615|Ga0314674_10723259All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Oxytrichinae → Oxytricha → Oxytricha trifallax500Open in IMG/M
3300032616|Ga0314671_10510101All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae654Open in IMG/M
3300032713|Ga0314690_10463929All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Oxytrichinae → Oxytricha → Oxytricha trifallax628Open in IMG/M
3300032714|Ga0314686_10534881All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae575Open in IMG/M
3300032728|Ga0314696_10660038All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae529Open in IMG/M
3300032744|Ga0314705_10447239All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae695Open in IMG/M
3300032744|Ga0314705_10592110All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae590Open in IMG/M
3300033984|Ga0334989_0440988All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Oxytrichinae → Oxytricha → Oxytricha trifallax660Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine21.54%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine15.38%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater13.85%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine6.15%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous4.62%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater3.85%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater3.85%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater3.08%
Wastewater EffluentEngineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent3.08%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake2.31%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine2.31%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater1.54%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake1.54%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.54%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.54%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.54%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine1.54%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.54%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated1.54%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.77%
Freshwater Microbial MatEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat0.77%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.77%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.77%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.77%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.77%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.77%
WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water0.77%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.77%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water0.77%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001355Pelagic Microbial community sample from North Sea - COGITO 998_met_08EnvironmentalOpen in IMG/M
3300002408Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)EnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300003475Marine microbial communities from the Indian Ocean - GS112EnvironmentalOpen in IMG/M
3300004777Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Jul07EnvironmentalOpen in IMG/M
3300004788Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004790Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005069Metagenomes from Harmful Algal Blooms in Lake Erie, HABS-E2014-0024EnvironmentalOpen in IMG/M
3300005516Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49BEnvironmentalOpen in IMG/M
3300005988Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 C2 DNAEngineeredOpen in IMG/M
3300006037Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNAEnvironmentalOpen in IMG/M
3300006397Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007561Estuarine microbial communities from the Columbia River estuary - metaG 1561A-3EnvironmentalOpen in IMG/M
3300007629Estuarine microbial communities from the Columbia River estuary - metaG 1554B-3EnvironmentalOpen in IMG/M
3300007725Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MGEnvironmentalOpen in IMG/M
3300008928Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_E3EnvironmentalOpen in IMG/M
3300008999Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545EnvironmentalOpen in IMG/M
3300009002Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573EnvironmentalOpen in IMG/M
3300009080Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759EnvironmentalOpen in IMG/M
3300009160Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaGEnvironmentalOpen in IMG/M
3300009172Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154EnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009434Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009495Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009705Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128EnvironmentalOpen in IMG/M
3300009785Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130EnvironmentalOpen in IMG/M
3300012523Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300012965Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012966Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013295northern Canada Lakes metatranscriptome co-assemblyEnvironmentalOpen in IMG/M
3300015360Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.BULKMAT1EnvironmentalOpen in IMG/M
3300017107Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in f/20 medium, no silicate, 19 C, 30 psu salinity and 446 ?mol photons light - Strombidinopsis sp. SopsisLIS2011 (MMETSP0463)Host-AssociatedOpen in IMG/M
3300017210Metatranscriptome of marine eukaryotic communities from northern Puget Sound, Washington in Ciliate medium, 15 C, 30 psu salinity and 103 ?mol photons light - Favella ehrenbergii Fehren 1 (MMETSP0123)Host-AssociatedOpen in IMG/M
3300017788Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20LEnvironmentalOpen in IMG/M
3300018423Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071413AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018739Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001019 (ERX1789514-ERR1719246)EnvironmentalOpen in IMG/M
3300018770Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002783 (ERX1789454-ERR1719490)EnvironmentalOpen in IMG/M
3300018874Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001024 (ERX1809749-ERR1740115)EnvironmentalOpen in IMG/M
3300018903Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001499 (ERX1789636-ERR1719512)EnvironmentalOpen in IMG/M
3300018961Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002783 (ERX1789414-ERR1719458)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300018996Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000839 (ERX1782178-ERR1712156)EnvironmentalOpen in IMG/M
3300019017Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002781EnvironmentalOpen in IMG/M
3300019020Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002813 (ERX1789673-ERR1719264)EnvironmentalOpen in IMG/M
3300019021Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)EnvironmentalOpen in IMG/M
3300019024Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002797 (ERX1789427-ERR1719237)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019049Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000531 (ERX1782179-ERR1712232)EnvironmentalOpen in IMG/M
3300019050Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782371-ERR1711865)EnvironmentalOpen in IMG/M
3300019150Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000616 (ERX1782105-ERR1711908)EnvironmentalOpen in IMG/M
3300020074Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200mEnvironmentalOpen in IMG/M
3300020172Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1EnvironmentalOpen in IMG/M
3300020183Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surfaceEnvironmentalOpen in IMG/M
3300020193Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015053 Kigoma Offshore 120mEnvironmentalOpen in IMG/M
3300020546Freshwater microbial communities from Lake Mendota, WI - 03OCT2011 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021336Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1073 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021342Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021889Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-3S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300025385Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Jul07 (SPAdes)EnvironmentalOpen in IMG/M
3300025449Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Jul08 (SPAdes)EnvironmentalOpen in IMG/M
3300025626Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes)EnvironmentalOpen in IMG/M
3300025684Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_74LU_5_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300026448Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 57R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026465Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 48R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027159Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573 (SPAdes)EnvironmentalOpen in IMG/M
3300027687Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes)EnvironmentalOpen in IMG/M
3300027780Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 (SPAdes)EnvironmentalOpen in IMG/M
3300027781Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 C2 DNA (SPAdes)EngineeredOpen in IMG/M
3300027782Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027786Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 7/17/14 B DNA (SPAdes)EngineeredOpen in IMG/M
3300027791Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 (SPAdes)EnvironmentalOpen in IMG/M
3300027883Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027885Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028335Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 14R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030564Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR020S0 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030699Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030709Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-17 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030741Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assemblyEnvironmentalOpen in IMG/M
3300030961Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_Q_0.2 metaT (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031036Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_X_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300031717Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-6 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031725Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031734Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031737Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031738Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031750Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031752Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-59 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032463Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032470Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032481Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032491Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032517Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032518Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032520Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032521Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032522Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032540Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032615Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032616Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032713Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_sur (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032714Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032728Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032744Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb9_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033984Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Mar2001-rr0030EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI20158J14315_1013322013300001355Pelagic MarineMDMFYKPPMQRKVECDALEKNYMNCLMQKSLKDKVFVNGCNLDSVLWFHLECPRASGXFDDPIEFKKKFRDYFANMKSVRDARQQSET*
JGI20158J14315_1016953513300001355Pelagic MarineMDMFYKPPMERKVECDALEDNYMNCLFQKSLKDKVFNNVCVLDSVLWFHLECPKASSKFDDPVEFKKKFRDFFA*
B570J29032_10897417613300002408FreshwaterPDECRALEINYMNCLMQKALKDKVTTNRCVMDSILWFHLECPKAAAKFDDPIEFKRKFRNFFTQ*
B570J40625_10121722123300002835FreshwaterMDIFYKPPLQRPDECRALEINYMNCLMQKALKDKVTTNRCVMDSILWFHLECPKAAAKFDDPIEFKRKFRNFFTQ*
INDIC_182292923300003475MarineMQRRTECKALEDNYMNCLFQKTLGDKVFVNRCVMDSILWFHLECPRAAAKFDDPTEFKRKFRDFFAHNKSIADAVKVKSAAQQRIKSKFGF*
Ga0007827_1008140523300004777FreshwaterMDTFYKPPLQRKVECDSLEDNYINCLFQKTLKDKVFNNRCILDSVLWFHLECPKRAGEFDDPIEFKKKFRDFFAHNKSIAEAVR*
Ga0007742_1060027723300004788Freshwater LakeFYKPPLQRLDECRALEINYINCLMQKALKDKVVTNRCVMDSILWFHLECPKAAAKFDDPIEFKRKFRNFFT*
Ga0007758_1070255323300004790Freshwater LakeDLFYKPPLQRLDECRALEINYINCLMQKALKDKVVTNRCVMDSILWFHLECPKAAAKFDDPIEFKRKFRNFFT*
Ga0071350_102900023300005069FreshwaterMDFFYKPPSQRPDECEALEENYINCLLQKSLKDRVFTNKCVMDSILWFHLECPRHVQAFDDPNTFKLKFRDFFAHQKHDAQILYEKPEHMEKLR*
Ga0066831_1012344923300005516MarineMDLFYKPPLQRPTECKALEDNYMLSFQKALKDKVTVNRCVLDSVLWFHLECPKAAGKFDDPVEFKRKFRDFFAHNKSIAD*
Ga0075160_1027461223300005988Wastewater EffluentMDLFYKPPLQRFDECYGLEENYMNCLFQKALKDRTMSNVCVLDSILWFHLECPKAASKFDDPIAFKRKIHDFIATQKSQREGIESVSADFRKLEK*
Ga0075160_1036135613300005988Wastewater EffluentMDLFYKPPLQRFDECYGLEENYVNCLFQKALKDKVDKDLCILDSILWFHLECPKAAAKFDDPVEFKRKVHDFLAL*
Ga0075465_1009548623300006037AqueousMNIFYKPPLQRGDECEALEDNYMNCLVQKALKDRVLTNKCVLDSILWFHLECPKAAAKFDD*
Ga0075465_1010593923300006037AqueousMDLFYKPPLQRLDECRALEINYINCLMQKALKDKVVTNRCVMDSILWFHLECPKAAAKFDDPIEFKRKFRNFFT*
Ga0075488_145229323300006397AqueousNMDMFYKPPMQRKVECDALEKNYMNCLMQKSLKDKVFVNGCNLDSVLWFHLECPRASGQFDDPIEFKKKFRDYFANMKSVRDARQQSET*
Ga0102914_121639513300007561EstuarineLINKMDLFYKPPLQRLDECRALEINYINCLMQKALKDKVVTNRCVMDSILWFHLECPKAAAKFDDPIEFKRKFRNFFT*
Ga0102895_117730323300007629EstuarineMDFFYKSPMQRPDECKALEENYMNCLLQKALKDRVFNNKCVLDSVLWFHLECPKSVQAFDDPNTF
Ga0102951_114514423300007725WaterMDTFYKPPKQRATECKSLEDNYINCLMQKALKDNVVTNRCVLDSILWFHVECPRWADKFDDPVEFKKKFRDFFARNKSIYDNATA*
Ga0103711_1005847413300008928Ocean WaterDQFYKPPLQREDECTVLEQNYMNCLLQKALKDRVQNNRCVLENLLWFHLECPNRIAGFDDKFEFKRKFRTFFAA*
Ga0102816_112368013300008999EstuarineMDLFYKPALQRPDECRALEENYMNCLMQKSLKDKVMNNRCVMDSILWFHMECPKEVAKFDDPIEFKRKWRNFFAQTKA
Ga0102810_113115513300009002EstuarineMDIFYRPPAQRMDECKVLEENYMNCMLQKAMKDKVFVNQCVLDSVLWFHLECPRAAGRFDDPVEFKRKWRDFFSLRKSMIDNTKLTAT*
Ga0102815_1084251113300009080EstuarineMDTFYKPPMQRATECKALEDNYMNCLFQKSLKDKVIVNRCVLDSVLWFHLECPRAASKFDDPIEFKKKFRDFFASNKSIAEASRYRSDTQRRIKK*
Ga0114981_1059504013300009160Freshwater LakeILSLMDLFYKPPLQRPDECKALEENYINCLMQKSLKDRVLTNRCVMDSLLWFHLECPKDAAKFDDPLEFKRKFRNFFAL*
Ga0114995_1029943813300009172MarineMDTFYKPPMQRGDECKSLEANYMNCMLQKAMNDNVINNRCYLDNVLWYHLECPHAAAKFDDPIEFKRKWRDFFQ*
Ga0114995_1030891113300009172MarineMDTFYKPPMQRDDECKALETNYMNCMFQKALNDNVMNNRCRLDSVLWFHLECPKHAAKFDDPLEFKRKWRDFFT*
Ga0115005_1082497313300009432MarineMDTFYKPPMQRNSECKALEDNYMNCLFQKALKDNVMVNRCMLDSVLWFHVECPKASAKFDDPVEFKKKFRDFFA*
Ga0115562_131141323300009434Pelagic MarineMDQFFKPPLQRPDECATLEENYINCLLQKALKDRVKNNRCVLDSVLWFHLECPRAAAAFDDKFEFKRKFREFFAVQKSYKQHSTPDAEMLRVKEEQSHL*
Ga0115008_1062996413300009436MarineMDTFYKPPQSRNTECRALDENYMNCLFQKALNDKVVVNRCVLDSVLWFHLECPKWAKKYDDPTEFKRKWRDFFSQIKSTHEATN*
Ga0115571_118678613300009495Pelagic MarineMDTFYKPPMQRSDECNSLEANYMNCMLQKAMNDNVINNRCYLDNVLWYHLECPQAAAKFDDPIEFKRKWRDFFQ*
Ga0115102_1069963933300009606MarineRQRTVECRALEENYMNCMMQKSLKDKVFVNGCFLDSVLWFHLECPRAASKFDDPVEFKRKWRDFFAANKAVLEANEQRMPSQKRI*
Ga0115000_1041430413300009705MarineMDTFYKPPMQRDDECRALEGNYMNCLLQKALNDNVMNNRCRLDSILWFHLECPKHAAKFDDPLEFKRKWRDFFT*
Ga0115001_1040067713300009785MarineMDTFYKPPMQKDDECRALEGNYMNCLLQKALNDNVMNNRCRLDSILWFHLECPKHAAKFDDPLEFKRKWRDFFT*
Ga0129350_118496013300012523AqueousRNSECKALEDNYMNCLFQKALKDNVMVNRCVLDSVLWFHVECPKASAKFDDPVEFKKKFRDFFA*
Ga0163111_1114213913300012954Surface SeawaterMDTFYKPPMQRHSECKALEDNYMNCLFQKALKDKVLVNRCMLDSVLWFHVECPKASAKFDDPVEFKKKFRDFFA*
Ga0129346_125952733300012965AqueousVIMDFFYKPPLERWDECAALEENYTNCLFQKAVKDKVFTNKCVLDSILWFKLECPKTHSKWDDPGYFKSKIRDFMAHQRHNA*
Ga0129341_102075213300012966AqueousMDFFYKPPLERWDECAALEENYTNCLFQKAVKDKVFTNKCVLDSILWFKLECPKTHSKWDDPGYFKSKIRDFMAHQRHNA*
Ga0170791_1069377413300013295FreshwaterDIFYKPPLQRPDECRALEENYMNCLMQKALKDKVLTNKCVMDSLLWFHLECPKAAAKFDDPLEFKRKFRNFFAL*
Ga0163144_1169714413300015360Freshwater Microbial MatMDLFYKPPMERFDECSSLEENYMNCLFQKALRDRVMNNRCNMDSILWFHLECPKASSKFDDPNAFKRKVREFIAETKT*
Ga0186524_11627113300017107Host-AssociatedYKPPLQDPKESSNLEENYMNCLMQKALKDHVLTNKCVLDSILWYHVECPKEVAKFDDPIEFKRKWRDFLGQQKHTYDLLFNKSDEHK
Ga0186339_11424723300017210Host-AssociatedMDFFYKPPVQRPDECAALEENYINCLMQKALKDRVMNNKCVLDSILWFHLECPKAAAKFDDPDIFKMKFRDFFAHQKLDAQILY
Ga0169931_1058166223300017788FreshwaterMDLFYKPPLQRPDECSALEENYMNCLLQKAMRDRVLTNRCVMDSILWFHLECPKAAAKFDDPL
Ga0181593_1068342313300018423Salt MarshPKTPKPQTSEIESTLTYSIIINMDTFYKPPMQRRVECASLEDNYMNCLFQKALSDKVFVNRCVLDSILWFHLECPRAAAKFDDPVEFKKKFRDFFSHNKSIADASK
Ga0192974_106802123300018739MarineMDQFYKPPLQRPDECATLEENYINCLLQKALKDKVQSNRCVLDSILWFHIECPRAAAQFDDKFEFKRKFREFFAVQKSYK
Ga0192974_107379613300018739MarineMDFFYKPPVQRPDECAALEENYVNCLMQKALKDRVMNNKCVLDSILWFHLECPKAAGAFDDAAAFKLKFRDFFAH
Ga0193530_108705113300018770MarineFFYKPPVQRADECAALEENYINCMLQKALKDRVMTNRCVMDSILWFHLECPKAIAAFDDPDTFKMKFRDFFAH
Ga0192977_110380713300018874MarineFYKPPLQRPDECATLEENYINCLLQKALKDKVQSNRCVLDSILWFHIECPRAAAQFDDKFEFKRKFREFFAVQKSYK
Ga0193244_101566223300018903MarineMDFFYKPPIERPDECEVLERNYMNCMLQKAMKDRVYNNRCNMESILWFHLECPKHKDKFDDPAEFKIKWRDFFA
Ga0193531_1025492113300018961MarineMDFFYKPPVQRADECAALEENYINCMLQKALKDRVMTNRCVMDSILWFHLECPKAIAAFDDPDTFKMKFRDFFAH
Ga0192961_1018891213300018980MarineMDMFYKPPMERKVECDALEDNYINCLFQKSLKDKVFTNQCVLDSVLWFHLECPKASSKFDDPVEFKKKFRDFFAQNKSL
Ga0192947_1015343933300018982MarineHGNYLINFQKTMDTFYKPPMQRDDECKALEMNYMNCMLQKALNDKVMNNRCRLDSVLWYHLECPKHAAKFDDPLEFKRKWRDFFT
Ga0192916_1014915433300018996MarineMGIKVKLINMDFFYKPPVQRPDECAALEENYINCMLQKALKDRVLTNRCVMDSILWFHLECPKAVAAFDDPDTFKMKFRDFFAH
Ga0193569_1030926123300019017MarineKEMDFFYKPPSERPDECHELEKNYMTCLLQKAMKDRVMTNKCNMDSILWFHLECPQRSGQFDDEDTFKLKFRDLFAQNKLD
Ga0193538_1026252913300019020MarineECAALEENYINCMLQKALKDRVMTNRCVMDSILWFHLECPKAIAAFDDPDTFKMKFRDFFAH
Ga0192982_1018293413300019021MarineTWGIICLYLFYRLMDTFYKPPTQKDSECRVLEENYMNCMFQKALNDKVIVNRCVLDSVLWFHLECPKRASAFDDPIEFKRKWRDFFS
Ga0193535_1025655123300019024MarineFYKPPVQRADECAALEENYINCMLQKALKDRVMTNRCVMDSILWFHLECPKAIAAFDDPDTFKMKFRDFFAH
Ga0192945_1014026213300019036MarineHGDKYNYLINFQKTMDTFYKPPMQRDDECKALEMNYMNCMLQKALNDKVMNNRCRLDSVLWYHLECPKHAAKFDDPLEFKRKWRDFFT
Ga0192945_1015572613300019036MarineTWDNYLFIFVYRLMDTFYKPPTQKDSECRVLEENYMNCMFQKALNDKVIVNRCVLDSVLWFHLECPKRASAFDDPIEFKRKWRDFFS
Ga0192981_1027836213300019048MarineNMDMFYKPPMERKVECDALEDNYINCLFQKSLKDKVFSNQCVLDSVLWFHLECPKASSKFDDPVEFKKKFRDFFAQNKSM
Ga0193082_1079162913300019049MarineMDFFYKPPVQRPEECRILEENYMNCMLQKALRDRVFNNRCVMDSILWFHLECPKARDKFDDPVEFRIKWRDFFA
Ga0192966_1018158513300019050MarineTWGIFICLYLFYRLMDTFYKPPTQKDSECRVLEENYMNCMFQKALNDKVIVNRCVLDSVLWFHLECPKRASAFDDPIEFKRKWRDFFS
Ga0194244_1011323413300019150MarineHGDNNMDTFYKPPMQRRTECRALEDNYMNCLFQKALNDKVFVNRCVLDSVLWFHLECPRAAAKFDDPVEFKRKFRDFFAHNKSIADAVKTKTATS
Ga0194113_1072166413300020074Freshwater LakeMDIFYKPPLQRPDECKALEENYINCLMQKALKDRVLSNKCVMDSLLWFHLECPKEAAKFDDPLEFKRKFRNFFAL
Ga0211729_1048655223300020172FreshwaterMDLFYKPPLQRLDECRALEINYINCLIQKALKDKVVTNRCVMDSILWFHLECPKAAAKFDDPIEFKRKFRNLFT
Ga0194115_1034259113300020183Freshwater LakeMDLFNKPPLMRPDECKALEENYMNCLLQKSMKDKVMTNRCVLDSVLWFHLECPKDVAKFDDPLEFKRKWRNFFASTKAAAEMLLIEDQET
Ga0194131_1037093813300020193Freshwater LakeMDLFYKPPLQRLDECKALEINYINCLMQKALKDKVVTNRCVMDSILWFHLECPKAAAKFDDPIEFKRKFRNFFT
Ga0208853_105262413300020546FreshwaterMDYFYAPPLQRDDECAALEDNYMNCLMQKALKDKVFVNKCVLDSVLFFPLECPKWHAKFDDPTEFKLKWKKFIAETKSFAQTILPIDEKQ
Ga0206687_111519313300021169SeawaterMDMFYKPPMERKVECDALEDNYINCLFQKSLKDKVFSNQCVLDSVLWFHLECPKASSKFDDPVEFKKKFRDFFA
Ga0210307_141105713300021336EstuarineMDTFYKPPMQRATECKALEDNYMNCLFQKSLKDKVIVNRCVLDSVLWFHLECPRAASKFDDPIEFKKKFRDFFASNKSIAEASRYRSDTQRRIKK
Ga0206691_133999523300021342SeawaterYKPPQQRKIECKALEENYINCMLQKALKDKVYVNHCVLDSVLWFHVECPRAASQFDDPIEFKKKFRDFFATNKSLMDNWSQKT
Ga0206691_183312013300021342SeawaterLMDIFYKPPQQRADECKSLEDNYINCLMQKTLKDKVFVNRCVLDSVLWFHLECPRAAGKFDDPVEFKRKFRDFFAHNTSVNDASQPTASRKRIDA
Ga0206692_135475313300021350SeawaterMDMFYKPPMERKVECDALEDNYINCLFQKSLKDKVFSNQCVLDSVLWFHLECPKASSKFDDPVEFKKKFRDFFAQNKSM
Ga0063089_102498313300021889MarineMDQFFKPPLQRPDECATLEENYINCLLQKALKDRVKNNRCVLDSVLWFHLECPRAAAAFDDKFEFKRKFREFFAVQKSYKQHSTPDAEMLRVKEEQSHL
Ga0244777_1062977213300024343EstuarineMDLFYKPPLQRLDECRALEINYINCLMQKALKDKVVTNRCVMDSILWFHLECPKAAAKFDDPIEFKRKFRNFFT
Ga0244775_1121201213300024346EstuarineMDIFYKPPVQRLDECKVLEENYINCLLQKSLKDRVYVNRCVLDSVLWFQVECPRAFGKFDDPVEFKRKFRDFFA
Ga0207956_101923223300025385FreshwaterMDTFYKPPLQRKVECDSLEDNYINCLFQKTLKDKVFNNRCILDSVLWFHLECPKRAGEFDDPIEFKKKFRDFFAHNKSIAEAVR
Ga0208106_107077613300025449FreshwaterFYKPPLQRKVECDSLEDNYINCLFQKTLKDKVFNNRCILDSVLWFHLECPKRAGEFDDPIEFKKKFRDFFAHNKSIAEAVR
Ga0209716_116880623300025626Pelagic MarineMDTFYKPPMQRSDECNSLEANYMNCMLQKAMNDNVINNRCYLDNVLWYHLECPQAAAKFDDPIEFKRKWRDFFQ
Ga0209652_107948823300025684MarineMDFFYKPPLERWDECAALEENYTNCLFQKAVKDKVFTNKCVLDSILWFKLECPKTHSKWDDPAYFKSKIRDFFAHQRHTA
Ga0247594_106126413300026448SeawaterKLTNMDMFYKPPMERKVECDALEDNYINCLFQKSLKDKVFSNQCVLDSVLWFHLECPKASSKFDDPVEFKKKFRDFFAQNKSM
Ga0247588_108536113300026465SeawaterLTNMDMFYKPPMERKVECDALEDNYINCLFQKSLKDKVFSSQCVLDSVLWFHLECPKASSKFDDPVEFKKKFRDFFAHNKSM
Ga0208020_105060913300027159EstuarineMDIFYRPPAQRMDECKVLEENYMNCMLQKAMKDKVFVNQCVLDSVLWFHLECPRAAGRFDDPVEFKRKWRDFFSLRKSMIDNTKLTAT
Ga0209710_114164713300027687MarineMDTFYKPPMQRGDECKSLEANYMNCMLQKAMNDNVINNRCYLDNVLWYHLECPHAAAKFDDPIEFKRKWRDFFQ
Ga0209502_1025413113300027780MarinePPMQRGDECKSLEANYMNCMLQKAMNDNVINNRCYLDNVLWYHLECPHAAAKFDDPIEFKRKWRDFFQ
Ga0209175_1021253823300027781Wastewater EffluentMDLFYKPPLQRFDECYGLEENYMNCLFQKALKDRTMSNVCVLDSILWFHLECPKAASKFDDPIAFKRKIHDFIATQKSQREGIESVSADFRKLEK
Ga0209500_1031291123300027782Freshwater LakePKTPKPLGVSSSIIISLMDLFYKPPLQRPDECKALEDNYMNCLMQKALKDRVLTNRCVMDSLLWFHLECPKDSAKFDDPLEFKRKFRNFFAL
Ga0209812_1014950423300027786Wastewater EffluentMDLFYKPPLQRFDECYGLEENYVNCLFQKALKDKVDKDLCILDSILWFHLECPKAAAKFDDPVEFKRKVHDFLAL
Ga0209830_1047682313300027791MarineTFYKPPMQRDDECRALEGNYMNCLLQKALNDNVMNNRCRLDSILWFHLECPKHAAKFDDPLEFKRKWRDFFT
Ga0209713_1017675033300027883MarineMDFFYKPPVERPDECQALEDNYMNCLVQKSLKDHVMNNRCVLDSILWFHLECPKSAENFDDPQLFKVKFRDYFANLKEDAQLLYEKPEHMERLK
Ga0209450_1021045613300027885Freshwater Lake SedimentMDFFYKPPSQRPDECEALEENYINCLLQKSLKDRVFTNKCVMDSILWFHLECPRHVQAFDDPNTFKLKFRDFFAHQKHDAQILYEKPEHMEKLR
Ga0256412_125448413300028137SeawaterLTNMDMFYKPPMERKVECDALEDNYINCLFQKSLKDKVFSNQCVLDSVLWFHLECPKASSKFDDPVEFKKKFRDFFAQNKSM
Ga0256413_122622113300028282SeawaterMFYKPPMERKVECDALEDNYINCLFQKSLKDKVFSNQCVLDSVLWFHLECPKASSKFDDPVEFKKKFRDFFAQNKSM
Ga0247566_105613613300028335SeawaterKSKLTNMDMFYKPPMERKVECDALEDNYINCLFQKSLKDKVFSNQCVLDSVLWFHLECPKASSKFDDPVEFKKKFRDFFAQNKSM
Ga0210256_1024190113300030564SoilLQRNDECILLDENYMNCLIQKAMRDRVKVNRCVLDSVLWFHLECPKYVAKYDDPLEFRRKFRNLFATLRYDKEIFIDQTEE
Ga0307398_1042598613300030699MarineNFQKTMDTFYKPPMQRDDECKALEMNYMNCMLQKALNDKVMNNRCRLDSVLWYHLECPKHAAKFDDPLEFKRKWRDFFT
Ga0307400_1063589123300030709MarineFYVPPLERPDECKALEENYMNCLMQKAMKDKVFTNRCVMDSLLWFHLECPKASQKFDDPVEFKRKFRNFFAYQRASAELMMS
Ga0307400_1072496123300030709MarineDTFYKPPMQRDDECKALEANYMNCMLQKALNDNVMNNRCRLDSVLWFHLECPKHAAKFDDPLEFKRKWRDFFT
Ga0307400_1081854113300030709MarineQFYKPPLQRPDECATLEENYINCLLQKALKDKVQSNRCVLDSILWFHIECPRAAAQFDDKFEFKRKFREFFAVQKSYK
Ga0265459_1290198313300030741SoilMDLFYKPPLQRPDECGALEENYINCLLQKAMRDRVLVNRCNMDSILWFHLECPKHISKFDNPLEFKIKFRDFLAEMRTSREVLLQ
Ga0151491_101976513300030961MarineLTKMDYFYQAPSQRPKECNRLEENYMNCLVQKAMKDRVVTNKCVLDSILWFHVECPTYVAKFDDPAQFRAKVRDFFAW
Ga0073978_160966713300031036MarineTKMDYFYQAPSQRPKECNRLEENYMNCLVQKAMKDRVVTNKCVLDSILWFHVECPTYVAKFDDPAQFRAKVRDFFAW
Ga0170824_10126474313300031231Forest SoilFYKPPLQREDECGALEENYINCLMQKALRDRVVINRCNMDSVLWFHLECPRAVAKFDNPIEFKKKFRDTFAIIR
Ga0307489_1034578623300031569Sackhole BrineMDFFYKPPMQRPDECEALEENYINCMLQKSLKDRVFNNKCVMDSILWFHLECPRHVQAFDDP
Ga0307396_1045351413300031717MarineKPPTQKDSECRVLEENYMNCMFQKALNDKVIVNRCVLDSVLWFHLECPKRASAFDDPIEIKRKWRDFFS
Ga0307381_1028717713300031725MarineTMDTFYKPPMQRDDECKALEMNYMNCMLQKALNDKVMNNRCRLDSVLWYHLECPKHAAKFDDPLEFKRKWRDFFT
Ga0307397_1043934713300031734MarineKTMDTFYKPPMQRDDECKALEMNYMNCMLQKALNDKVMNNRCRLDSVLWYHLECPKHAAKFDDPLEFKRKWRDFFT
Ga0307397_1060003123300031734MarineLMDTFYKPPTQKDSECRVLEENYMNCMFQKALNDKVIVNRCVLDSVLWFHLECPKRASAFDDPIEFKRKWRDFFSQNKSIADAFRTQSKSS
Ga0307387_1067125013300031737MarineDTFYKPPMQRDDECKALEMNYMNCMLQKALNDKVMNNRCRLDSVLWYHLECPKHAAKFDDPLEFKRKWRDFFT
Ga0307384_1059541713300031738MarineFFKPPLQRATECGTLEENYMNCMLQKALKDKVFTNKCVMDSILWFHVECPRSVAAFDDPAEFKRKWRGFFALQKSY
Ga0307383_1054166813300031739MarineMDTFYKPPMQRDDECKALEMNYMNCMLQKALNDKVMNNRCRLDSVLWYHLECPKHAAKFDDPLEFKRKWRDFFT
Ga0307389_1119806113300031750MarineTFYKPPMQRDDECKALEMNYMNCMLQKALNDKVMNNRCRLDSVLWYHLECPKHAAKFDDPLEFKRKWRDFFT
Ga0307404_1041315123300031752MarineQKDSECRVLEENYMNCMFQKALNDKVIVNRCVLDSVLWFHLECPKRASAFDDPIEFKRKWRDFFS
Ga0314684_1072705413300032463SeawaterMDTFYKPPMQRNSECKALEDNYMNCLFQKALKDNVMVNRCMLDSVLWFHVECPKASAKFDDPVEFKKKFRDFFA
Ga0314670_1045988613300032470SeawaterRDDECKALETNYMNCMFQKALNDNVMNNRCRLDSVLWFHLECPKHAAKFDDPLEFKRKWRDFFT
Ga0314668_1036140613300032481SeawaterMDTFYKPPMQRDDECKALETNYMNCMFQKALNDNVMNNRCRLDSVLWFHLECPKHAAKFDDPLEFKRKWRDFFT
Ga0314675_1044733923300032491SeawaterDTFYKPPMQRDDECKALETNYMNCMFQKALNDNVMNNRCRLDSVLWFHLECPKHAAKFDDPLEFKRKWRDFFT
Ga0314688_1042602613300032517SeawaterTMDTFYKPPMQRDDECKALETNYMNCMFQKALNDNVMNNRCRLDSVLWFHLECPKHAAKFDDPLEFKRKWRDFFT
Ga0314689_1050139023300032518SeawaterFYKPPMQRDDECKALETNYMNCMFQKALNDNVMNNRCRLDSVLWFHLECPKHAAKFDDPLEFKRKWRDFFT
Ga0314667_1056179713300032520SeawaterKTMDTFYKPPMQRDDECKALETNYMNCMFQKALNDNVMNNRCRLDSVLWFHLECPKHAAKFDDPLEFKRKWRDFFT
Ga0314680_1054242713300032521SeawaterLQKTMDTFYKPPMQRDDECKALETNYMNCMFQKALNDNVMNNRCRLDSVLWFHLECPKHAAKFDDPLEFKRKWRDFFT
Ga0314680_1092954113300032521SeawaterTFYKPPMQRNSECKALEDNYMNCLFQKALKDNVMVNRCMLDSVLWFHVECPKASAKFDDPVEFKKKFRDFFA
Ga0314677_1051046413300032522SeawaterTMDTFYKPPMQRNSECKALEDNYMNCLFQKALKDNVMVNRCMLDSVLWFHVECPKASAKFDDPVEFKKKFRDFFA
Ga0314682_1053205313300032540SeawaterTMDTFYKPPMQRSDECNSLEANYMNCMLQKAMNDNVINNRCYLDNVLWYHLECPQAAAKFDDPIEFKRKWRDFFQ
Ga0314674_1072325923300032615SeawaterDTFYKPPMQRNSECKALEDNYMNCLFQKALKDNVMVNRCMLDSVLWFHVECPKASAKFDDPVEFKKKFRDFFA
Ga0314671_1051010113300032616SeawaterDTFYKPPMQRSDECNSLEANYMNCMLQKAMNDNVINNRCYLDNVLWYHLECPQAAAKFDDPIEFKRKWRDFFQ
Ga0314690_1046392913300032713SeawaterFYKPPMQRNSECKALEDNYMNCLFQKALKDNVMVNRCMLDSVLWFHVECPKASAKFDDPVEFKKKFRDFFA
Ga0314686_1053488113300032714SeawaterPPMQRNSECKALEDNYMNCLFQKALKDNVMVNRCMLDSVLWFHVECPKASAKFDDPVEFKKKFRDFFA
Ga0314696_1066003813300032728SeawaterTFYKPPMQRDDECKALETNYMNCMFQKALNDNVMNNRCRLDSVLWFHLECPKHAAKFDDPLEFKRKWRDFFT
Ga0314705_1044723923300032744SeawaterDECKALETNYMNCMFQKALNDNVMNNRCRLDSVLWFHLECPKHAAKFDDPLEFKRKWRDFFT
Ga0314705_1059211013300032744SeawaterMQRNSECKALEDNYMNCLFQKALKDNVMVNRCMLDSVLWFHVECPKASAKFDDPVEFKKKFRDFFA
Ga0334989_0440988_381_6083300033984FreshwaterMDLFYKPPLQRPDECKALEDNYMNCLMQKALKDRVLTNRCVMDSLLWFHLECPKDSAKFDDPLEFKRKFRNFFAL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.