 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F060973 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 132 |
| Average Sequence Length | 39 residues |
| Representative Sequence | VSNAKYLSILDEIKKKGGSLDGGEPNDKVLIIDGLNTFI |
| Number of Associated Samples | 120 |
| Number of Associated Scaffolds | 132 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 79.55 % |
| % of genes near scaffold ends (potentially truncated) | 99.24 % |
| % of genes from short scaffolds (< 2000 bps) | 95.45 % |
| Associated GOLD sequencing projects | 114 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.28 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (88.636 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (28.030 % of family members) |
| Environment Ontology (ENVO) | Unclassified (81.061 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (86.364 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.30% β-sheet: 0.00% Coil/Unstructured: 59.70% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.28 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 132 Family Scaffolds |
|---|---|---|
| PF00154 | RecA | 96.97 |
| PF01341 | Glyco_hydro_6 | 0.76 |
| PF01011 | PQQ | 0.76 |
| COG ID | Name | Functional Category | % Frequency in 132 Family Scaffolds |
|---|---|---|---|
| COG0468 | RecA/RadA recombinase | Replication, recombination and repair [L] | 96.97 |
| COG5297 | Cellulase/cellobiase CelA1 | Carbohydrate transport and metabolism [G] | 0.76 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 88.64 % |
| All Organisms | root | All Organisms | 11.36 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 28.03% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 11.36% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 9.85% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 6.82% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 4.55% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 3.79% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 3.79% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 3.79% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 3.03% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 3.03% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 3.03% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 2.27% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 2.27% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 2.27% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 1.52% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 1.52% |
| Marine Oceanic | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Oceanic | 0.76% |
| Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 0.76% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.76% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.76% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.76% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 0.76% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.76% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.76% |
| Hydrothermal Vent Fluids | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Fluids | 0.76% |
| Diffuse Vent Fluid, Hydrothermal Vents | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Vent Fluid, Hydrothermal Vents | 0.76% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.76% |
| Ocean Water | Environmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water | 0.76% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000147 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 54 02/08/11 150m | Environmental | Open in IMG/M |
| 3300000226 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 34 06/16/09 135m | Environmental | Open in IMG/M |
| 3300000247 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2009 P26 500m | Environmental | Open in IMG/M |
| 3300001354 | Pelagic Microbial community sample from North Sea - COGITO 998_met_05 | Environmental | Open in IMG/M |
| 3300001967 | Marine microbial communities from Devil's Crown, Floreana Island, Equador - GS027 | Environmental | Open in IMG/M |
| 3300002231 | Marine sediment microbial communities from Santorini caldera mats, Greece - red mat | Environmental | Open in IMG/M |
| 3300002484 | Marine viral communities from the Pacific Ocean - ETNP_2_130 | Environmental | Open in IMG/M |
| 3300002514 | Marine viral communities from the Pacific Ocean - ETNP_6_85 | Environmental | Open in IMG/M |
| 3300005402 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV73 | Environmental | Open in IMG/M |
| 3300005514 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV263 | Environmental | Open in IMG/M |
| 3300005521 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV255 | Environmental | Open in IMG/M |
| 3300005603 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV61 | Environmental | Open in IMG/M |
| 3300006024 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_DCM_ad_63m_LV_B | Environmental | Open in IMG/M |
| 3300006093 | Marine microbial communities from the Eastern Tropical South Pacific Oxygen Minumum Zone, cruise NBP1315, 2013 - sample NBP189 | Environmental | Open in IMG/M |
| 3300006311 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_1_1000m | Environmental | Open in IMG/M |
| 3300006336 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_2_0500m | Environmental | Open in IMG/M |
| 3300006339 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_3_0500m | Environmental | Open in IMG/M |
| 3300006718 | Marine microbial communities from the Deep Atlantic Ocean - MP0747 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006738 | Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006900 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_Bottom_ad_5009_LV_A | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006926 | Marine viral communities from the Subarctic Pacific Ocean - 18_ETSP_OMZAT15316 metaG | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300007160 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_1000m | Environmental | Open in IMG/M |
| 3300007777 | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS918_NRZ_DNA CLC_assembly | Environmental | Open in IMG/M |
| 3300008050 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG | Environmental | Open in IMG/M |
| 3300008216 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_Geostar | Environmental | Open in IMG/M |
| 3300008627 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 247m, 2.7-0.2um | Environmental | Open in IMG/M |
| 3300008956 | Marine microbial communities from eastern North Pacific Ocean - P8 free-living McLane | Environmental | Open in IMG/M |
| 3300009058 | Estuarine microbial communities from the Columbia River estuary - metaG 1370A-02 | Environmental | Open in IMG/M |
| 3300009173 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 | Environmental | Open in IMG/M |
| 3300009375 | Combined Assembly of Gp0137073, Gp0137074 | Environmental | Open in IMG/M |
| 3300009378 | Combined Assembly of Gp0137076, Gp0137077 | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009425 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 | Environmental | Open in IMG/M |
| 3300009428 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009496 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 | Environmental | Open in IMG/M |
| 3300009622 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3321_4155 | Environmental | Open in IMG/M |
| 3300009703 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaG | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010151 | Marine viral communities from the Subarctic Pacific Ocean - 22_ETSP_OMZ_AT15343 metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300011252 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_4, permeate | Environmental | Open in IMG/M |
| 3300017703 | Marine viral communities from the Subarctic Pacific Ocean - ?Lowphox_02 viral metaG | Environmental | Open in IMG/M |
| 3300017710 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28 | Environmental | Open in IMG/M |
| 3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
| 3300017724 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17 | Environmental | Open in IMG/M |
| 3300017726 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 | Environmental | Open in IMG/M |
| 3300017730 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13 | Environmental | Open in IMG/M |
| 3300017740 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13 | Environmental | Open in IMG/M |
| 3300017742 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21 | Environmental | Open in IMG/M |
| 3300017743 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17 | Environmental | Open in IMG/M |
| 3300017744 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23 | Environmental | Open in IMG/M |
| 3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
| 3300017748 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21 | Environmental | Open in IMG/M |
| 3300017767 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 | Environmental | Open in IMG/M |
| 3300017771 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13 | Environmental | Open in IMG/M |
| 3300017818 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018876 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020169 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160419_1 | Environmental | Open in IMG/M |
| 3300020249 | Marine microbial communities from Tara Oceans - TARA_B100000482 (ERX556038-ERR599056) | Environmental | Open in IMG/M |
| 3300020312 | Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX556125-ERR598977) | Environmental | Open in IMG/M |
| 3300020373 | Marine microbial communities from Tara Oceans - TARA_B100000959 (ERX555949-ERR598946) | Environmental | Open in IMG/M |
| 3300020377 | Marine microbial communities from Tara Oceans - TARA_B100000927 (ERX556007-ERR599065) | Environmental | Open in IMG/M |
| 3300020378 | Marine microbial communities from Tara Oceans - TARA_B100000066 (ERX556006-ERR599102) | Environmental | Open in IMG/M |
| 3300020400 | Marine microbial communities from Tara Oceans - TARA_B100001115 (ERX555947-ERR598992) | Environmental | Open in IMG/M |
| 3300020414 | Marine microbial communities from Tara Oceans - TARA_B100000035 (ERX556019-ERR599028) | Environmental | Open in IMG/M |
| 3300020436 | Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020452 | Marine microbial communities from Tara Oceans - TARA_B100001173 (ERX556054-ERR599078) | Environmental | Open in IMG/M |
| 3300020456 | Marine microbial communities from Tara Oceans - TARA_B100001741 (ERX555984-ERR599123) | Environmental | Open in IMG/M |
| 3300020470 | Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX555976-ERR599053) | Environmental | Open in IMG/M |
| 3300020472 | Marine microbial communities from Tara Oceans - TARA_B100001250 (ERX556017-ERR598995) | Environmental | Open in IMG/M |
| 3300020478 | Marine microbial communities from Tara Oceans - TARA_B100000029 (ERX556025-ERR599111) | Environmental | Open in IMG/M |
| 3300021364 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304 | Environmental | Open in IMG/M |
| 3300021443 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 12015 | Environmental | Open in IMG/M |
| 3300021791 | Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Daikoku_FS921 150_kmer | Environmental | Open in IMG/M |
| 3300022227 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014_SV_150_PacBio MetaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300022912 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_150_MG | Environmental | Open in IMG/M |
| 3300022931 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_100_MG | Environmental | Open in IMG/M |
| 3300024255 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_10_MG | Environmental | Open in IMG/M |
| 3300024344 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025084 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025099 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025141 | Marine viral communities from the Pacific Ocean - ETNP_6_85 (SPAdes) | Environmental | Open in IMG/M |
| 3300025286 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_215 (SPAdes) | Environmental | Open in IMG/M |
| 3300025458 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_110m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025709 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S4LV_130m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025776 | Marine microbial communities from the Deep Pacific Ocean - MP2097 (SPAdes) | Environmental | Open in IMG/M |
| 3300025886 | Pelagic Microbial community sample from North Sea - COGITO 998_met_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300026209 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV65 (SPAdes) | Environmental | Open in IMG/M |
| 3300026253 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_Bottom_ad_5009_LV_A (SPAdes) | Environmental | Open in IMG/M |
| 3300026263 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV255 (SPAdes) | Environmental | Open in IMG/M |
| 3300026267 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV259 (SPAdes) | Environmental | Open in IMG/M |
| 3300027553 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_04_M0_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300027779 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300027788 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 (SPAdes) | Environmental | Open in IMG/M |
| 3300027839 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_86 (SPAdes) | Environmental | Open in IMG/M |
| 3300027906 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300028008 | Seawater microbial communities from Monterey Bay, California, United States - 1D_r | Environmental | Open in IMG/M |
| 3300028132 | Seawater microbial communities from Monterey Bay, California, United States - 61D | Environmental | Open in IMG/M |
| 3300028190 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_1000m | Environmental | Open in IMG/M |
| 3300028192 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_500m | Environmental | Open in IMG/M |
| 3300028197 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_10m | Environmental | Open in IMG/M |
| 3300028277 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_120m | Environmental | Open in IMG/M |
| 3300028489 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_1000m | Environmental | Open in IMG/M |
| 3300031143 | Marine microbial communities from water near the shore, Antarctic Ocean - #422 | Environmental | Open in IMG/M |
| 3300031757 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 32315 | Environmental | Open in IMG/M |
| 3300031803 | Marine microbial communities from Western Arctic Ocean, Canada - CB27_AW_983 | Environmental | Open in IMG/M |
| 3300032130 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 34915 | Environmental | Open in IMG/M |
| 3300032278 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-500_MG | Environmental | Open in IMG/M |
| 3300032360 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 34915 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2011_101210322 | 3300000115 | Marine | VTNARYLSILEEIKNKGGKLDSEEPDDKVLIIDGLNTFIRC |
| SI54feb11_150mDRAFT_10144712 | 3300000147 | Marine | LSNKRYLSILDEIKKHGGEEGNTENPNENILLVDGLNLFIRCFSVIP |
| SI34jun09_135mDRAFT_10098995 | 3300000226 | Marine | MNNRYFXILEEIKKKGGKLDDGHFNDKVLIIDGLN |
| LPaug09P26500mDRAFT_10364041 | 3300000247 | Marine | MDNDRYISILNEITKHGGEIDSGKPDDKVLIIDGLNTFIRVF |
| JGI20155J14468_101540932 | 3300001354 | Pelagic Marine | VSNKKYLSIFEEIKKKGGSLDDGNPNDKVLLIDGLNTFIR |
| GOS2242_10010291 | 3300001967 | Marine | MSKSRYISILNEIKKNGGDSYSNNPNEKVLIIDGLNTFIRV |
| KVRMV2_1018438831 | 3300002231 | Marine Sediment | VSNGKYLSILDEIKKKGGSLDGGEPNDKVLVIDGL |
| JGI25129J35166_10930371 | 3300002484 | Marine | MSNDKYLSILEEIKKHGGGSDITKNPNEKVLIIDGLNTFIRVFS |
| JGI25133J35611_100100161 | 3300002514 | Marine | VSNAKYXSIFEEIKKKGGSLDGGEPNDKVLIIDGLNTFIR |
| Ga0066855_100841301 | 3300005402 | Marine | MSNGKYLSILDEIKKHGGGSDITKNPNEKVLIIDGLNTFIRVFS |
| Ga0066866_101684961 | 3300005514 | Marine | MSNDKYLSILDEIKKHGGDVDSTNPNEKVLIIDGLNT |
| Ga0066862_100590573 | 3300005521 | Marine | VSNEKYLSILEEIKKKGGSLDSGEPNDKVLIIDGLNTFIR |
| Ga0066853_101818882 | 3300005603 | Marine | MSNEKYLSILDEIKKHGGGSDITKNPNEKVLIIDGLN |
| Ga0066371_100868561 | 3300006024 | Marine | MSKSRYISILNEIKKNGGDSYSNNPNEKVLIIDGLN |
| Ga0082019_10756952 | 3300006093 | Marine | MPNDRYISILEEIKRKGGQVDNGEPNDKVLIIDGLNTFIRV |
| Ga0068478_10253902 | 3300006311 | Marine | MANARYLSILEEIKNKGGNLDAGEPDDKVLIIDGLNTFIRCFSAI |
| Ga0068502_12093061 | 3300006336 | Marine | MSNGKYLSILDEIKKHGGGSDITKNPNEKVLMLIFV |
| Ga0068502_15034981 | 3300006336 | Marine | MNNGKYLSILDEIKKHGGDVDSTNPNEKILIIDGLNTFIRVLSVIP |
| Ga0068502_16891481 | 3300006336 | Marine | RVWMANARYLSILEEIKNKGGQLDSGEPDDKVLIIDGLTL* |
| Ga0068481_15176582 | 3300006339 | Marine | MSNGKYLSILDEIKKHGGDVDSTNPNEKILIIDGLN |
| Ga0005504_12734251 | 3300006718 | Deep Ocean | MGNDRYLSILDEIKKSGGGSDITKNPNDKVLIIDG |
| Ga0098035_12102931 | 3300006738 | Marine | VSNAKYLSIFEEIKKKGGSLDGGEPNDKVLIIDGLNTF |
| Ga0098054_12937861 | 3300006789 | Marine | VSNAKYLSILDEIKKNGGSIDGGEPNDKVLIIDGLNTF |
| Ga0066376_104780501 | 3300006900 | Marine | VTNARYLSILEEIKNKGGKLDSDEPDDKVLIIDGLNTFIRC |
| Ga0070748_10982392 | 3300006920 | Aqueous | VTNARYLSILDEIKKKGGELDSEEPDDKVLIIDGLNTFIR |
| Ga0098057_10235883 | 3300006926 | Marine | VTNARYLSILEEIKKKGGNLDEGEPDDKVLIIDGL |
| Ga0098036_11825691 | 3300006929 | Marine | VTNAKYLSILEEIKNKGGKLDSGEPDDKVLIIDGLNTFIRCFS |
| Ga0099959_10832411 | 3300007160 | Marine | MSNDRYLSILDEIKKHGGGSDITKNPNEKVLIIDG |
| Ga0105711_11225391 | 3300007777 | Diffuse Vent Fluid, Hydrothermal Vents | MGNDRYLSILDEIKKHGGGSDITKNPNDKVLIIDG* |
| Ga0098052_12765702 | 3300008050 | Marine | VSNAKYLSILDEIKKNGGSIDGGEPNDKVLIIDGLN |
| Ga0114898_11569322 | 3300008216 | Deep Ocean | MPNDRYISILEEIKRKGGQVDNGEPNDKVLIIDGLNT |
| Ga0115656_12222891 | 3300008627 | Marine | MSNAKYLSIFEEIKKKGGSVDFDNPDKKVLIVDGL |
| Ga0104261_10156332 | 3300008956 | Ocean Water | VTNARYLSILEEIKKNGGKLDSDEPDDKVLIIDGLN |
| Ga0102854_11980071 | 3300009058 | Estuarine | VTNARYLSILEEIKKNGGKLDSDEPDDKVLIIDGLNTFIR |
| Ga0114996_103351912 | 3300009173 | Marine | MINGKYLSILDEIKKHGGDVDSTNPNEKVLIIDGLNTFIRVF |
| Ga0118721_11031392 | 3300009375 | Marine | MNDRYVSILEQIKKQGGKLDDGHFNDKVLIIDGLNTFI |
| Ga0118726_10621091 | 3300009378 | Marine | VSNEKYLSILDEIKKKGGSLDSGEPNDKVLIIDGLNTFIR |
| Ga0114994_102818132 | 3300009420 | Marine | MSNARYLSILNEIKKKGGSVNFQKKNKKVLIVDGLN |
| Ga0114997_102425342 | 3300009425 | Marine | VLNNGKYLSILDEIKKHGGKTDTTNPNEKVLIIDGLN |
| Ga0114915_11262782 | 3300009428 | Deep Ocean | MLVSNKKYLSILDEIKKKGGSLDDGNPNDKVLIIDGLN |
| Ga0114932_102342792 | 3300009481 | Deep Subsurface | VSNAKYLSILDEIKKNGGSIDGGEPNDKVLIIDGLNTFI |
| Ga0114932_102899272 | 3300009481 | Deep Subsurface | VTNAKYLSILEQIKNDGGQVEHNNPDDKILIIDGLN |
| Ga0115570_104963501 | 3300009496 | Pelagic Marine | VSNSKYLSIFEEIKKKGGSLDGGNPNDKVLIIDGLNTF |
| Ga0105173_10582682 | 3300009622 | Marine Oceanic | VSNGKYLSILEEIKKKGGTLDGGKPNDKVLIVDGLN |
| Ga0114933_105823451 | 3300009703 | Deep Subsurface | MLVSNKKYLSILDNIKKDKRSLGDGNPNDKVLVIDGLNTF |
| Ga0115012_106037781 | 3300009790 | Marine | MKKEYLSILEEIKKNGGKDNLGELNDKVLIIDGLNT |
| Ga0098043_12253002 | 3300010148 | Marine | MSKGRYLSILDEIKKHGGDSYSNNPNEKVLIIDGLNTFIRVF |
| Ga0098056_11965991 | 3300010150 | Marine | VSNAKYLSILEEIKKQGGKLDSEEPDDKVLIIDGL |
| Ga0098061_12895842 | 3300010151 | Marine | VTNARYLSILEEIKNKGGKLDSEEPDDKILIIDGL |
| Ga0098061_12970631 | 3300010151 | Marine | MSNEKYLSILDEIKKHGGGSDITKNPNEKVLIIDGLNTFIRVFS |
| Ga0098059_12268401 | 3300010153 | Marine | VSNEKYLSILEEIKKKGGSLDSGEPNDKVLIIDGLNT |
| Ga0151674_10413571 | 3300011252 | Marine | VSNAKYLSILDEIKKNGGSIDGGEPNDKVLIIDGLNTFIRV |
| Ga0181367_10246472 | 3300017703 | Marine | VTNARYLSILEEIKKKGGNLDAGEPDDKVLIIDGLNTFIRCFSAI |
| Ga0181403_10715191 | 3300017710 | Seawater | MSNARYLSILNEIKKKGGSVNFQKKNKKVLIVDGLNTFIR |
| Ga0181390_11248991 | 3300017719 | Seawater | VSNKKYLSIFEEIKKKGGSLDDGNPNDKVLLIDGLN |
| Ga0181388_10990601 | 3300017724 | Seawater | VTNARYLSILEEIKKNGGNTESENPDDKVLVIDGLNTFIRCFSA |
| Ga0181381_11190042 | 3300017726 | Seawater | VTNAKYLSILEEIKQKGGDSASETANDKVLIIDGLNTFIRCFSAI |
| Ga0181417_11797482 | 3300017730 | Seawater | VTNARYLSILDEIKKKGGKLDSEEPDDKVLIIDGLNTFIRCFSA |
| Ga0181418_10227773 | 3300017740 | Seawater | VTNAKYLSILEEIKQKGGDSASETANDKVLIIDGLNTFIRCF |
| Ga0181399_11210601 | 3300017742 | Seawater | VTNAKYLSILEEIKQKGGDSASETANDKVLIIDGLNTFIRCFS |
| Ga0181402_10570141 | 3300017743 | Seawater | VSNKKYLSIFEEIKKKGGSLDDGNPNDKVLIIDGL |
| Ga0181397_11826432 | 3300017744 | Seawater | VTNARYLSILDEIKKKGGELDSEEPDDKVLIIDGLNTFIRCF |
| Ga0181389_11267392 | 3300017746 | Seawater | VTNARYLSILEEIKKNGGNTESENPDDKVLVIDGLNTFI |
| Ga0181393_11732401 | 3300017748 | Seawater | VTTNARYLSILDEIKKKGGSTESENPDDKVLVIDGLNTFIRCF |
| Ga0181406_12299982 | 3300017767 | Seawater | VTNARYLSILDEIKKKGGELDSEEPDDKVLIIDGLN |
| Ga0181425_10587001 | 3300017771 | Seawater | VTNAKYLSILEEIKQKGGDSASETANDKVLIIDGLNTFIRCFSA |
| Ga0181565_105245592 | 3300017818 | Salt Marsh | MRWSVSNGKYLSILQEIKKKGGELDSEEPNDKVLIIDGLNTF |
| Ga0181563_103167611 | 3300018420 | Salt Marsh | MRWSVSNGKYLSILQEIKKKGGELDSEEPNDKVLIIDGLNTFIRC |
| Ga0181564_106480332 | 3300018876 | Salt Marsh | MRYSVSNAKYLSILEEIKKKGGSTESENPDDKVLVIDGLNTFIRCF |
| Ga0206127_11050492 | 3300020169 | Seawater | VSNSKYLSIFEEIKKKGGSLDGGNPNDKVLIIDGLN |
| Ga0211635_10319511 | 3300020249 | Marine | MSNARYLSILNEIKKKGGSVNFQNTNKKVLIVDGLN |
| Ga0211542_10119201 | 3300020312 | Marine | VSNSKYLSILEEIKKKGGELDSEGPDDKVLIIDGLNTFIRCF |
| Ga0211542_10220931 | 3300020312 | Marine | MSNAKYLSILEEIKNKGGKLDSEEPDDKVLIIDGLNTFIRCF |
| Ga0211660_102803821 | 3300020373 | Marine | VSNGKYLSIFEEIKKKGGSLDGGKPNDKVLIIDGLNTFIRVF |
| Ga0211647_102888272 | 3300020377 | Marine | VSNKRYLSIFEEIKKKGGSLDGGEPNDKVLIIDGLNTFIR |
| Ga0211527_101512731 | 3300020378 | Marine | VSNSKYLSILEEIKKKGGELDSEGPDDKVLIIDGLNTFIRCFSA |
| Ga0211636_103155621 | 3300020400 | Marine | VSKSKYLSIFEEIKNKGGSLDGGEPNDKVLIIDGLNTFI |
| Ga0211523_101562401 | 3300020414 | Marine | VSNAKYLSILDEIKKKGGSLDGGEPNDKVLIIDGLNTFI |
| Ga0211708_100704252 | 3300020436 | Marine | VSNGKYLSILEEIKNKGGKLDSEEPNDKVLIIDGLNTFI |
| Ga0211576_103850812 | 3300020438 | Marine | VTNARYLSILEEIKKNGGKLDSDEPDDKVLIIDGLNTFIRCF |
| Ga0211545_105223412 | 3300020452 | Marine | MNNGKYLSILDEIKKHGGKTNTSNPNEKVLIIDGLNTFI |
| Ga0211551_106238002 | 3300020456 | Marine | VSNAKYLSILDEIKKKGGSLDGGEPNDKVLIIDGLN |
| Ga0211543_103870971 | 3300020470 | Marine | VTNARYLSILDEIKKKGGSTESDNPDDKVLIIDGLNTFIR |
| Ga0211579_107460472 | 3300020472 | Marine | VSNAKYLSILDEIKKKGGSLDGGEPNDKVLIIDGLNTFIRVF |
| Ga0211503_107394552 | 3300020478 | Marine | MSNAKYLSILEEIKNKGGKLDSEEPDDKVLIIDGLN |
| Ga0213859_103959372 | 3300021364 | Seawater | VSNAKYLSILEEIKKKGGSTESENPDDKVLVIDGLNTFIRCFSA |
| Ga0206681_101617171 | 3300021443 | Seawater | VSNGKYLSIFEEIKKKGGSLDGGKPNDKVLLIDGL |
| Ga0206681_102930151 | 3300021443 | Seawater | MSNDRYLSILDEIKKSGGGSDITKNPNEKVLIIDGL |
| Ga0226832_102421141 | 3300021791 | Hydrothermal Vent Fluids | MSNEKYLSILDEIKKHGGGSDITKNPNEKVLIIDGLNTFIRV |
| Ga0187827_105662641 | 3300022227 | Seawater | VSNARYLSIFEEIKKKGGSLDGGEPNDKVLLIDGLNTFIRV |
| (restricted) Ga0233430_10132031 | 3300022912 | Seawater | MNNRYFSILEEIKKKGGKLDDGHFNDKVLIIDGLNTF |
| (restricted) Ga0233433_100075868 | 3300022931 | Seawater | MNNRYFSILEEIKKKGGKLDDGHFNDKVLIIDGLNTFIRVF |
| (restricted) Ga0233438_101348712 | 3300024255 | Seawater | VSNSKYLSIFDEIKKKGGSLDDGEPNDKVLIIDGLN |
| Ga0209992_103164041 | 3300024344 | Deep Subsurface | VTNAKYLSILEQIKNDGGQVEHNNPDDKILIIDGLNTF |
| Ga0208298_10380101 | 3300025084 | Marine | VKNKYLSILDEIKKKGGSLDDGKPDDKVLIVDGLNTFLRV |
| Ga0208669_11207932 | 3300025099 | Marine | VTNARYLSILEEIKNKGGKLDSEEPDDKILIIDGLNT |
| Ga0209535_11662252 | 3300025120 | Marine | VSNKKYLSIFEEIKKKGGSLDDGNPNDKVLLIDGLNTFIRV |
| Ga0209348_10723602 | 3300025127 | Marine | VSNKRYLSIFEEIKKKGGSLDGGDPNDKVLIIDGLNTF |
| Ga0209756_11369042 | 3300025141 | Marine | MSNDKYLSILDEIKKHGGDVDSTNPNEKVLIIDGLNTFIRV |
| Ga0208315_11235281 | 3300025286 | Deep Ocean | MSNGKYLSILDEIKKHGGGSDITKNPNEKVLIIDGLNTFIRV |
| Ga0209559_10949481 | 3300025458 | Marine | LNNGKYLSILDEIKKHGGKTDTTNPNEKVLIIDGLNTF |
| Ga0209044_11264841 | 3300025709 | Marine | VSNEKYLSIFEEIKKKGGSLDDGKPNDKVLIIDGLNTF |
| Ga0208699_10022506 | 3300025776 | Deep Ocean | MDNDRYISILNEIRKHGGEIDSGKPDDKVLIIDGLNTFIR |
| Ga0209632_101972222 | 3300025886 | Pelagic Marine | VSNKKYLSIFEEIKKKGGSLDDGNPNDKVLLIDGL |
| Ga0207989_10656652 | 3300026209 | Marine | MSNDRYLSILEEIKKHGGDVDREPNDKVLIIDGLNTFI |
| Ga0208879_12539952 | 3300026253 | Marine | MSNDRYLSILDEIKKHGGGSDITKNPNDKVLIIDGLNTFIRV |
| Ga0207992_11736942 | 3300026263 | Marine | MSNDKYLSILDEIKKHGGDVDSTNPNEKVLIIDGLNTF |
| Ga0208278_10769392 | 3300026267 | Marine | MNRKYLSIFEEIKSKGGKINGREPNDKVLIVDGLNTFI |
| Ga0208947_10476861 | 3300027553 | Marine | MSNARYLSILNEIKKKGGSVDFQNTNKKVLIVDGL |
| Ga0209709_101733102 | 3300027779 | Marine | VLNNGKYLSILDEIKKHGGKTDTTNPNEKVLIIDGLNTF |
| Ga0209711_104335461 | 3300027788 | Marine | VSNSKYLSILDEIKKKGGSLDDGNPNDKVLIIDGLNTF |
| Ga0209403_104403932 | 3300027839 | Marine | VTNARYLSILEEIKKKGGNLDEGEPDDKVLIIDGLNTFIRCF |
| Ga0209404_103918481 | 3300027906 | Marine | VTNARYLSILEEIKNKGGKLDSEEPDDKILIIDGLNTFIRCFS |
| Ga0228674_11360831 | 3300028008 | Seawater | VTNARYLSILDEIKKKGGELDSEEPDDKVLIIDGLNTFIRCFSAI |
| Ga0228649_11304102 | 3300028132 | Seawater | VTNAKYLSILEEIKQKGGDSASETANDKVLIIDGLNTFIRCFSAIP |
| Ga0257108_11252601 | 3300028190 | Marine | VSNGKYLSIFEEIKKKGGSLDGGKPNDKVLIIDGL |
| Ga0257108_11411292 | 3300028190 | Marine | MANARYLSILEEIKNKGGNLDAGEPDDKVLIIDGLNTFIRCFSAIPTL |
| Ga0257108_11942581 | 3300028190 | Marine | MSNGRYISILEEIKKHGGEENREPNDKVLIIDGLNTFI |
| Ga0257108_12073072 | 3300028190 | Marine | VSNARYLSIFEEIKKKGGSLDGGEPNDRVLIIDGLNTFIRVF |
| Ga0257107_11427052 | 3300028192 | Marine | VINDKYLSILNQIKKDGGLVEHNNPNDKVLIIDGLNTFIRVFSVVPITNDDGA |
| Ga0257107_11731511 | 3300028192 | Marine | MDKRYVSILDEIKKKGGSLDGGHFNDKVLIVDGLNTFIRVFS |
| Ga0257110_10559453 | 3300028197 | Marine | MSNARYLSILNEIKKKGGSVNFQKKNKKVLIVDGLNT |
| Ga0257116_10734362 | 3300028277 | Marine | VINDKYLSILNQIKKDGGLVEHNNPDDKVLIIDGLNT |
| Ga0257112_100534851 | 3300028489 | Marine | MNKRYVSILEEIKKKGGSLDGGHFNDKVLIVDGLNTFIRVF |
| Ga0308025_11457461 | 3300031143 | Marine | VSNAKYLSIFEEIKKNGGSIDAGEPNDKVLIIDGL |
| Ga0315328_106928051 | 3300031757 | Seawater | MDKRYVSILEEIKKKGGSLDGGHFNDKVLIVDGLNT |
| Ga0310120_100766721 | 3300031803 | Marine | MKWSVMSNDRYLSILDEIKKSGGGSDITKNPNEKVLIIDGL |
| Ga0315333_102679992 | 3300032130 | Seawater | VSNAKYLSILEEIKKKGGSLDSGEPNDKVLIIDGLNTFIRV |
| Ga0310345_109187061 | 3300032278 | Seawater | MNNRYFSILEEIKKKGGKLDDGHFNDKVLIIDGLNTFIR |
| Ga0310345_122278902 | 3300032278 | Seawater | MSNDRYLSILDEIKKHGGGSDITKNPNEKVLIIDGLNTFI |
| Ga0310345_124226852 | 3300032278 | Seawater | MSNEKYLSILDEIKKHGGGSDITKNPNEKVLIIDGLNTFIR |
| Ga0315334_110619091 | 3300032360 | Seawater | MANARYLSILEEIKNKGGNLDAGEPDDKVLIIDGLNTFIRCF |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |