NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F060338

Metagenome / Metatranscriptome Family F060338

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F060338
Family Type Metagenome / Metatranscriptome
Number of Sequences 133
Average Sequence Length 64 residues
Representative Sequence MLYTPLEQFQIILLFSIKLFCFDFSITNLALVNFLVLFFFGAIIFLFSSNENYLKETSFFFIPST
Number of Associated Samples 103
Number of Associated Scaffolds 133

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 2.26 %
% of genes near scaffold ends (potentially truncated) 66.17 %
% of genes from short scaffolds (< 2000 bps) 71.43 %
Associated GOLD sequencing projects 98
AlphaFold2 3D model prediction Yes
3D model pTM-score0.45

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (56.391 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine
(31.579 % of family members)
Environment Ontology (ENVO) Unclassified
(33.083 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(72.180 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 52.69%    β-sheet: 0.00%    Coil/Unstructured: 47.31%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.45
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 133 Family Scaffolds
PF00119ATP-synt_A 67.67
PF00507Oxidored_q4 2.26
PF00499Oxidored_q3 1.50
PF00662Proton_antipo_N 0.75
PF00361Proton_antipo_M 0.75
PF00510COX3 0.75
PF00346Complex1_49kDa 0.75
PF10588NADH-G_4Fe-4S_3 0.75
PF00115COX1 0.75
PF00203Ribosomal_S19 0.75

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 133 Family Scaffolds
COG0356FoF1-type ATP synthase, membrane subunit aEnergy production and conversion [C] 67.67
COG0838NADH:ubiquinone oxidoreductase subunit 3 (chain A)Energy production and conversion [C] 2.26
COG0839NADH:ubiquinone oxidoreductase subunit 6 (chain J)Energy production and conversion [C] 1.50
COG1009Membrane H+-translocase/NADH:ubiquinone oxidoreductase subunit 5 (chain L)/Multisubunit Na+/H+ antiporter, MnhA subunitEnergy production and conversion [C] 1.50
COG0185Ribosomal protein S19Translation, ribosomal structure and biogenesis [J] 0.75
COG0649NADH:ubiquinone oxidoreductase 49 kD subunit (chain D)Energy production and conversion [C] 0.75
COG1845Heme/copper-type cytochrome/quinol oxidase, subunit 3Energy production and conversion [C] 0.75
COG3261Ni,Fe-hydrogenase III large subunitEnergy production and conversion [C] 0.75


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms91.73 %
UnclassifiedrootN/A8.27 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2199352003|2199758386All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli828Open in IMG/M
3300001273|B570J13893_100964All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli2432Open in IMG/M
3300001282|B570J14230_10045075All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli1489Open in IMG/M
3300002404|B570J29591_1000398All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta4937Open in IMG/M
3300003677|Ga0008458J53046_108570All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae743Open in IMG/M
3300003682|Ga0008456_1019320All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli816Open in IMG/M
3300004097|Ga0055584_102318653All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Eupodiscales → Odontellaceae → Odontella → Odontella aurita545Open in IMG/M
3300004282|Ga0066599_100687882Not Available701Open in IMG/M
3300005525|Ga0068877_10006540Not Available8878Open in IMG/M
3300006165|Ga0075443_10000072All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta38320Open in IMG/M
3300006484|Ga0070744_10004604Not Available4130Open in IMG/M
3300006870|Ga0075479_10046095All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Eupodiscales → Odontellaceae → Odontella → Odontella aurita1867Open in IMG/M
3300007232|Ga0075183_10072658All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Eupodiscales → Odontellaceae → Odontella → Odontella aurita2042Open in IMG/M
3300007321|Ga0102692_1596167All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli721Open in IMG/M
3300007550|Ga0102880_1187388All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli541Open in IMG/M
3300007557|Ga0102821_1039139Not Available1245Open in IMG/M
3300007585|Ga0102916_1005505All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli2878Open in IMG/M
3300007623|Ga0102948_1026962All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Eupodiscales → Odontellaceae → Odontella → Odontella aurita1906Open in IMG/M
3300007636|Ga0102856_1000730Not Available3798Open in IMG/M
3300007681|Ga0102824_1134293All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli650Open in IMG/M
3300007860|Ga0105735_1145501Not Available525Open in IMG/M
3300007955|Ga0105740_1006121All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli1448Open in IMG/M
3300007981|Ga0102904_1069142All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Eupodiscales → Odontellaceae → Odontella → Odontella aurita812Open in IMG/M
3300008114|Ga0114347_1071328All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli1414Open in IMG/M
3300008119|Ga0114354_1010421All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Eupodiscales → Odontellaceae → Odontella → Odontella aurita6310Open in IMG/M
3300008119|Ga0114354_1023022All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Eupodiscales → Odontellaceae → Odontella → Odontella aurita2803Open in IMG/M
3300008119|Ga0114354_1036539All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli2156Open in IMG/M
3300008121|Ga0114356_1037968All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta3967Open in IMG/M
3300008259|Ga0114841_1009556Not Available5198Open in IMG/M
3300008958|Ga0104259_1036695All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Eupodiscales → Odontellaceae → Odontella → Odontella aurita521Open in IMG/M
3300008996|Ga0102831_1271702All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Eupodiscales → Odontellaceae → Odontella → Odontella aurita559Open in IMG/M
3300009026|Ga0102829_1065188All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Eupodiscales → Odontellaceae → Odontella → Odontella aurita1106Open in IMG/M
3300009079|Ga0102814_10018984All Organisms → cellular organisms → Eukaryota → Sar3977Open in IMG/M
3300009079|Ga0102814_10099405All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli1597Open in IMG/M
3300009080|Ga0102815_10125762All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli1406Open in IMG/M
3300009129|Ga0118728_1034599All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Eupodiscales → Odontellaceae → Odontella → Odontella aurita2863Open in IMG/M
3300009327|Ga0103843_103872All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Eupodiscales → Odontellaceae → Odontella → Odontella aurita753Open in IMG/M
3300009433|Ga0115545_1003184All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta7929Open in IMG/M
3300009543|Ga0115099_10151448All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Eupodiscales → Odontellaceae → Odontella → Odontella aurita1818Open in IMG/M
3300009543|Ga0115099_10240157All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Eupodiscales → Odontellaceae → Odontella → Odontella aurita822Open in IMG/M
3300009543|Ga0115099_10750709All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1712Open in IMG/M
3300009543|Ga0115099_10753976All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Eupodiscales → Odontellaceae → Odontella → Odontella aurita1500Open in IMG/M
3300009544|Ga0115006_10000113All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta38813Open in IMG/M
3300009592|Ga0115101_1058656All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Eupodiscales → Odontellaceae → Odontella → Odontella aurita675Open in IMG/M
3300009592|Ga0115101_1630704Not Available3570Open in IMG/M
3300009592|Ga0115101_1832000All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Eupodiscales → Odontellaceae → Odontella → Odontella aurita2263Open in IMG/M
3300009599|Ga0115103_1454295All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Eupodiscales → Odontellaceae → Odontella → Odontella aurita1145Open in IMG/M
3300009599|Ga0115103_1742843All Organisms → cellular organisms → Eukaryota3064Open in IMG/M
3300009599|Ga0115103_1825245All Organisms → cellular organisms → Eukaryota2007Open in IMG/M
3300009599|Ga0115103_1897735All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Eupodiscales → Odontellaceae → Odontella → Odontella aurita694Open in IMG/M
3300009717|Ga0123375_12332All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Eupodiscales → Odontellaceae → Odontella → Odontella aurita551Open in IMG/M
3300009732|Ga0123373_127012All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Eupodiscales → Odontellaceae → Odontella → Odontella aurita762Open in IMG/M
3300009732|Ga0123373_140459All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Eupodiscales → Odontellaceae → Odontella → Odontella aurita725Open in IMG/M
3300009754|Ga0123364_1007334All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Eupodiscales → Odontellaceae → Odontella → Odontella aurita691Open in IMG/M
3300011381|Ga0102688_1010428All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Eupodiscales → Odontellaceae → Odontella → Odontella aurita729Open in IMG/M
3300012370|Ga0123369_1052321All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Eupodiscales → Odontellaceae → Odontella → Odontella aurita719Open in IMG/M
3300012408|Ga0138265_1060687All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli953Open in IMG/M
3300012414|Ga0138264_1298466All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli903Open in IMG/M
3300012415|Ga0138263_1094486All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli747Open in IMG/M
3300012418|Ga0138261_1591304All Organisms → cellular organisms → Eukaryota → Sar725Open in IMG/M
3300012418|Ga0138261_1758083All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli904Open in IMG/M
3300012504|Ga0129347_1164658All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Eupodiscales → Odontellaceae → Odontella → Odontella aurita742Open in IMG/M
3300012518|Ga0129349_1320980All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Eupodiscales → Odontellaceae → Odontella → Odontella aurita644Open in IMG/M
3300012522|Ga0129326_1340293All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Eupodiscales → Odontellaceae → Odontella → Odontella aurita703Open in IMG/M
3300012523|Ga0129350_1401560All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Eupodiscales → Odontellaceae → Odontella → Odontella aurita571Open in IMG/M
3300012954|Ga0163111_10473113All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Eupodiscales → Odontellaceae → Odontella → Odontella aurita1150Open in IMG/M
3300012954|Ga0163111_11037264All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli793Open in IMG/M
3300012954|Ga0163111_11992663All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli584Open in IMG/M
3300012963|Ga0129340_1019385All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Eupodiscales → Odontellaceae → Odontella → Odontella aurita664Open in IMG/M
3300012968|Ga0129337_1106978All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Eupodiscales → Odontellaceae → Odontella → Odontella aurita741Open in IMG/M
3300017753|Ga0181407_1131183All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli623Open in IMG/M
3300018942|Ga0193426_10022155All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Eupodiscales → Odontellaceae → Odontella → Odontella aurita1215Open in IMG/M
3300019009|Ga0192880_10186173All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Eupodiscales → Odontellaceae → Odontella → Odontella aurita513Open in IMG/M
3300019191|Ga0180035_1010476All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli879Open in IMG/M
3300019191|Ga0180035_1099680All Organisms → cellular organisms → Eukaryota → Sar699Open in IMG/M
3300019200|Ga0180036_1049207All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli761Open in IMG/M
3300019200|Ga0180036_1060851All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli729Open in IMG/M
3300019201|Ga0180032_1035470All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Eupodiscales → Odontellaceae → Odontella → Odontella aurita512Open in IMG/M
3300019201|Ga0180032_1069619All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Eupodiscales → Odontellaceae → Odontella → Odontella aurita599Open in IMG/M
3300019201|Ga0180032_1079294All Organisms → cellular organisms → Eukaryota → Sar743Open in IMG/M
3300019201|Ga0180032_1091563All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli822Open in IMG/M
3300019703|Ga0194021_1004041All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli1083Open in IMG/M
3300019726|Ga0193974_1025872All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli691Open in IMG/M
3300019730|Ga0194001_1000129All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Eupodiscales → Odontellaceae → Odontella → Odontella aurita5644Open in IMG/M
3300019737|Ga0193973_1002038All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Eupodiscales → Odontellaceae → Odontella → Odontella aurita1614Open in IMG/M
3300019742|Ga0193965_1047688All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli724Open in IMG/M
3300019749|Ga0193983_1001069All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Eupodiscales → Odontellaceae → Odontella → Odontella aurita2238Open in IMG/M
3300019750|Ga0194000_1084799All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli525Open in IMG/M
3300020159|Ga0211734_11077170All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta9979Open in IMG/M
3300020162|Ga0211735_10434986All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli515Open in IMG/M
3300020205|Ga0211731_11480458All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Eupodiscales → Odontellaceae → Odontella → Odontella aurita5719Open in IMG/M
3300020495|Ga0208720_1001065All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta5678Open in IMG/M
3300020561|Ga0207934_1000331Not Available7031Open in IMG/M
3300021282|Ga0210303_1061234All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Eupodiscales → Odontellaceae → Odontella → Odontella aurita638Open in IMG/M
3300021282|Ga0210303_1112056All Organisms → cellular organisms → Eukaryota → Sar700Open in IMG/M
3300021284|Ga0210299_106759All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli796Open in IMG/M
3300021284|Ga0210299_132173All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli743Open in IMG/M
3300021299|Ga0210302_1102717All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli862Open in IMG/M
3300021323|Ga0210295_1003620All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli1506Open in IMG/M
3300021323|Ga0210295_1049803All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Eupodiscales → Odontellaceae → Odontella → Odontella aurita614Open in IMG/M
3300021356|Ga0213858_10008896All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta4740Open in IMG/M
3300021845|Ga0210297_1071482All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli784Open in IMG/M
3300021849|Ga0210304_1014035All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Eupodiscales → Odontellaceae → Odontella → Odontella aurita703Open in IMG/M
3300021957|Ga0222717_10188030All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Eupodiscales → Odontellaceae → Odontella → Odontella aurita1233Open in IMG/M
3300022217|Ga0224514_10000827Not Available8798Open in IMG/M
3300022367|Ga0210312_119381All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Eupodiscales → Odontellaceae → Odontella → Odontella aurita536Open in IMG/M
3300022372|Ga0210293_116479All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli735Open in IMG/M
3300022372|Ga0210293_116561All Organisms → cellular organisms → Eukaryota → Sar733Open in IMG/M
3300022374|Ga0210311_1016434All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli890Open in IMG/M
3300022374|Ga0210311_1019196All Organisms → cellular organisms → Eukaryota825Open in IMG/M
3300022374|Ga0210311_1030451All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Eupodiscales → Odontellaceae → Odontella → Odontella aurita653Open in IMG/M
3300022375|Ga0210313_1020533All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli776Open in IMG/M
3300024343|Ga0244777_10147684All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli1518Open in IMG/M
3300024343|Ga0244777_10591288All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Eupodiscales → Odontellaceae → Odontella → Odontella aurita673Open in IMG/M
3300024346|Ga0244775_10015834All Organisms → cellular organisms → Eukaryota6993Open in IMG/M
3300024346|Ga0244775_10085487All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli2691Open in IMG/M
3300024346|Ga0244775_10383531All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli1157Open in IMG/M
3300024532|Ga0256352_1054786All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli714Open in IMG/M
3300025879|Ga0209555_10344496All Organisms → cellular organisms → Eukaryota558Open in IMG/M
3300027254|Ga0208177_1000484All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Eupodiscales → Odontellaceae → Odontella → Odontella aurita4711Open in IMG/M
3300027254|Ga0208177_1000489All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta4693Open in IMG/M
(restricted) 3300027728|Ga0247836_1008837All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta9994Open in IMG/M
3300027757|Ga0208671_10076147All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli1238Open in IMG/M
3300027771|Ga0209279_10000456All Organisms → cellular organisms → Eukaryota26925Open in IMG/M
3300027797|Ga0209107_10025171All Organisms → cellular organisms → Eukaryota3418Open in IMG/M
(restricted) 3300027996|Ga0233413_10171425All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli904Open in IMG/M
3300028267|Ga0256358_1059937All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli749Open in IMG/M
3300028329|Ga0210315_1026829All Organisms → cellular organisms → Eukaryota731Open in IMG/M
3300028524|Ga0210314_113710All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli714Open in IMG/M
3300031786|Ga0315908_11113890All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Eupodiscales → Odontellaceae → Odontella → Odontella aurita631Open in IMG/M
3300033984|Ga0334989_0000967All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta13739Open in IMG/M
3300034355|Ga0335039_0035660Not Available3042Open in IMG/M
3300034357|Ga0335064_0352405All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli940Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine31.58%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine11.28%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous5.26%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment4.51%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater4.51%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton4.51%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine4.51%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine3.76%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater3.01%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine3.01%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake2.26%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater2.26%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater2.26%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater1.50%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.50%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water1.50%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment0.75%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater0.75%
River WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water0.75%
Freshwater Microbial MatEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater Microbial Mat0.75%
FreshwaterEnvironmental → Aquatic → Freshwater → Pond → Sediment → Freshwater0.75%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.75%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.75%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater0.75%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.75%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.75%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine0.75%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.75%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater0.75%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment0.75%
WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water0.75%
Wastewater EffluentEngineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent0.75%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water0.75%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2199352003Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnionEnvironmentalOpen in IMG/M
3300001273Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnionEnvironmentalOpen in IMG/M
3300001282Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnionEnvironmentalOpen in IMG/M
3300002404Freshwater microbial communities from Lake Mendota, WI - 22APR2009 deep hole epilimnionEnvironmentalOpen in IMG/M
3300003677Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_66_BLW_10 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300003682Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_03_M0_10 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300004282Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sedimentEnvironmentalOpen in IMG/M
3300005525Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaGEnvironmentalOpen in IMG/M
3300006165Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNAEnvironmentalOpen in IMG/M
3300006484Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535EnvironmentalOpen in IMG/M
3300006870Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300007232Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 10/23/14 A2 RNA (Eukaryote Community Metatranscriptome)EngineeredOpen in IMG/M
3300007321Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaT (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300007550Estuarine microbial communities from the Columbia River estuary - metaG 1549A-3EnvironmentalOpen in IMG/M
3300007557Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.715EnvironmentalOpen in IMG/M
3300007585Estuarine microbial communities from the Columbia River estuary - metaG 1562A-3EnvironmentalOpen in IMG/M
3300007623Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_H2O_MGEnvironmentalOpen in IMG/M
3300007636Estuarine microbial communities from the Columbia River estuary - metaG 1371A-3EnvironmentalOpen in IMG/M
3300007681Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.753EnvironmentalOpen in IMG/M
3300007860Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1372A_3umEnvironmentalOpen in IMG/M
3300007955Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373B_3.0umEnvironmentalOpen in IMG/M
3300007981Estuarine microbial communities from the Columbia River estuary - metaG 1556A-3EnvironmentalOpen in IMG/M
3300008114Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NAEnvironmentalOpen in IMG/M
3300008119Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NAEnvironmentalOpen in IMG/M
3300008121Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample HABS-E2014-0110-100-LTREnvironmentalOpen in IMG/M
3300008259Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NAEnvironmentalOpen in IMG/M
3300008958Marine microbial communities from eastern North Pacific Ocean - P1 particle-associatedEnvironmentalOpen in IMG/M
3300008996Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747EnvironmentalOpen in IMG/M
3300009026Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575EnvironmentalOpen in IMG/M
3300009079Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741EnvironmentalOpen in IMG/M
3300009080Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759EnvironmentalOpen in IMG/M
3300009129Combined Assembly of Gp0139513, Gp0139514EnvironmentalOpen in IMG/M
3300009327Microbial communities of water from the North Atlantic ocean - ACM30EnvironmentalOpen in IMG/M
3300009433Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330EnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009544Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M MetagenomeEnvironmentalOpen in IMG/M
3300009592Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009717Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_236_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009732Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_232_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009754Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_198_18m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300011381Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel7S_1600h metaT (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300012370Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_209_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012408Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA23.A_192.20151118 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012414Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA16.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012415Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA15.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012418Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 72hr light incubation - RNA12.A_72.20151113 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012504Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012518Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012522Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012523Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300012963Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012968Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017753Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26EnvironmentalOpen in IMG/M
3300018942Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002295 (ERX1782357-ERR1712003)EnvironmentalOpen in IMG/M
3300019009Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000756 (ERX1782233-ERR1711966)EnvironmentalOpen in IMG/M
3300019191Estuarine microbial communities from the Columbia River estuary - R.880 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019200Estuarine microbial communities from the Columbia River estuary - R.1175 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019201Estuarine microbial communities from the Columbia River estuary - R6.10AS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019703Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_7-8_MGEnvironmentalOpen in IMG/M
3300019726Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRT_10-11_MGEnvironmentalOpen in IMG/M
3300019730Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_7-8_MGEnvironmentalOpen in IMG/M
3300019737Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRT_9-10_MGEnvironmentalOpen in IMG/M
3300019742Microbial mat bacterial communities from the Broadkill River, Lewes, Delaware, United States - FB_8_MGEnvironmentalOpen in IMG/M
3300019749Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BLT_4-5_MGEnvironmentalOpen in IMG/M
3300019750Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States - FLT_6-7_MGEnvironmentalOpen in IMG/M
3300020159Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1EnvironmentalOpen in IMG/M
3300020162Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1EnvironmentalOpen in IMG/M
3300020205Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1EnvironmentalOpen in IMG/M
3300020495Freshwater microbial communities from Lake Mendota, WI - 20APR2010 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020561Freshwater microbial communities from Lake Mendota, WI - 22APR2009 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021282Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1035 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021284Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R878 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021299Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1034 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021323Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R9.63AS (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021356Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245EnvironmentalOpen in IMG/M
3300021845Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R876 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021849Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1037 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300022217Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_24EnvironmentalOpen in IMG/M
3300022367Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1161 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022372Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R8.46A (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022374Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1166 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022375Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1183 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300024532Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025879Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027254Estuarine microbial communities from the Columbia River estuary - metaG 1561A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027728 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14mEnvironmentalOpen in IMG/M
3300027757Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 (SPAdes)EnvironmentalOpen in IMG/M
3300027771Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027797Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes)EnvironmentalOpen in IMG/M
3300027996 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_6_MGEnvironmentalOpen in IMG/M
3300028267Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Colum_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028329Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Washington, United States ? R1276 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028524Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1184 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031786Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124EnvironmentalOpen in IMG/M
3300033984Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Mar2001-rr0030EnvironmentalOpen in IMG/M
3300034355Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Oct2015-rr0135EnvironmentalOpen in IMG/M
3300034357Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME12May2017-rr0187EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
21999085352199352003FreshwaterLYTPLEQFQIILLFSIKLFCFDFSITNLALVNFLVLFFFGTIIFLFSSNVNYLKETSFFFIPST
B570J13893_10096413300001273FreshwaterYTPLEQFQIILLFSIKLFCFDFSITNLALVNFLVLFFFGTIIFLFSSNVNYLKETSFFFIPST*
B570J14230_1004507533300001282FreshwaterPLEQFQIILLFSIKLFCFDFSITNLALVNFLVLFFFGTIIFLFSSNVNYLKETSFFFIPST*
B570J29591_100039893300002404FreshwaterMLSALAISKKVFKLLKIMLYTPLEQFQIILLFSIKLFCFDFSITNLALVNFLVLFFFGTIIFLFSSNVNYLKETSFFFIPST*
Ga0008458J53046_10857013300003677SeawaterQIILLFSIKLFCFDFSITNLVLVNLLVLLFFGAIVTLFSSNVNYVKETSFCFIPTT*
Ga0008456_101932013300003682SeawaterLLFSIKLFCFDFSITNLALVNFLVLLLFGAVVVLFSSNANSLKETSFFFIPST*
Ga0055584_10231865313300004097Pelagic MarineLEQFQIILLFSIKLFCFDFSITNLVLVNFLVLLFFGAIVVLFSSKVNHLKETSFFFIPSA
Ga0066599_10068788213300004282FreshwaterQKPKFCGETPSACALFLTKKVFKLLKIMLYAPLEQFQILLLFSIELFCLNFSINNLALLNSLVSLFFGGIVLLFNSNVN*
Ga0068877_10006540173300005525Freshwater LakeMLYTPLEQFQIILLFSIKLFCFDFSITNLALVNFLVLLFFGAIIRFFSSNENYLKETSFFFIPST*
Ga0075443_1000007253300006165MarineMLHTPLEQFQIILLFSIKLFCLDFSITNLVLVNFLVLLFFGAIVTLFSSNSSYLKETSFFFIPST*
Ga0070744_1000460443300006484EstuarineMLSALVISKKVFKLLKIMLYTPLEQFQIILLFSIKLFCFDFSITNLALVNSLVLFFFGAIIFLFSSNENYLKETSFFFIPST*
Ga0075479_1004609553300006870AqueousMLHTPLEQFQIILLFSIKLFCFDFSITNLVLVNVLVLVFFIVLVYFFSPNIISSDTASFFFIPNT*
Ga0075183_1007265843300007232Wastewater EffluentMLSTPLEQFQIILLFSIKLFCFDFSITNLVLVNILVLLFFSLFVYFFSSNTDCSNVSSFFFIPNT*
Ga0102692_159616733300007321Freshwater LakeFQIILLFSIKLFCFDFSITNLALVNFLVLLFFGAIIRFFSSNENYLKETSFFFIPST*
Ga0102880_118738813300007550EstuarineMLYTPLEQFQIILLFSIKLFCFDFSITNLVLVNLLVLLLFAATIILFSSKVNYLKETSFFFIPST*
Ga0102821_103913913300007557EstuarineMLYTPLEQFQIILLFSIKLFCFDFSITNLALVNFLVLAIFAAMVFFFSSNANYLNETSFFFIP
Ga0102916_100550533300007585EstuarineMLYTPLEQFQIILLFSIKLFCFDFSITNLVLVNFLVLLLFGAIVILFSSNVNYLKEISFFFIPST*
Ga0102948_102696233300007623WaterMLHTPLEQFQIILLFSIKLFCFDFSITNLALVNLLVLAIFAIIVFSFSSNVNYLKETSFFFIPST*
Ga0102856_100073033300007636EstuarineMLYTPLEQFQIILLFSIKLFCFDFSITNLALVNSLVLFFFGAIIFLFSSNVNYLKETSFFFIPST*
Ga0102824_113429333300007681EstuarineMLYTPLEQFQIILLFSIKLFCFDFSITNLALVNFLVLAIFAAMVFFFSSNANYLNETSFFFIPN
Ga0105735_114550113300007860Estuary WaterMLSALVISKKVFKLLKIMLYTPLEQFQIILLFSIKLFCFDFSITNLALVNFLVLFFFGTIIFLFSSNVNYLKETSFFFIPST*
Ga0105740_100612113300007955Estuary WaterLLFSIKLFCFDFSITNLALVNFLVLLLFGAIVILFSSNGNYLKETSFFFIPST*
Ga0102904_106914233300007981EstuarineLKVMLYTPLEQFQIILLYSIKLFCFDFSITNLALVNFLVLLCFSAVIILFSSSSDYPKETSFFFIPST*
Ga0114347_107132813300008114Freshwater, PlanktonMLSALVISKKVFKLLKIMLYTPLEQFQIILLFSIKLFCFDFSITNLALVNFLVLFFFGTIIFLFSSNVNYLKETSFFFIQST*
Ga0114354_101042153300008119Freshwater, PlanktonMLYTPLEQFQIILLFSVKLFCFDFSITNLVLVNLLVLFFFFVVVTLFSSNANYLQETSFFFIPSI*
Ga0114354_102302243300008119Freshwater, PlanktonLFVNSATSYKCEHNVFKILKIMLFTPLEQFQIILLFSFKLFCFDFSITNLVLVNLLVLFFFFVVVTLFSSHKNYLQETSFFFIPNI*
Ga0114354_103653943300008119Freshwater, PlanktonMLSTPLEQFQIILLFSIKLFCFDFSITNLVLVNMLVLIFFAAIVYFFSSNFNYLNETSFFFIPNA*
Ga0114356_103796843300008121Freshwater, PlanktonMLHTPLEQFQIILLFSIKLFCFDFSITNLVLVNLLVLAIFVAIVFLFSSNVNYLKETSFFFIPNT*
Ga0114841_100955643300008259Freshwater, PlanktonCVIYCQKIFKLLKIMLYTPLEQFQIILLFSIKLFCFDFSITNLALVNFLVLLLFGAIVILFSSNGNYLKETSFFFIPST*
Ga0104259_103669523300008958Ocean WaterFPIKLFCFDFSITNLVLVNFLVLLIFMLLVISFSSNLNFFKETSFFFVPST*
Ga0102831_127170213300008996EstuarineMLYTPLEQFQIILLFSIKLFCFDFSITNLALVNFLVLFFFGTIIFLFSSNVNYLKETSFFFIPST*
Ga0102829_106518813300009026EstuarineKLLKIMLYTPLEQFQIILLFSIKLFCFDFSITNLALVNFLVLLLFGAIVILFSSNGNYLKETSFFFIPST*
Ga0102814_1001898493300009079EstuarineMLYTPLEQFQIILLFSIKLFCFDFSITNLALVNFLVLLLFGAIVFLLSSNLNYLKETSFFFIPST*
Ga0102814_1009940513300009079EstuarineLLKIMLYTPLEQFQIILLFSIKLFCFDFSITNLALVNFLVLFFFGTIIFLFSSNVNYLKETSFFFIPST*
Ga0102815_1012576233300009080EstuarineYTPLEQFQIILLFSIKLFCFDFSITNLVLVNLLVLLLFAATIILFSSKVNYLKETSFFFIPST*
Ga0118728_103459943300009129MarineMLHTPLEQFQIILLFSIKLFCFDFSITNLALVNFLVLAIFAAMVFFFSSNVNYLNETSFFFIPNT*
Ga0103843_10387233300009327River WaterQIQIILLFSIKLFCFDFSITNLVLVNLLVLAIFVAIVFLFSSNVNYLKETSFFFIPNT*
Ga0115545_100318483300009433Pelagic MarineMLHTPLEQFQIILLFSIKLFCFDFSITNLVLVNLLVLAIFAAMVFLFSSNVNYLKETSFFFIPNT*
Ga0115099_1015144843300009543MarineLYTPLEQFQIILLFSIKLFCFDFSITNLVLVNFLALLFFGAIVLFFSSTASYSKETSFFFIPST*
Ga0115099_1024015733300009543MarineEQFQIILLFSIKLFCFDFSITNLVLVNFLVLLFFGAIVVSFSSNENYLKETSFFFIPGT*
Ga0115099_1075070943300009543MarineKSCFVCVPKKIFKLLKTMLYTSLEQLQIILLFSIKLFCFDFSITNLVLVNFLILFFFDAVVAFFSSKVNHLKEISFFLI*
Ga0115099_1075397613300009543MarineQFQIILLFSIKLFCFDFSITNLVLVNFLVLLFFGAVVVFFSSKVNHLKETSFFFIPSA*
Ga0115006_10000113793300009544MarineMLHTPLEQFQIILLFSIKLFCFDFSITNLALVNLLVLAIFAAMVFFFSSNVNYLKETSFFFIPNT*
Ga0115101_105865633300009592MarineLFSIKLFCFDFSITNLALVNLLVLAIFAIIVFSFSSNVNYLKETSFFFIPST*
Ga0115101_163070493300009592MarineMLYTPLEQFQIILLFSIKLFCFDFSITNLVLVNLLVLLFFGAIVTLFSSNVNYVKETSFCFIPTT*
Ga0115101_183200013300009592MarineEQFQIILLFSIKLFCFDFSITNLVLVNFLALLFFGAIVLFFSSTASYSKETSFFFIPST*
Ga0115103_145429523300009599MarineMLHTPLEQFQIILLFSIKLFCFDFSVTNLVLVNFLVLLFFGGIVTFFSSNVNYLKETSFCFIPST*
Ga0115103_174284383300009599MarineMLYTPLEQFQIILLYSIKLFCFDFSITNLALVNFLVLLCFSAVIILFSSSSDYPKETSFFFIPST*
Ga0115103_182524513300009599MarineKISKGLKKMLYTPLEQFQIILLFSIKLFCFDFSITNLVLVNLLVLLFFGAIVTLFSSNVNYVKETSFCFIPTT*
Ga0115103_189773513300009599MarineQFQIILLFSIKLFCFDFSITNLVLVNFLALLFFGAIVLFFSSTASYSKETSFFFIPST*
Ga0123375_1233213300009717MarineQFQIILLFSIKLFCFDFSITNLVLVNLLVLAIFVAIVFLFSSNVNYLKETSFFFIPNT*
Ga0123373_12701213300009732MarineQFQIILLFSIKLFCFDFSITNLALVNLLVLAIFAAMVFFFSSNANYLEETSFFFIPNT*
Ga0123373_14045933300009732MarineLEQFQIILLFSIKLFCFDFSITNLVLVNLLVLAIFVAIVFLFSSNVNYLKETSFFFIPNT
Ga0123364_100733433300009754MarineFQIILLFSIKLFCFDFSITNLALVNLLVLAIFAIIVFSFSSNVNYLKETSFFFIPST*
Ga0102688_101042813300011381Freshwater LakeKKVFKLLKIMLYTPLEQFQIILLFSIKLFCFDFSITNLALVNFLVLFFFGTIIFLFSSNVNYLKETSFFFIPST*
Ga0123369_105232123300012370MarineFCFDFSITNLALVNLLVLAIFAAMVFFFSSNANYLEETSFFFIPNT*
Ga0138265_106068713300012408Polar MarineLHTPLEQFQIILLFSIKLFCLDFSITNLVLVNFLVLLFFGAIVTLFSSNSSYLKETSFFFIPST*
Ga0138264_129846613300012414Polar MarineLEQFQIILLFSIKLFCLDFSITNLVLVNFLVLLFFGAIVTLFSSNSSYLKETSFFFIPST
Ga0138263_109448623300012415Polar MarineILLFSIKLFCFDFSITNLVLVNFLVLLFFGAIVILFSSSAGSLKETSFFFHSKYMTGVS*
Ga0138261_159130413300012418Polar MarineQIILLFSIKLFCFDFSITNLVLVNFLVLLFFGAIVILFSSSAGSLKETSFFFHSKYMTGVS*
Ga0138261_175808313300012418Polar MarinePLEQFQIILLFSIKLFCLDFSITNLVLVNFLVLLFFGAIVTLFSSNSSYLKETSFFFIPST*
Ga0129347_116465813300012504AqueousQFQIILLFSIKLFCFDFSITNLALVNLLVLAIFAIIVFSFSSNVNYLKETSFFFIPST*
Ga0129349_132098023300012518AqueousLLFSIKLFCFDFSITNLALVNLLVLAIFAIIVFSFSSNVNYLKETSFFFIPST*
Ga0129326_134029333300012522AqueousLEQFQIILLFSIKLFCFDFSITNLALVNLLVLAIFAAMVFFFSSNVNYLKETSFFFIPNT
Ga0129350_140156023300012523AqueousLEQFQIILLFSIKLFCFDFSITNLALVNLLVLAIFAAMVFFFSSNTNYLEETSFFFIPNT
Ga0163111_1047311333300012954Surface SeawaterMLFTPLEQFQIILLFSIKLFCFNFSITNLVLVNFLVLFFFSFIIFLISSDINQFKKSSLYFIP
Ga0163111_1103726423300012954Surface SeawaterMIAGDEEQCSRSKLSYFLIIKILKCMLYTPLEQFQIILLLSIKLFCFDFSITNLALVNILTLLVFGAVITLFSSSRNYLKETSFFFIPST*
Ga0163111_1199266323300012954Surface SeawaterMLLFTPLEQFQIISLFSIKLFCFDFSITNLVLVNFLVLFFFSFIIFLISSDINQFKKSSLYFIP
Ga0129340_101938533300012963AqueousKLFCFDFSITNLALVNLLVLAIFAIIVFSFSSNVNYLKETSFFFIPST*
Ga0129337_110697813300012968AqueousFSIKLFCFDFSITNLVLVNLLVLAIFAAIVFSFSSNANYLKETSFFFIPNT*
Ga0181407_113118313300017753SeawaterMLYTPLEQFQIILLFSIKLFCFDFSITNLVLVNLLVLLFFSAIVIFFSSSSNYLKETSF
Ga0193426_1002215533300018942MarineSKCMLYTPLEQFQIILLLSIKLFCFDFSITNLALVNILTLLVFGAVITLFSSSRNYLKETSFFFIPST
Ga0192880_1018617323300019009MarineHGMLYTPLEQFQIILLFPIKLFCFDFSITNLVLVNFLVLLIFMLLVISFSSNLNFFKETSFFFVPST
Ga0180035_101047623300019191EstuarineEQFQIILLFSIKLFCFDFSITNLALVNFLVLLLFGAIVILFSSNGNYLKETSFFFIPST
Ga0180035_109968023300019191EstuarineLEQFQIILLFSIKLFCFDFSITNLALVNFLVLLFFGAIIRFFSSNENYLKETSFFFIPST
Ga0180036_104920713300019200EstuarineQFQIILLFSIKLFCFDFSITNLVLVNLLVLLLFAATIILFSSKVNYLKETSFFFIPST
Ga0180036_106085113300019200EstuarineQFQIILLFSIKLFCFDFSITNLALVNFLVLLFFGAIIRFFSSNENYLKETSFFFIPST
Ga0180032_103547013300019201EstuarineLEQFQIILLFSIKLFCFDFSITNLVLVNFLVLLLFGAIVILFSSNVNYLKEISFFFIPST
Ga0180032_106961913300019201EstuarineQIILLFSIKLFCFDFSITNLVLVNLLVLLLFAATIILFSSKVNYLKETSFFFIPST
Ga0180032_107929413300019201EstuarinePLEQFQIILLFSIKLFCFDFSITNLVLVNMLVLIFFAAIVYFFSSNFNYLNETSFFFIPN
Ga0180032_109156333300019201EstuarineEQFQIILLFSIKLFCFDFSITNLALVNFLVLLFFGAIIRFFSSNENYLKETSFFFIPST
Ga0194021_100404113300019703SedimentMLYTPLEQFQIILLFSIKLFCFDFSITNLVLVNFLVLLFFGAVVVFFSSKLNHLKETSF
Ga0193974_102587223300019726SedimentMLHTPLEQFQIILLFSIKLFCFDFSITNLALVNLLVLAIFAIIVFSFSSNVNYLKETSF
Ga0194001_100012923300019730SedimentMLYTPLEQFQIILLFSIKLFCFDFSITNLVLVNFLVLLFFGAVVVFFSSKLNHLKETSFFFIPSA
Ga0193973_100203823300019737SedimentMLHTPLEQFQIILLFSIKLFCFDFSITNLALVNLLVLAIFAIIVFSFSSNVNYLKETSFFFIPST
Ga0193965_104768813300019742Freshwater Microbial MatMLYTPLEKFQITLLFSIKLFCFDFSISKFIGFIIFFSSNENYLKETSFFLSQLHDKYQLI
Ga0193983_100106923300019749SedimentMLYTPLEQFQIILLFSIKLFCFDFSITNLVLVNFLVLLFFGAVVVFFSSKVNHLKETSFFFIPSA
Ga0194000_108479913300019750SedimentMLYTPLEQFQIILLFSIKLFCFDFSITNLVLVNFLVLLFFVAIVIFFSSNANYLKE
Ga0211734_1107717093300020159FreshwaterMYSLIGYHPKRFKLLKIMLYTPLEQFQIILLFPIKLFCFDFSITNLVLVNFLVLLLFGAIVILFSSNLNHLKESSFFFIPSS
Ga0211735_1043498623300020162FreshwaterMLYTPLEQFQIILLFSIKLFCFDFSITNLALVNFLVLLFFGAIIRFFSSNENYLKETSFFFIPSTXQVLVETFYDT
Ga0211731_1148045813300020205FreshwaterMLYTPLEQFQIILLFSIKLFCFDFSITNLALVNFLVLFFFGAIIFLFSSNENYLKETSFFFIPST
Ga0208720_100106533300020495FreshwaterMLSALVISKKVFKLLKIMLYTPLEQFQIILLFSIKLFCFDFSITNLALVNFLVLFFFGTIIFLFSSNVNYLKETSFFFIPST
Ga0207934_100033153300020561FreshwaterMLSALAISKKVFKLLKIMLYTPLEQFQIILLFSIKLFCFDFSITNLALVNFLVLFFFGTIIFLFSSNVNYLKETSFFFIPST
Ga0210303_106123423300021282EstuarinePLEQFQIILLFSIKLFCFDFSITNLALVNFLVLLFFGAIIRFFSSNENYLKETSFFFIPS
Ga0210303_111205613300021282EstuarineLEQFQIILLFSIKLFCFDFSITNLALVNFLVLLLFGAIVILFSSNVNYLKETSFFFIPST
Ga0210299_10675913300021284EstuarineLTKKVFKLLKIMLYTPLEQFQIILLFSIKLFCFDFSITNLALVNFLVLLLFGAIVILFSSNVNYLKETSFFFIPST
Ga0210299_13217313300021284EstuarineLEQFQIILLFSIKLFCFDFSITNLALVNFLVLLLFGAIVILFSSNGNYLKETSFFFIPST
Ga0210302_110271713300021299EstuarineQIILLFSIKLFCFDFSITNLALVNSLVLFFFGAIIFLFSSNENYLKETSFFFIPST
Ga0210295_100362043300021323EstuarineMLSTPLEQFQIILLFSIKLFCFDFSITNLVLVNMLVLIFFAAIVYFFSSNFNYLNETSFFFIPNA
Ga0210295_104980313300021323EstuarinePLEQFQIILLFSVKLFCFDFSITNLVLVNLLVLLLFAATIILFSSKVNYLKETSFFFIPS
Ga0213858_1000889633300021356SeawaterMLHTPLEQFQIILLFSIKLFCFDFSITNLALVNLLVLAIFAAMVFFFSSNVNYLKETSFFFIPNT
Ga0210297_107148213300021845EstuarineKKIFKLLKIMLYTPLEQFQIILLFSIKLFCFDFSITNLALVNFLVLLLFGAIVILFSSNVNYLKETSFFFIPST
Ga0210304_101403513300021849EstuarineDCVLFIGKKIFKLLKIMLYTPLEQFQIILLFSIKLFCFDFSITNLVLVNFLVLLLFGAIVILFSSNGNYLKETSFFFIPST
Ga0222717_1018803013300021957Estuarine WaterFCFDFSITNLVLVNFLVLLFFGAIVIFFSSNASSLKETSFFLFQVHGKC
Ga0224514_1000082733300022217SedimentMLYTPLEQFQIILLFSIKLFCFDFSITNLVLVNFLVLLFFGAIVIFFSSNASSLKETSFFFIPST
Ga0210312_11938123300022367EstuarineSMLHTLLEQFQIILLFSMKLFCFDFSVTNLVLVNFLVLLFFGEIVTFFSSNVDDLKETSFCFIPST
Ga0210293_11647913300022372EstuarineQFQIILLFSIKLFCFDFSITNLALVNFLVLLLFGAIVILFSSNGNYLKETSFFFIPST
Ga0210293_11656113300022372EstuarineQFQIILLFSIKLFCFDFSITNLVLVNMLVLIFFAAIVYFFSSNFNYLNETSFFFIPNA
Ga0210311_101643423300022374EstuarineKLFCFDFSITNLVLVNLLVLLLFAATIILFSSKVNYLKETSFFFIPST
Ga0210311_101919623300022374EstuarineMLYTPLEQFQIILLFSIKLFCFDFSITNLALVNFLVLLFFGAIIRFFSSNENYLKETSFFFIPST
Ga0210311_103045123300022374EstuarineEQFQIILLFSIKLFCFDFSITNLVLVNILVIIFFTLFVYFFSSNSNTASFFFIPNT
Ga0210313_102053323300022375EstuarineYTPLEQFQIILLFSIKLFCFDFSITNLVLVNLLVLLLFAATIILFSSKVNYLKETSFFFIPST
Ga0244777_1014768433300024343EstuarineISKKVFKLLKTMLYTPLEQFQIILLFSIKLFCFDFSITNLALVNSLVLFFFGAIIFLFSSNENYLKETSFFFIPST
Ga0244777_1059128813300024343EstuarineIMLYTPLEQFQIILLFSIKLFCFDFSITNLALVNFLVLLFFGAIIRFFSSNENYLKETSFFFIPST
Ga0244775_1001583433300024346EstuarineMLYTPLEQFQIILLFSIKLFCFDFSITNLALVNFLVLLLFGAIVFLLSSNLNYLKETSFFFIPST
Ga0244775_1008548743300024346EstuarineMLYTPLEQFQIILLFSIKLFCFDFSITNLVLVNLLVLLLFAATIILFSSKVNYLKETSFFFIPST
Ga0244775_1038353143300024346EstuarineMLYTPLEQFQIILLFSIKLFCFDFSITNLALVNFLVLLLFGAIVILFSSNVNYLKETSFFFIPSTXQVLVETFYETSL
Ga0256352_105478623300024532FreshwaterFDFSITNLVLVNLLVLLLFSATIILFSSKVNYLKETSFFFIPST
Ga0209555_1034449613300025879MarineMLYTPLEQFQIILLFSIKLFCFDFSITNLVLVNLLVLLFFGAIVVFFSSNTNHLKETSFFFIPSTW
Ga0208177_100048463300027254EstuarineMLYTPLEQFQIILLFSVKLFCFDFSITNLVLVNLLVLFFFFVVVTLFSSNANYLQETSFFFIPSI
Ga0208177_100048993300027254EstuarineMLYTPLEQFQIILLFSIKLFCFDFSITNLVLVNFLVLLLFGAIVILFSSNVNYLKEISFFFIPST
(restricted) Ga0247836_100883793300027728FreshwaterMYLLFGYHPKRFKLLKIMLYTPLEQFQIILLFPIKLFCFDFSITNLVLVNFLVLLLFGAIVILFSSNLNHLKESSFFFIPST
Ga0208671_1007614743300027757EstuarineMLYTPLEQFQIILLFSIKLFCFDFSITNLVLVNFLVLLLFGAIVILFSSNVNYLKEISFFFIPSTXQALVETFYETSLQLL
Ga0209279_1000045633300027771MarineMLHTPLEQFQIILLFSIKLFCLDFSITNLVLVNFLVLLFFGAIVTLFSSNSSYLKETSFFFIPST
Ga0209107_1002517113300027797Freshwater And SedimentMLYTPLEQFQIILLFSIKLFCFDFSITNLALVNFLVLLLFGAIVFLLSSNLNYLKE
(restricted) Ga0233413_1017142513300027996SeawaterMLHTPLEQFQIILLFSIKLFCFDFSITNLALVNFLVLAIFAAMVFFFSSNANYLNETSFFFIPNTWQVFIEA
Ga0256358_105993723300028267FreshwaterFDFSITNLVLVNLLVLLLFAATIILFSSKVNYLKETSFFFIPST
Ga0210315_102682913300028329EstuarineEQFQIILLFSIKLFCFDFSITNLALVNFLVLFFFGTIIFLFSSNVNYLKETSFFFIPST
Ga0210314_11371023300028524EstuarineDFSITNLVLVNLLVLLLFAATIILFSSKVNYLKETSFFFIPST
Ga0315908_1111389013300031786FreshwaterLKVMLYTPLEQFQIILLFSVKLFCFDFSITNLVLVNLLVLFFFFVVVTLFSSNANYLQETSFFFIPSI
Ga0334989_0000967_1840_20373300033984FreshwaterMLYTPLEQFQIILLFSIKLFCFDFSITNLALVNSLVLFFFGAIIFLFSSNENYLKETSFFFIPST
Ga0335039_0035660_1501_16983300034355FreshwaterMLYTPLEQFQIILLFSIKLFCFDFSITNLALVNFLVLFFFGTIIFLFSSNVNYLKETSFFFIPST
Ga0335064_0352405_548_7963300034357FreshwaterMLSALAISKKVFKLLKIMLYTPLEQFQIILLFSIKLFCFDFSITNLALVNFLVLFFFGAIIFLFSSNVNYLKETSFFFIPST


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.