| Basic Information | |
|---|---|
| Family ID | F059390 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 134 |
| Average Sequence Length | 53 residues |
| Representative Sequence | MQIATVGSYPVTIGWLIALLVLILAILGLVGVVPTSPTVVFGLIGALAVARLT |
| Number of Associated Samples | 66 |
| Number of Associated Scaffolds | 133 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 91.47 % |
| % of genes near scaffold ends (potentially truncated) | 6.72 % |
| % of genes from short scaffolds (< 2000 bps) | 61.94 % |
| Associated GOLD sequencing projects | 57 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.66 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (76.119 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (27.612 % of family members) |
| Environment Ontology (ENVO) | Unclassified (55.224 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (62.687 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.74% β-sheet: 11.11% Coil/Unstructured: 48.15% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.66 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 133 Family Scaffolds |
|---|---|---|
| PF01510 | Amidase_2 | 8.27 |
| PF08310 | LGFP | 3.76 |
| PF00145 | DNA_methylase | 2.26 |
| PF07508 | Recombinase | 2.26 |
| PF08774 | VRR_NUC | 2.26 |
| PF01391 | Collagen | 1.50 |
| PF01464 | SLT | 1.50 |
| PF05127 | Helicase_RecD | 0.75 |
| PF13524 | Glyco_trans_1_2 | 0.75 |
| PF05065 | Phage_capsid | 0.75 |
| PF06737 | Transglycosylas | 0.75 |
| PF13229 | Beta_helix | 0.75 |
| PF13560 | HTH_31 | 0.75 |
| PF05135 | Phage_connect_1 | 0.75 |
| PF11651 | P22_CoatProtein | 0.75 |
| PF01832 | Glucosaminidase | 0.75 |
| PF13518 | HTH_28 | 0.75 |
| PF14659 | Phage_int_SAM_3 | 0.75 |
| PF16473 | Rv2179c-like | 0.75 |
| PF13392 | HNH_3 | 0.75 |
| PF00847 | AP2 | 0.75 |
| PF11752 | DUF3309 | 0.75 |
| PF01555 | N6_N4_Mtase | 0.75 |
| PF01541 | GIY-YIG | 0.75 |
| PF13481 | AAA_25 | 0.75 |
| COG ID | Name | Functional Category | % Frequency in 133 Family Scaffolds |
|---|---|---|---|
| COG5479 | LGFP repeat-containing protein, may be involved in cell wall binding | Cell wall/membrane/envelope biogenesis [M] | 3.76 |
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 2.26 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 2.26 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.75 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.75 |
| COG1444 | tRNA(Met) C34 N-acetyltransferase TmcA | Translation, ribosomal structure and biogenesis [J] | 0.75 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.75 |
| COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 0.75 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 76.12 % |
| All Organisms | root | All Organisms | 23.88 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 27.61% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 26.12% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 4.48% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.99% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.99% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.24% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.24% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.24% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 2.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.49% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.49% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.49% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.49% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.49% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.75% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.75% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.75% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.75% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.75% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.75% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.75% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.75% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2162886013 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026632 | Grasslands soil microbial communities from Chapel Hill, North Carolina, USA that are Nitrogen fertilized -NN346 (SPAdes) | Environmental | Open in IMG/M |
| 3300026666 | Grasslands soil microbial communities from Chapel Hill, North Carolina, USA that are Nitrogen fertilized -NN351 (SPAdes) | Environmental | Open in IMG/M |
| 3300027722 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027743 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| SwBSRL2_0634.00005450 | 2162886013 | Switchgrass Rhizosphere | MQIATVGAYPVTIGWLIAILVLLLAVLGLLGVIPTSPMVVFGLIAALAVARLT |
| Ga0066395_1000006215 | 3300004633 | Tropical Forest Soil | MQIATIGSVSVTIGWLIALIVLILAILGLVGVLPLNQTVGFGLIGALAVARLL* |
| Ga0066395_100005334 | 3300004633 | Tropical Forest Soil | MHVATVGTYPVTIGWLIALLVLILAILGLVGVLPMSQTVIFGLIAALAVARLT* |
| Ga0066395_1000074219 | 3300004633 | Tropical Forest Soil | MQITTVGSLSVTVGWLIAIVILILAILGLVGVLANTPLIIFGLIAGLAISRLL* |
| Ga0066395_100009159 | 3300004633 | Tropical Forest Soil | MQIGTYTLGIGGIIAILVLLLAILGMLSVLPQTPVVIFGLIAALAVARLVP* |
| Ga0066395_100107694 | 3300004633 | Tropical Forest Soil | MQIATVGSLAVTVGWLIALVILILAILGLVGVLPATPVVVFGLIGGLAIARLL* |
| Ga0066395_100198867 | 3300004633 | Tropical Forest Soil | MRFQLSVPVVTIGWLLAIVILILAILGLVGVLPSTPVVVFGLIGGLAIARLL* |
| Ga0066395_100781464 | 3300004633 | Tropical Forest Soil | MQIASIGAYPVSVGALIALIVLILAILGLVGVLPNTPLVIFGLIGALGIARLT* |
| Ga0066395_100902433 | 3300004633 | Tropical Forest Soil | MQITTVGSLSVTVGWLIAIVILVLAILGLVGVLPNTPIVIFGMLGGLAIARLL* |
| Ga0066395_101097453 | 3300004633 | Tropical Forest Soil | MHIATVGNLPVTIGWLIALIVLILAILGLVGVLPNTPLVIFGLIGALAVARLL* |
| Ga0066395_107708032 | 3300004633 | Tropical Forest Soil | ASIGAYPVSVGALIALIVLILAILGLVGVLPSTPLVIFGLIGALAVARLL* |
| Ga0066395_108365831 | 3300004633 | Tropical Forest Soil | MQLGTVGNVAVTVGWLIAIVVLILAILGLVGVVPLDKNTAFGMLGALAIARLL* |
| Ga0066395_108781232 | 3300004633 | Tropical Forest Soil | MQIATVGSLAVTVGWLIALVILILAILGLVGVLPATPVVVFGLIGGLAIAR |
| Ga0065704_103237723 | 3300005289 | Switchgrass Rhizosphere | MQIATVGAYPVTIGWLIAILVLLLAVLGLLGVIPTSPMVVFGLIAALAVARLT* |
| Ga0070676_100122622 | 3300005328 | Miscanthus Rhizosphere | MQITTVGNMAITIGWLIALLVLILAILGLVGVVPTSPQVLFGLIAALAVARLT* |
| Ga0070666_104039602 | 3300005335 | Switchgrass Rhizosphere | MPTFAVGTYPWTIGAIIAIVVLLLAVLGLVGVLPMSAPVAFGLFAALAVARLT* |
| Ga0070687_1001349334 | 3300005343 | Switchgrass Rhizosphere | MQVTTIGNMAITIGWLIALLVLILAILGLVGVVPTSPQVLFGLIAALAVARLT* |
| Ga0070668_1002539973 | 3300005347 | Switchgrass Rhizosphere | MQITTVGSMAITIGWLIALLVLILAILGLVGVVPTSPTVVFGLIAALAVARLT* |
| Ga0070668_1015708171 | 3300005347 | Switchgrass Rhizosphere | MQVTTIGSMAITIGWLIALLVLILAILGLVGALPTSPTVVFGLIAALAVARLT* |
| Ga0070669_1013262052 | 3300005353 | Switchgrass Rhizosphere | MQIATVGTMAITIGWLIALLVLILAILGLVGVLPMDKNVIFGLFAALAV |
| Ga0070667_1001217675 | 3300005367 | Switchgrass Rhizosphere | MQIATVGTMAITIGWLIALLVLILAILGLVGVLPMDKNVIFGLFAALAVARLT* |
| Ga0070714_1004077125 | 3300005435 | Agricultural Soil | MQIATVGSYPITIGWLIALIVLLLAILGLIGVVPTSPMVVFGLIGALAVARLT* |
| Ga0070713_1000014886 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MQLTTVGNLAITIGWLIAIVVLLIAILGLIGLVPLSQTVVFGMFAALAVARLV* |
| Ga0070710_103863972 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MQVTTVGNLAITLGWLVAVLCLLIAILGLLSVVPYTAPVVFGLIAALAVARLI* |
| Ga0070710_106144422 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MQVATVGSYPVTIGWLIAVIVLILAILGLVGVVPSTPLVLFGLIGGLAVARLT* |
| Ga0070711_1000040245 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MQVTTVGNLAITLGWLVAVLVLLIAILGLLSVVPYTAPVVFGLIAALAVARLI* |
| Ga0070711_1004528062 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MQIATVGSLAITIGWLIALIVLVLAILGLVGVLPMSATVFFGFIAALAIARLI* |
| Ga0070711_1010001212 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MQIATVGSYPITIGWLIALIVLLLAILGLIGVVPTSPTVVFGLIGALAVARLT* |
| Ga0070700_1003766922 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MQITTVGSMAITIGWLIAVLVLLLAVLGLLSVIPTSPQVVFGLIAALAVARLT* |
| Ga0073909_100007806 | 3300005526 | Surface Soil | MQLGTVGTYAFSIGSIIAILVLLIAILGLISVVPSSPVVIFGLIAALAVARLT* |
| Ga0070684_1001339094 | 3300005535 | Corn Rhizosphere | MQLGTVSGMAITIGWLIAVLVFLLAVLGMFGVVPFGATIVFGLIAALAVARLL* |
| Ga0066670_105970222 | 3300005560 | Soil | MQIATVGSYPLTLGWVIALLALLIAILGLISVIPLTPTVAFGLFAALAVSRLV* |
| Ga0066905_1000025079 | 3300005713 | Tropical Forest Soil | MTVGTYPLTIGGLVAIVVLIIAILGLVGVVPLSQTVVFGLFAALAVARLT* |
| Ga0066905_1001040413 | 3300005713 | Tropical Forest Soil | MQLGTVGSYPVTVGWLIAIVVLLLAILGLVNVLPMTQTVFFGLIGALAVARLT* |
| Ga0066905_1010171952 | 3300005713 | Tropical Forest Soil | VKVVTVGNRSVTIGWIIALLVVLLAILGALGVLPQTPIVIFGLIGALGLAVLL* |
| Ga0066905_1020882042 | 3300005713 | Tropical Forest Soil | MQITTLGSMAVTIGWLIALLVLILAILGLVGVVPTSPTVVFGLIAALAVARLT* |
| Ga0066903_10000007026 | 3300005764 | Tropical Forest Soil | MQIATVGTYAVTVGWLIALVVLLLAILGLVGVLPTTPTILFGLLGALAVARLT* |
| Ga0066903_1002607965 | 3300005764 | Tropical Forest Soil | MQLGTVGSLAVTIGWLIALLVLILAILGLVGVLPMSQTVIFGLIGALAVARLT* |
| Ga0066903_1003332796 | 3300005764 | Tropical Forest Soil | MQITTVGSVSVTVGWLIAIMILILAILGLVGVLANTPLIVFGLIGGLAISRLL* |
| Ga0066903_1005183806 | 3300005764 | Tropical Forest Soil | MHIATVGSYPVTIGWLIALIVLILAILGLVGVLPSTPLVIFGLIGALGVARLT* |
| Ga0066903_1009469865 | 3300005764 | Tropical Forest Soil | MHIATVGSYPVTIGWLIALIVLILAILGLVGVLPNTPLVIFGLIGALGIARLT* |
| Ga0066903_1017983804 | 3300005764 | Tropical Forest Soil | MQITTVGSLTVTVGWLIAIVILVLAILGLVGVLANTSLIVFGLIGGLAISRLL* |
| Ga0066903_1028701393 | 3300005764 | Tropical Forest Soil | MHIATAGNYAVTIGGLSALVVLLLAILGLVGVLPVSSTVIFGLIAALAIARLT* |
| Ga0066903_1039584961 | 3300005764 | Tropical Forest Soil | MHIGTVGAYPVTVGWLIAIVVLILAILGLVGVVLLDKNTAFGMLGALAIAR |
| Ga0066903_1045502652 | 3300005764 | Tropical Forest Soil | MHIATVGNLPVTIGWLIGLIVLILTILGLVGVLPNTPLVIFGLIGALAVARLL* |
| Ga0081455_1001782912 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MQIATVGSYPVTIGWLIALLVLILAILGLVGVVPTSPTVVFGLIGALAVARLT* |
| Ga0081455_100357798 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MRLATVGAYPVTLGWVIAVVVLILAIIGLVGALPMNQTVVFGLIAALAVARLV* |
| Ga0081455_107450952 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MQIGTVGTYPVTIGWLIAIVVLLIAILGLVGAIPFTPTVVFGLLAALAVARLT* |
| Ga0066652_1002202785 | 3300006046 | Soil | MHIATVGSYPVTLGWLIALLVLVLAILGLVGVLPMTVTVVFGLLAALAVARLT* |
| Ga0070715_105971253 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MMPAFTVGAYPYTLGAIIAILVLLLAILGLLNVIPFTATIVFGLIAALSIARLT* |
| Ga0075425_1017275371 | 3300006854 | Populus Rhizosphere | MQIGTVGTYTVTIGWLIAILVLILAILGLVSAIPFTPTVIFGLLAALAVARLT* |
| Ga0075425_1018701542 | 3300006854 | Populus Rhizosphere | MQITTVGSMAITIGWLVALLVLILAILGLVGAIPFTPTTVFAFIAALAIARLV* |
| Ga0105098_100012604 | 3300009081 | Freshwater Sediment | MQIATVGAYPLTIGSLIAVLVLILAVLGMAGVLPFTPVFVFGLLAALAIARLT* |
| Ga0111539_108261523 | 3300009094 | Populus Rhizosphere | MQLGTIGTYPVTIGWLIALLVLILAILGLVAAIPFTPTTVFAFIAALAIARLT* |
| Ga0105245_112758942 | 3300009098 | Miscanthus Rhizosphere | MQIATVGTMAITIGWLIALLVLILAILGLVGVLPMDKSVIFGLFAALAVARLT* |
| Ga0105104_101014923 | 3300009168 | Freshwater Sediment | MQIATVGAYPLTIGSLIAVLVLILAVLGMAGVLPFTPVFVFGLLAGLAIARLT* |
| Ga0126374_104694633 | 3300009792 | Tropical Forest Soil | MHIATVGNLPVTIGWLIALIVLILAILGLVGVLPNTPLVIFGLIGALGIARLT* |
| Ga0126304_101980654 | 3300010037 | Serpentine Soil | MQLGTIGSYAITIGWLIALLVLILAILGLVNVLPMSQTVVFGLIAALAVARLT* |
| Ga0126314_100800806 | 3300010042 | Serpentine Soil | MQIATVGSYALTVGWLIALIVLLLAILGLISVIPLTPTVVFGLFAALAVARLI* |
| Ga0126314_101513824 | 3300010042 | Serpentine Soil | MQIATVGSYALTVGWLIALIVLLLAILGLISVIPLTPTVVFGLFAALAVARLT* |
| Ga0126380_107311542 | 3300010043 | Tropical Forest Soil | MHIATVGNLPVTIGWLIGLIVLILAILGLVGVLPNTPLVIFGLIGALAVARLL* |
| Ga0126382_101210155 | 3300010047 | Tropical Forest Soil | MQIGTVGTYAVGLGSVIALVALIIAILGLVGVVPTSPQVVFSLIAALAVARLT* |
| Ga0126382_116746821 | 3300010047 | Tropical Forest Soil | MQIATVGTYPVTIGWLIAILVLLLAILGLVNVVPTTPTVVFGLIAALAVARLT* |
| Ga0127503_109300327 | 3300010154 | Soil | VYGGWIGALIAGLVLLLAILGLLHVVPLSETVVFGMFIGLAVARLV* |
| Ga0126370_100121248 | 3300010358 | Tropical Forest Soil | MQFQMSAPVITIGWLIALLVLILAILGLVGVLPSTPLVIFGLIGALAAARLL* |
| Ga0126370_101247583 | 3300010358 | Tropical Forest Soil | MHVATVGSLAVTVGWLIALIVLILAILGLVGVLPNTPLVIFGLIGALAVARLL* |
| Ga0126370_102057971 | 3300010358 | Tropical Forest Soil | MQIGTYTLGIGGIIAILVLLLAILGMLSVLPQTPVVIFGLIAALAVARLIP* |
| Ga0126370_104292262 | 3300010358 | Tropical Forest Soil | MPLGTVGGIAITIGWLIALLVFILAVLGLFGVLPLGATVVFGLIAALALARLL* |
| Ga0126372_126407902 | 3300010360 | Tropical Forest Soil | MHVATVGSLAVTVGWLIALIVLILAILGLVGVLPNTPLVIFGLI |
| Ga0126378_100926315 | 3300010361 | Tropical Forest Soil | MHVATVGNYPVTIGWLIALLVLILAILGLVGVLPMTPTVLFGLIGALGVARLT* |
| Ga0126378_115247983 | 3300010361 | Tropical Forest Soil | MRVLSVGNYPVTIGWLIALVVLIIAILGVVSVVPLSPTIAFGLIGALAVARLL* |
| Ga0126377_100930245 | 3300010362 | Tropical Forest Soil | VTIGWLIALLTLILAILGLVGVLPTSPQVVFGLIAALAVARLT* |
| Ga0126377_102349752 | 3300010362 | Tropical Forest Soil | MQVTTLGSMAITIGWLIALLVLILSILGLVGVVPTSPQVVFGLLAALAVARLT* |
| Ga0126377_109733622 | 3300010362 | Tropical Forest Soil | MQIGTVGSVAVTVGWLIAIVVLLLAILGLVNVLPMSQPVIFGLVGALAVARLT* |
| Ga0126377_113950423 | 3300010362 | Tropical Forest Soil | MQIGAVGEYKVTIGWLVALLVLILAILGLVNVVPLTPVVIFGLLAALAISRLT* |
| Ga0126379_1000034325 | 3300010366 | Tropical Forest Soil | MQITTVGSLAVTVGWLIAIIILILAILGLVGVLPNTPIVVFGMLGGLAIARLL* |
| Ga0126379_1002412810 | 3300010366 | Tropical Forest Soil | MRVGAVGTYAVTVGWLIAIVVLLLAILGLVGVLSASPTVVFGLIAALAVARLT* |
| Ga0126379_101032942 | 3300010366 | Tropical Forest Soil | MQITTVGSLSVTVGWLIAIVILILAILGLVGVLANTSLIVFGLIGGLAISRLL* |
| Ga0126379_101116726 | 3300010366 | Tropical Forest Soil | MHVATVGSLAVTVGWLIALIVLILAVLGLVGVLPSTPLVIFGLIGGLAIARLL* |
| Ga0126379_101246987 | 3300010366 | Tropical Forest Soil | MHIATVGNLPVTIGWLIALIVLILAILGLVGVLPNTPLVSFGLIGALGIARLT* |
| Ga0126379_101720352 | 3300010366 | Tropical Forest Soil | VTVGWLIAIVVLILAILGLVGVVPLDKNTAFGMLGALAIARLL* |
| Ga0126379_102323015 | 3300010366 | Tropical Forest Soil | MHIATVGNLPVTIGWLIALIVLILAILGLVGVLPNTPLVIFGLIGALGIARLL* |
| Ga0126379_108397231 | 3300010366 | Tropical Forest Soil | MHIATVGNLPVTIGWLIGLIVLILAILGLVGVLPNTPLVIFGLIGALGIARLT* |
| Ga0126381_1001052084 | 3300010376 | Tropical Forest Soil | MQIATLGNYALTLGWIVAIVVLILAIIGLVGALPMSGTVVFGLIAALAIARLI* |
| Ga0126381_1048462871 | 3300010376 | Tropical Forest Soil | NYPVTIGWLIALVVLIIAILGVVSVVPLSPTIAFGLIGALAVARLL* |
| Ga0126383_104608862 | 3300010398 | Tropical Forest Soil | MHITTLGGLPITIGWVIALVVLIIAILGIVGVVPFGLQTVFSLIAALAVARLL* |
| Ga0126383_125701071 | 3300010398 | Tropical Forest Soil | VQITTVGSLSVTIGWLIAIVILVLAILGLVGVLANTPLIIFGLIAGLAISRLV* |
| Ga0137382_100790403 | 3300012200 | Vadose Zone Soil | MHVATVGTYPVTIGWLIALLVLILAILGLVGVLPLSTTVVFGLIAALAVARLT* |
| Ga0126375_108744162 | 3300012948 | Tropical Forest Soil | VTIGWLIALLVLILAILGLVSVIPPNPPVVFGLIAALAVARLT* |
| Ga0126369_1000054521 | 3300012971 | Tropical Forest Soil | MHVATVGTYPVTIGWLIALLVLILAILGLVGVLPQSATVVFGLIAALAVARLT* |
| Ga0126369_1000054524 | 3300012971 | Tropical Forest Soil | MHVATVGTYPVTIGWLIALLVLILAILGLVGVLPMSQTVVFGLIAALAVARLT* |
| Ga0126369_100044404 | 3300012971 | Tropical Forest Soil | MQLGTVGSLAVTIGWLIALLVLILAILGLVGVLPMTQTVIFGLIGALAVARLL* |
| Ga0126369_100253848 | 3300012971 | Tropical Forest Soil | MQFQMSAPVITIGWLIALLVLILAILGLVGVLPSTPLVIFGLIGALAVARLL* |
| Ga0126369_103398152 | 3300012971 | Tropical Forest Soil | MQITTVGSLAVTIGWLLAIVILILAILGLVGVLANTPLIVFGLIGGLAISRLL* |
| Ga0126369_106157994 | 3300012971 | Tropical Forest Soil | MHVATVGSLAVTVGWLIALIVLILAILGLVGVLPSTPLVIFGLIGALAAARLL* |
| Ga0126369_123334763 | 3300012971 | Tropical Forest Soil | MQIASIGAYPVSVGALIALIVLILAILGLVGVLPSTPLVIFGLIGALAVARLL* |
| Ga0126369_134422382 | 3300012971 | Tropical Forest Soil | MHVATVGSLAVTVGWLVALIVLILAILGLVGVLPNTPLVIFGLI |
| Ga0157369_117799571 | 3300013105 | Corn Rhizosphere | VGTYPWTIGAIIALVVLLLAILGLVGVLPLSQTVVFGLFAGLAIARLT* |
| Ga0157375_117759021 | 3300013308 | Miscanthus Rhizosphere | MPTFAVGTYPWTIGAIIALLVLLLAILGLIGVVPFTQTVVFALLAALAVARLT* |
| Ga0157376_1000021324 | 3300014969 | Miscanthus Rhizosphere | MPTFAVGTYPWTIGAIIALVVLLLAILGLVGVLPLSQTVVFGLFAGLAIARLT* |
| Ga0132258_114387162 | 3300015371 | Arabidopsis Rhizosphere | MQVTTIGSMAITIGWLIALLVLILAILGLVGVVPTSPQVLFGLIAALAVARLT* |
| Ga0132258_119271264 | 3300015371 | Arabidopsis Rhizosphere | MQITTVGSMAITIGWLIAVLVLILAVLGLLSVIPTSPQVVFGLIAALAVARLT* |
| Ga0132258_120375612 | 3300015371 | Arabidopsis Rhizosphere | MVITIGWLIAIIVLLLAILGLVGVLPMSQTVIFGLIGALAVARLT* |
| Ga0210397_108716072 | 3300021403 | Soil | MQITTVGNNYAITLGWLIAVLVLLIAILGLIGVIPFTPTVVFGLVAALAVARLI |
| Ga0210392_100035716 | 3300021475 | Soil | MAITIGWLIAVVVLLIAILGLLGVVPLSQTVVFGLIAALAVARLI |
| Ga0210392_105568623 | 3300021475 | Soil | LAYGWSTDMQITTVGNNYAITLGWLIAVLLLLIAILGLIGVIPFTPTVVFGLVAALAVARLI |
| Ga0126371_105063853 | 3300021560 | Tropical Forest Soil | MQIATVGSLAVTVGWLIALIVLILAILGLVGVLPSTPLVIFGLIGGLAIARLL |
| Ga0207692_100191048 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MQVTTVGNLAITLGWLVAVLCLLIAILGLLSVVPYTAPVVFGLIAALAVARLI |
| Ga0207692_108815822 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MQLTTVNGLAITIGWLIAIVVLLIAILGLIGLVPLSQTVVFGMFAALAVARLV |
| Ga0207680_103988262 | 3300025903 | Switchgrass Rhizosphere | MPTFAVGTYPWTIGAIIAIVVLLLAVLGLVGVLPMSAPVAFGLFAALAVARLT |
| Ga0207685_101402143 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MPAFTVGAYPYTLGAIIAILVLLLAILGLLNVIPFTATIVFGLIAALSIARLT |
| Ga0207662_100068263 | 3300025918 | Switchgrass Rhizosphere | MQIATVGTMAITIGWLIALLVLILAILGLVGVLPMDKNVIFGLFAALAVARLT |
| Ga0207662_104515873 | 3300025918 | Switchgrass Rhizosphere | MQVTTIGNMAITIGWLIALLVLILAILGLVGVVPTSPQVLFGLIAALAVARLT |
| Ga0207659_1000336115 | 3300025926 | Miscanthus Rhizosphere | MQITTVGNMAITIGWLIALLVLILAILGLVGVVPTSPQVLFGLIAALAVARLT |
| Ga0207687_117705591 | 3300025927 | Miscanthus Rhizosphere | MQIATVGTMAITIGWLIALLVLILAILGLVGVLPMDKSVIFGLFAALAVARLT |
| Ga0207700_100012046 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MQLTTVGNLAITIGWLIAIVVLLIAILGLIGLVPLSQTVVFGMFAALAVARLV |
| Ga0207706_105026214 | 3300025933 | Corn Rhizosphere | MQITTVGSMAITIGWLIAVLVLLLAVLGLLSVIPTSPQVVFGLIAALAVARLT |
| Ga0207675_10000035110 | 3300026118 | Switchgrass Rhizosphere | MQVTTIGSMAITIGWLIALLVLILAILGLVGALPTSPTVVFGLIAALAVARLT |
| Ga0208573_100092 | 3300026632 | Soil | MQIATVGTLAITIGWLIALIVLLLAILGLIGVVPTSPVVVFGLIGALAVARLT |
| Ga0208574_1011352 | 3300026666 | Soil | MHVATVGSYPITIGWLIALVVLLLAILGLIGVVPTSPVVVFGLIGALAVARLA |
| Ga0209819_102096204 | 3300027722 | Freshwater Sediment | MQIATVGAYPLTIGSLIAVLVLILAVLGMAGVLPFTPVFVFGLLAALAIARLT |
| Ga0209593_100480473 | 3300027743 | Freshwater Sediment | MQIATVGAYPLTIGSLIAVLVLILAVLGMAGVLPFTPVFVFGLLAGLAIARLT |
| Ga0209465_1000011740 | 3300027874 | Tropical Forest Soil | MQIATIGSVSVTIGWLIALIVLILAILGLVGVLPLNQTVGFGLIGALAVARLL |
| Ga0209465_1000029924 | 3300027874 | Tropical Forest Soil | MQIGTYTLGIGGIIAILVLLLAILGMLSVLPQTPVVIFGLIAALAVARLVP |
| Ga0209465_1000078323 | 3300027874 | Tropical Forest Soil | MQITTVGSLSVTVGWLIAIVILILAILGLVGVLANTPLIIFGLIAGLAISRLL |
| Ga0209465_1000304514 | 3300027874 | Tropical Forest Soil | MHVATVGTYPVTIGWLIALLVLILAILGLVGVLPMSQTVIFGLIAALAVARLT |
| Ga0209465_100472362 | 3300027874 | Tropical Forest Soil | MQIASIGAYPVSVGALIALIVLILAILGLVGVLPNTPLVIFGLIGALGIARLT |
| Ga0209465_100480404 | 3300027874 | Tropical Forest Soil | MQIATVGSLAVTVGWLIALVILILAILGLVGVLPATPVVVFGLIGGLAIARLL |
| Ga0209465_100593791 | 3300027874 | Tropical Forest Soil | MHVATVGSLAVTVGWLIALIVLILAILGLVGVLPSTPLVIFGLIGALAVARLL |
| Ga0209465_100955343 | 3300027874 | Tropical Forest Soil | MQITTVGSLSVTVGWLIAIVILVLAILGLVGVLPNTPIVIFGMLGGLAIARLL |
| Ga0209465_101133624 | 3300027874 | Tropical Forest Soil | MHIATVGNLPVTIGWLIALIVLILAILGLVGVLPNTPLVIFGLIGALAVARLL |
| Ga0209465_101452113 | 3300027874 | Tropical Forest Soil | MHIATVGNLPVTIGWLIGLIVLILAILGLVGVLPNTPLVIFGLIGALAVARLL |
| Ga0207428_111191122 | 3300027907 | Populus Rhizosphere | MQLGTIGTYPVTIGWLIALLVLILAILGLVAAIPFTPTTVFAFIAALAIARLT |
| Ga0307498_104898021 | 3300031170 | Soil | MPAFTVGTYPWTVGAIIAIVVLLLAILGLIGVIPLSQTVVFGLIAALAVARLT |
| ⦗Top⦘ |