NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F058285

Metagenome / Metatranscriptome Family F058285

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F058285
Family Type Metagenome / Metatranscriptome
Number of Sequences 135
Average Sequence Length 82 residues
Representative Sequence MPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTSATADTFLNVSVNNAEYSKDVSVPALVTGQPFGVLNG
Number of Associated Samples 109
Number of Associated Scaffolds 135

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 97.78 %
% of genes near scaffold ends (potentially truncated) 97.78 %
% of genes from short scaffolds (< 2000 bps) 88.15 %
Associated GOLD sequencing projects 102
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group unclassified viruses (100.000 % of family members)
NCBI Taxonomy ID 12429
Taxonomy All Organisms → Viruses → unclassified viruses

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Strait → Unclassified → Seawater
(40.000 % of family members)
Environment Ontology (ENVO) Unclassified
(86.667 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(89.630 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 0.00%    β-sheet: 45.12%    Coil/Unstructured: 54.88%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000101|DelMOSum2010_c10130713All Organisms → Viruses → unclassified viruses → Circular genetic element sp.964Open in IMG/M
3300000117|DelMOWin2010_c10080244All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1274Open in IMG/M
3300004829|Ga0068515_102641All Organisms → Viruses → unclassified viruses → Circular genetic element sp.2300Open in IMG/M
3300004829|Ga0068515_102838All Organisms → Viruses → unclassified viruses → Circular genetic element sp.2238Open in IMG/M
3300004829|Ga0068515_110483All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1164Open in IMG/M
3300005057|Ga0068511_1083586All Organisms → Viruses → unclassified viruses → Circular genetic element sp.557Open in IMG/M
3300005086|Ga0072334_10379714All Organisms → Viruses → unclassified viruses → Circular genetic element sp.745Open in IMG/M
3300005086|Ga0072334_10529934All Organisms → Viruses → unclassified viruses → Circular genetic element sp.500Open in IMG/M
3300005086|Ga0072334_10554127All Organisms → Viruses → unclassified viruses → Circular genetic element sp.500Open in IMG/M
3300005086|Ga0072334_11239300All Organisms → Viruses → unclassified viruses → Circular genetic element sp.500Open in IMG/M
3300006026|Ga0075478_10224515All Organisms → Viruses → unclassified viruses → Circular genetic element sp.569Open in IMG/M
3300006190|Ga0075446_10019533All Organisms → Viruses → unclassified viruses → Circular genetic element sp.2279Open in IMG/M
3300006334|Ga0099675_1020743All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1189Open in IMG/M
3300006413|Ga0099963_1017121All Organisms → Viruses → unclassified viruses → Circular genetic element sp.634Open in IMG/M
3300006803|Ga0075467_10285183All Organisms → Viruses → unclassified viruses → Circular genetic element sp.884Open in IMG/M
3300006803|Ga0075467_10408324All Organisms → Viruses → unclassified viruses → Circular genetic element sp.706Open in IMG/M
3300006947|Ga0075444_10314340All Organisms → Viruses → unclassified viruses → Circular genetic element sp.602Open in IMG/M
3300007266|Ga0101450_118024All Organisms → Viruses → unclassified viruses → Circular genetic element sp.2163Open in IMG/M
3300007273|Ga0101448_113316All Organisms → Viruses → unclassified viruses → Circular genetic element sp.2226Open in IMG/M
3300007345|Ga0070752_1099183All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1250Open in IMG/M
3300009124|Ga0118687_10194741All Organisms → Viruses → unclassified viruses → Circular genetic element sp.737Open in IMG/M
3300009172|Ga0114995_10143330All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1334Open in IMG/M
3300009172|Ga0114995_10173889All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1199Open in IMG/M
3300009420|Ga0114994_10611548All Organisms → Viruses → unclassified viruses → Circular genetic element sp.714Open in IMG/M
3300009428|Ga0114915_1055513All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1263Open in IMG/M
3300009432|Ga0115005_11454843All Organisms → Viruses → unclassified viruses → Circular genetic element sp.560Open in IMG/M
3300009445|Ga0115553_1318136All Organisms → Viruses → unclassified viruses → Circular genetic element sp.599Open in IMG/M
3300009447|Ga0115560_1338891All Organisms → Viruses → unclassified viruses → Circular genetic element sp.570Open in IMG/M
3300009508|Ga0115567_10217744All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1227Open in IMG/M
3300009702|Ga0114931_10938264All Organisms → Viruses → unclassified viruses → Circular genetic element sp.500Open in IMG/M
3300009703|Ga0114933_10258708All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1163Open in IMG/M
3300009705|Ga0115000_10675942All Organisms → Viruses → unclassified viruses → Circular genetic element sp.639Open in IMG/M
3300010155|Ga0098047_10393405All Organisms → Viruses → unclassified viruses → Circular genetic element sp.519Open in IMG/M
3300010300|Ga0129351_1028804All Organisms → Viruses → unclassified viruses → Circular genetic element sp.2301Open in IMG/M
3300010392|Ga0118731_107724492All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1196Open in IMG/M
3300010430|Ga0118733_102020902All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1145Open in IMG/M
3300012920|Ga0160423_10595103All Organisms → Viruses → unclassified viruses → Circular genetic element sp.749Open in IMG/M
3300012952|Ga0163180_10229727All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1284Open in IMG/M
3300013010|Ga0129327_10598106All Organisms → Viruses → unclassified viruses → Circular genetic element sp.608Open in IMG/M
3300017697|Ga0180120_10113452All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1170Open in IMG/M
3300017710|Ga0181403_1128828All Organisms → Viruses → unclassified viruses → Circular genetic element sp.528Open in IMG/M
3300017713|Ga0181391_1037531All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1167Open in IMG/M
3300017714|Ga0181412_1152676All Organisms → Viruses → unclassified viruses → Circular genetic element sp.519Open in IMG/M
3300017717|Ga0181404_1142307All Organisms → Viruses → unclassified viruses → Circular genetic element sp.580Open in IMG/M
3300017724|Ga0181388_1119261All Organisms → Viruses → unclassified viruses → Circular genetic element sp.628Open in IMG/M
3300017726|Ga0181381_1081392All Organisms → Viruses → unclassified viruses → Circular genetic element sp.692Open in IMG/M
3300017727|Ga0181401_1046390All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1202Open in IMG/M
3300017727|Ga0181401_1049398All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1155Open in IMG/M
3300017728|Ga0181419_1049069All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1106Open in IMG/M
3300017728|Ga0181419_1132573All Organisms → Viruses → unclassified viruses → Circular genetic element sp.603Open in IMG/M
3300017730|Ga0181417_1011359All Organisms → Viruses → unclassified viruses → Circular genetic element sp.2288Open in IMG/M
3300017733|Ga0181426_1092765All Organisms → Viruses → unclassified viruses → Circular genetic element sp.605Open in IMG/M
3300017734|Ga0187222_1056639All Organisms → Viruses → unclassified viruses → Circular genetic element sp.909Open in IMG/M
3300017739|Ga0181433_1043803All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1146Open in IMG/M
3300017740|Ga0181418_1094711All Organisms → Viruses → unclassified viruses → Circular genetic element sp.725Open in IMG/M
3300017742|Ga0181399_1055208All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1030Open in IMG/M
3300017748|Ga0181393_1072915All Organisms → Viruses → unclassified viruses → Circular genetic element sp.908Open in IMG/M
3300017750|Ga0181405_1044415All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1180Open in IMG/M
3300017752|Ga0181400_1055198All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1223Open in IMG/M
3300017753|Ga0181407_1016354All Organisms → Viruses → unclassified viruses → Circular genetic element sp.2075Open in IMG/M
3300017755|Ga0181411_1062019All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1138Open in IMG/M
3300017755|Ga0181411_1123468All Organisms → Viruses → unclassified viruses → Circular genetic element sp.755Open in IMG/M
3300017755|Ga0181411_1187098All Organisms → Viruses → unclassified viruses → Circular genetic element sp.585Open in IMG/M
3300017757|Ga0181420_1053293All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1294Open in IMG/M
3300017757|Ga0181420_1093853All Organisms → Viruses → unclassified viruses → Circular genetic element sp.928Open in IMG/M
3300017757|Ga0181420_1218809All Organisms → Viruses → unclassified viruses → Circular genetic element sp.548Open in IMG/M
3300017758|Ga0181409_1178859All Organisms → Viruses → unclassified viruses → Circular genetic element sp.616Open in IMG/M
3300017759|Ga0181414_1169706All Organisms → Viruses → unclassified viruses → Circular genetic element sp.569Open in IMG/M
3300017760|Ga0181408_1046470All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1167Open in IMG/M
3300017760|Ga0181408_1075156All Organisms → Viruses → unclassified viruses → Circular genetic element sp.887Open in IMG/M
3300017762|Ga0181422_1018387All Organisms → Viruses → unclassified viruses → Circular genetic element sp.2300Open in IMG/M
3300017762|Ga0181422_1053810All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1289Open in IMG/M
3300017762|Ga0181422_1253875All Organisms → Viruses → unclassified viruses → Circular genetic element sp.520Open in IMG/M
3300017763|Ga0181410_1057674All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1179Open in IMG/M
3300017764|Ga0181385_1018189All Organisms → Viruses → unclassified viruses → Circular genetic element sp.2253Open in IMG/M
3300017764|Ga0181385_1053922All Organisms → Viruses → unclassified viruses → Virus sp.1250Open in IMG/M
3300017765|Ga0181413_1027295All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1790Open in IMG/M
3300017767|Ga0181406_1017200All Organisms → Viruses → unclassified viruses → Circular genetic element sp.2303Open in IMG/M
3300017767|Ga0181406_1054687All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1231Open in IMG/M
3300017768|Ga0187220_1132003All Organisms → Viruses → unclassified viruses → Circular genetic element sp.755Open in IMG/M
3300017769|Ga0187221_1064520All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1156Open in IMG/M
3300017772|Ga0181430_1051765All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1273Open in IMG/M
3300017773|Ga0181386_1179639All Organisms → Viruses → unclassified viruses → Circular genetic element sp.641Open in IMG/M
3300017775|Ga0181432_1182339All Organisms → Viruses → unclassified viruses → Circular genetic element sp.654Open in IMG/M
3300017775|Ga0181432_1203556All Organisms → Viruses → unclassified viruses → Circular genetic element sp.620Open in IMG/M
3300017776|Ga0181394_1062468All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1234Open in IMG/M
3300017779|Ga0181395_1195139All Organisms → Viruses → unclassified viruses → Circular genetic element sp.630Open in IMG/M
3300017782|Ga0181380_1022944All Organisms → Viruses → unclassified viruses → Circular genetic element sp.2314Open in IMG/M
3300017782|Ga0181380_1077801All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1163Open in IMG/M
3300017783|Ga0181379_1027005All Organisms → Viruses → unclassified viruses → Circular genetic element sp.2294Open in IMG/M
3300017786|Ga0181424_10114220All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1164Open in IMG/M
3300020289|Ga0211621_1055543All Organisms → Viruses → unclassified viruses → Circular genetic element sp.542Open in IMG/M
3300020336|Ga0211510_1144559All Organisms → Viruses → unclassified viruses → Circular genetic element sp.527Open in IMG/M
3300020358|Ga0211689_1170478All Organisms → Viruses → unclassified viruses → Circular genetic element sp.599Open in IMG/M
3300020396|Ga0211687_10113569All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1138Open in IMG/M
3300022061|Ga0212023_1008559All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1283Open in IMG/M
3300022074|Ga0224906_1055285All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1260Open in IMG/M
3300022074|Ga0224906_1074740All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1036Open in IMG/M
3300022074|Ga0224906_1129033All Organisms → Viruses → unclassified viruses → Circular genetic element sp.726Open in IMG/M
3300022164|Ga0212022_1066027All Organisms → Viruses → unclassified viruses → Circular genetic element sp.556Open in IMG/M
3300022178|Ga0196887_1067557All Organisms → Viruses → unclassified viruses → Circular genetic element sp.867Open in IMG/M
3300022187|Ga0196899_1175782All Organisms → Viruses → unclassified viruses → Circular genetic element sp.580Open in IMG/M
3300024334|Ga0228671_1116876All Organisms → Viruses → unclassified viruses → Circular genetic element sp.629Open in IMG/M
3300024335|Ga0228672_1080099All Organisms → Viruses → unclassified viruses → Circular genetic element sp.954Open in IMG/M
3300024417|Ga0228650_1109861All Organisms → Viruses → unclassified viruses → Circular genetic element sp.744Open in IMG/M
(restricted) 3300024518|Ga0255048_10059133All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1914Open in IMG/M
3300025138|Ga0209634_1042319All Organisms → Viruses → unclassified viruses → Circular genetic element sp.2310Open in IMG/M
3300025138|Ga0209634_1113713All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1169Open in IMG/M
3300025276|Ga0208814_1045804All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1302Open in IMG/M
3300025652|Ga0208134_1061076All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1153Open in IMG/M
3300025870|Ga0209666_1048546All Organisms → Viruses → unclassified viruses → Circular genetic element sp.2298Open in IMG/M
3300025889|Ga0208644_1155507All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1043Open in IMG/M
3300026134|Ga0208815_1011688All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1223Open in IMG/M
3300026134|Ga0208815_1013755All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1105Open in IMG/M
3300026134|Ga0208815_1046491All Organisms → Viruses → unclassified viruses → Circular genetic element sp.573Open in IMG/M
3300027668|Ga0209482_1129914All Organisms → Viruses → unclassified viruses → Circular genetic element sp.766Open in IMG/M
3300027686|Ga0209071_1229461All Organisms → Viruses → unclassified viruses → Circular genetic element sp.513Open in IMG/M
3300027687|Ga0209710_1151369All Organisms → Viruses → unclassified viruses → Circular genetic element sp.842Open in IMG/M
3300027714|Ga0209815_1113009All Organisms → Viruses → unclassified viruses → Circular genetic element sp.894Open in IMG/M
3300027752|Ga0209192_10173138All Organisms → Viruses → unclassified viruses → Circular genetic element sp.838Open in IMG/M
3300027813|Ga0209090_10190004All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1064Open in IMG/M
3300027847|Ga0209402_10719639All Organisms → Viruses → unclassified viruses → Circular genetic element sp.544Open in IMG/M
(restricted) 3300027865|Ga0255052_10600676All Organisms → Viruses → unclassified viruses → Circular genetic element sp.540Open in IMG/M
3300028671|Ga0257132_1025665All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1265Open in IMG/M
3300029293|Ga0135211_1017783All Organisms → Viruses → unclassified viruses → Circular genetic element sp.761Open in IMG/M
3300029308|Ga0135226_1030163All Organisms → Viruses → unclassified viruses → Circular genetic element sp.554Open in IMG/M
3300029309|Ga0183683_1014384All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1836Open in IMG/M
3300029345|Ga0135210_1006445All Organisms → Viruses → unclassified viruses → Circular genetic element sp.968Open in IMG/M
3300031622|Ga0302126_10041854All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1963Open in IMG/M
3300031622|Ga0302126_10264485All Organisms → Viruses → unclassified viruses → Circular genetic element sp.590Open in IMG/M
3300031637|Ga0302138_10187451All Organisms → Viruses → unclassified viruses → Circular genetic element sp.695Open in IMG/M
3300031848|Ga0308000_10330802All Organisms → Viruses → unclassified viruses → Circular genetic element sp.580Open in IMG/M
3300032274|Ga0316203_1218525All Organisms → Viruses → unclassified viruses → Circular genetic element sp.524Open in IMG/M
3300032277|Ga0316202_10038600All Organisms → Viruses → unclassified viruses → Circular genetic element sp.2267Open in IMG/M
3300034418|Ga0348337_091961All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1019Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater40.00%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine11.85%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous8.15%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine7.41%
Marine OceanicEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine Oceanic2.22%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater2.22%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient2.22%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine2.22%
Marine WaterEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Water2.22%
Marine HarborEnvironmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor2.22%
WaterEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Water2.96%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean1.48%
MarineEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Marine1.48%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater1.48%
Microbial MatEnvironmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat1.48%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine1.48%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface1.48%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.74%
Marine WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine Water0.74%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.74%
MarineEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine0.74%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment0.74%
Marine Surface WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water0.74%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.74%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.74%
Marine Surface WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine Surface Water0.74%
SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment0.74%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000101Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010EnvironmentalOpen in IMG/M
3300000117Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010EnvironmentalOpen in IMG/M
3300004829Marine water microbial communities from the Pohang Bay, Korea with extracellular vesicles - Pohang-EVsEnvironmentalOpen in IMG/M
3300005057Marine water microbial communities from the East Sea, Korea with extracellular vesicles - East-Sea-0.2umEnvironmentalOpen in IMG/M
3300005086Microbial Community from Halfdan Field MHDA3EnvironmentalOpen in IMG/M
3300006026Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006190Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNAEnvironmentalOpen in IMG/M
3300006334Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_0025mEnvironmentalOpen in IMG/M
3300006413Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_2_0025mEnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006947Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNAEnvironmentalOpen in IMG/M
3300007266Marine coastal surface water microbial communities in Port Hacking, Sydney, Australia ? TJ16 time pointEnvironmentalOpen in IMG/M
3300007273Marine coastal surface water microbial communities in Port Hacking, Sydney, Australia ? TJ14 time pointEnvironmentalOpen in IMG/M
3300007345Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30EnvironmentalOpen in IMG/M
3300009124Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsfEnvironmentalOpen in IMG/M
3300009172Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154EnvironmentalOpen in IMG/M
3300009420Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152EnvironmentalOpen in IMG/M
3300009428Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55EnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009445Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331EnvironmentalOpen in IMG/M
3300009447Pelagic marine microbial communities from North Sea - COGITO_mtgs_110509EnvironmentalOpen in IMG/M
3300009508Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412EnvironmentalOpen in IMG/M
3300009702Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV14_V59a metaGEnvironmentalOpen in IMG/M
3300009703Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaGEnvironmentalOpen in IMG/M
3300009705Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128EnvironmentalOpen in IMG/M
3300010155Marine viral communities from the Subarctic Pacific Ocean - 12_ETSP_OMZ_AT15267 metaGEnvironmentalOpen in IMG/M
3300010300Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNAEnvironmentalOpen in IMG/M
3300010392Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385EnvironmentalOpen in IMG/M
3300010430Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samplesEnvironmentalOpen in IMG/M
3300012920Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaGEnvironmentalOpen in IMG/M
3300012952Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 MetagenomeEnvironmentalOpen in IMG/M
3300013010Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNAEnvironmentalOpen in IMG/M
3300017697Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2)EnvironmentalOpen in IMG/M
3300017710Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28EnvironmentalOpen in IMG/M
3300017713Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11EnvironmentalOpen in IMG/M
3300017714Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15EnvironmentalOpen in IMG/M
3300017717Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25EnvironmentalOpen in IMG/M
3300017724Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17EnvironmentalOpen in IMG/M
3300017726Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24EnvironmentalOpen in IMG/M
3300017727Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20EnvironmentalOpen in IMG/M
3300017728Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24EnvironmentalOpen in IMG/M
3300017730Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13EnvironmentalOpen in IMG/M
3300017733Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23EnvironmentalOpen in IMG/M
3300017734Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 (version 2)EnvironmentalOpen in IMG/M
3300017739Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10EnvironmentalOpen in IMG/M
3300017740Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13EnvironmentalOpen in IMG/M
3300017742Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21EnvironmentalOpen in IMG/M
3300017748Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21EnvironmentalOpen in IMG/M
3300017750Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29EnvironmentalOpen in IMG/M
3300017752Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22EnvironmentalOpen in IMG/M
3300017753Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26EnvironmentalOpen in IMG/M
3300017755Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09EnvironmentalOpen in IMG/M
3300017757Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22EnvironmentalOpen in IMG/M
3300017758Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30EnvironmentalOpen in IMG/M
3300017759Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28EnvironmentalOpen in IMG/M
3300017760Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16EnvironmentalOpen in IMG/M
3300017762Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18EnvironmentalOpen in IMG/M
3300017763Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20EnvironmentalOpen in IMG/M
3300017764Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11EnvironmentalOpen in IMG/M
3300017765Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28EnvironmentalOpen in IMG/M
3300017767Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20EnvironmentalOpen in IMG/M
3300017768Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2)EnvironmentalOpen in IMG/M
3300017769Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2)EnvironmentalOpen in IMG/M
3300017772Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10EnvironmentalOpen in IMG/M
3300017773Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24EnvironmentalOpen in IMG/M
3300017775Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17EnvironmentalOpen in IMG/M
3300017776Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23EnvironmentalOpen in IMG/M
3300017779Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300017783Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10EnvironmentalOpen in IMG/M
3300017786Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18EnvironmentalOpen in IMG/M
3300020289Marine microbial communities from Tara Oceans - TARA_B100000242 (ERX556122-ERR599019)EnvironmentalOpen in IMG/M
3300020336Marine microbial communities from Tara Oceans - TARA_E500000081 (ERX289008-ERR315860)EnvironmentalOpen in IMG/M
3300020358Marine microbial communities from Tara Oceans - TARA_B100000768 (ERX555925-ERR599009)EnvironmentalOpen in IMG/M
3300020396Marine microbial communities from Tara Oceans - TARA_B100000767 (ERX555915-ERR599122)EnvironmentalOpen in IMG/M
3300022061Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v2)EnvironmentalOpen in IMG/M
3300022074Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2)EnvironmentalOpen in IMG/M
3300022164Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2)EnvironmentalOpen in IMG/M
3300022178Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3)EnvironmentalOpen in IMG/M
3300022187Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3)EnvironmentalOpen in IMG/M
3300024334Seawater microbial communities from Monterey Bay, California, United States - 89DEnvironmentalOpen in IMG/M
3300024335Seawater microbial communities from Monterey Bay, California, United States - 90DEnvironmentalOpen in IMG/M
3300024417Seawater microbial communities from Monterey Bay, California, United States - 62DEnvironmentalOpen in IMG/M
3300024518 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_2EnvironmentalOpen in IMG/M
3300025138Marine viral communities from the Pacific Ocean - LP-40 (SPAdes)EnvironmentalOpen in IMG/M
3300025276Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes)EnvironmentalOpen in IMG/M
3300025652Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes)EnvironmentalOpen in IMG/M
3300025870Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300026134Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3438_5245 (SPAdes)EnvironmentalOpen in IMG/M
3300027668Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027686Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG108-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027687Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes)EnvironmentalOpen in IMG/M
3300027714Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027752Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes)EnvironmentalOpen in IMG/M
3300027813Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes)EnvironmentalOpen in IMG/M
3300027847Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 (SPAdes)EnvironmentalOpen in IMG/M
3300027865 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_21EnvironmentalOpen in IMG/M
3300028671Metatranscriptome of marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_10m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029293Marine harbor viral communities from the Indian Ocean - SCH2EnvironmentalOpen in IMG/M
3300029308Marine harbor viral communities from the Indian Ocean - SRB2EnvironmentalOpen in IMG/M
3300029309Marine viral communities collected during Tara Oceans survey from station TARA_100 - TARA_R100001440EnvironmentalOpen in IMG/M
3300029345Marine harbor viral communities from the Indian Ocean - SCH1EnvironmentalOpen in IMG/M
3300031622Marine microbial communities from Western Arctic Ocean, Canada - CB4_20mEnvironmentalOpen in IMG/M
3300031637Marine microbial communities from Western Arctic Ocean, Canada - CBN3_32.1EnvironmentalOpen in IMG/M
3300031848Marine microbial communities from water near the shore, Antarctic Ocean - #3EnvironmentalOpen in IMG/M
3300032274Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 1EnvironmentalOpen in IMG/M
3300032277Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotiteEnvironmentalOpen in IMG/M
3300034418Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2010_1013071313300000101MarineMPLVQKTLTLASGATSDNILANTNYEFVDGNVRLRVASAVDTAGTSATADTFLNVSVNNAEYSKDVSVPALVTGQPFGVLNGSYTNN
DelMOWin2010_1008024433300000117MarineLANTNYEFVDGNVRLRVASAVDTAGTTATADTFLNVSVNNAEYSKDVSVPALVTGQPFGVLNGAYTNNDLLTTGSQRNR
Ga0068515_10264113300004829Marine WaterMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTSATSDTFLNVSVNNAEYSKDVSVPALVTGQPFGVLNGAYLNNDLLTTG
Ga0068515_10283853300004829Marine WaterMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTSATADTFLNVSVNNAEYSKDVSV
Ga0068515_11048313300004829Marine WaterMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTSATADTFLNVSVNNAEYSKDVSVP
Ga0068511_108358613300005057Marine WaterMPLVQKTLTLAAGATSDNILANTNYEFIDGNVRLRVASAVDTAGTSATADTFLNVSVNNAEYSKDVSVPALVSGQPFGVLNGAYINNDLLT
Ga0072334_1037971423300005086WaterMPLVQKTLTLASGATSDNILANTNYEFVDGNVRLRVASAVDTAGTSATADTFLNVSVNNAEYSKDVSVPALVSG
Ga0072334_1052993413300005086WaterMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTTATADTFLNVSVNNAEYSKDVSVPALVTGQPFGVLN
Ga0072334_1055412713300005086WaterMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTTATADTFLNVSVNNAEYSKDVSVPALV
Ga0072334_1123930013300005086WaterMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTTATADTFLNVSVNNAEYSKDVSVPALIT
Ga0075478_1022451513300006026AqueousMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTSATADTFLNVSVNNAEYSKDVSVPALVTGQPFGVLNGSY
Ga0075446_1001953313300006190MarineMPLVQKTLTLTAGATSDNILANTNYEFVDGNVRIRVASACDSAGTSATADTFLNVSVNNAEFSKDVSVPALV
Ga0099675_102074333300006334MarineMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTSATADTFLNVSVNNAEYSKDVSVPALVSGQPFGVLNGAY
Ga0099963_101712113300006413MarineMPLVQKTLTLAAGATSDNILADTNYEFVDGNVRLRVASAVDTAGTSATSDTFLNVSVNNAEYSKDVSVPAL
Ga0075467_1028518313300006803AqueousMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTSATADTFLNVSVNNAEYSKDVSVPALVTGQPF
Ga0075467_1040832413300006803AqueousMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRIASAVDTAGTTATADTFLNVSVNNAEFSKDVSVPALTTGQPFGVLNGN
Ga0075444_1031434013300006947MarineMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRISSAVDTAGTTATADTFLNVSVNNAEFSKDVSVPALVT
Ga0101450_11802413300007266Marine Surface WaterMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTSATADTFLNVSVNNAEYSKDVSVPALVSGQPFGVLN
Ga0101448_11331633300007273Marine Surface WaterMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTSATADTFLNVSVNNAEYSKDVSVPALVSGQPFGVLNGXWSVEWSIS*
Ga0070752_109918313300007345AqueousMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTSATSDTFLNVSVNNAEYSKDVSVPALVSGQPFGVLNGSYLNNDL
Ga0118687_1019474123300009124SedimentMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTSATADTFLNVSVNNAEYSKDVSVPALVDGQPFGVLSGAYTNNDLITTGS
Ga0114995_1014333013300009172MarineMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRISSAVDTAGTSATADTFLNVSVNNAEYSKDVSVPALVTGQPFG
Ga0114995_1017388913300009172MarineMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRISSAVDTAGTSATADTFLNVSVNNAEYSKDVSVPALTTGQPFGVLNGNYVNNDL
Ga0114994_1061154823300009420MarineMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTSASADTFLNVSVNNAEYSKDVSVPALVTGQPFGVLNGNYVNNDLLT
Ga0114915_105551313300009428Deep OceanMPLVQKTLTLTSGATSDNILANTNYEFIDGNVRIRVASAVDSAGTTATADTFLNVSVNNAEFSKDVSVPGLVTGQPFG
Ga0115005_1145484323300009432MarineMPLVQKTITLAAGATSDNILANTNYEFVDGNVRLRISSAVDTAGTTATADTFLNVSVNNAEYSKDVSVPALVTGQPFGVLNGNYVNNDLLT
Ga0115553_131813613300009445Pelagic MarineMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTSATADTFLNVSVNNAEYSKDVSVPALVTGQP
Ga0115560_133889113300009447Pelagic MarineMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTSATADTFLNVSVNNAEYSKDVSVPALVTGQPFGVLNGSYTNNDLLTT
Ga0115567_1021774433300009508Pelagic MarineMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTTATADTFLNVSVNNAEYSKDVSVPALVTGQPFGVLNGSY
Ga0114931_1093826423300009702Deep SubsurfaceMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTNATSDTFLNVSVNNAEYSKDVSVPALVTGQPFG
Ga0114933_1025870833300009703Deep SubsurfaceMPLVQKTLTLAAGATSDNILANTNYEFIDGNVRLRVASAVDTAGTSATADTFLNVSVNNAEYSKDVSVPALVSGQPFGVL
Ga0115000_1067594213300009705MarineMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRIASAVDTAGTTATVDTFLNVSVNNAEYSKDVSVPALVTGQPFGVLNGN
Ga0098047_1039340523300010155MarineMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTTATADTFLNVSVNNAEYSKDVSVPALVTGQPFGVLNGSYTNNDL
Ga0129351_102880413300010300Freshwater To Marine Saline GradientMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTSATSDTFLNVSVNNAEYSKDVSVPALVSGQPFGVLNGSYLNNDLLTTGSQRN
Ga0118731_10772449213300010392MarineMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTSATADTFLNVSVNNAEYSKDVSVPALV
Ga0118733_10202090233300010430Marine SedimentMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTSETADTFLNVSVNNAEYSKDVSVPALVTGQPFG
Ga0160423_1059510313300012920Surface SeawaterMPLVQKTLTLAAGATSDNILANTNYEFIDGNVRLRVASAVDTAGTSATSDTFLNVSVNNAEYSKDVSVPALVSGQP
Ga0163180_1022972723300012952SeawaterMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTTATADTFLNVSVNNAEYSKDVSVPALVTGQPF
Ga0129327_1059810623300013010Freshwater To Marine Saline GradientMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRIRVASAVDTAGKSATADTFLNVSVNNAEYSKEVSVPALV
Ga0180120_1011345233300017697Freshwater To Marine Saline GradientMPLVQKTLTLASGATSDNILANTNYEFVDGNVRLRVASAVDTAGTSATADTFLNVSVNNAEYSKDVSV
Ga0181403_112882823300017710SeawaterMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTSATADTFLNVSVNNAEYSKDVSVPALVTGQPFGVLNGSYT
Ga0181391_103753113300017713SeawaterMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTTATADTFLNVSVNNAEYSKDVSVPALVTGQPFG
Ga0181412_115267623300017714SeawaterMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTSATADTFLNVSVNNAEYSKDVSVPALVTGQPFGVLNGSYINNDLLTTGS
Ga0181404_114230723300017717SeawaterMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTTATADTFLNVSVNNAEYSKDVSVPALVTGQPFGVLNGSYVNN
Ga0181388_111926123300017724SeawaterMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTSATADTFLNVSVNNAEYSKDVSVPALVSGQPFGVLNGS
Ga0181381_108139223300017726SeawaterMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRIASAVDTAGTSSTADTFLNVSVNNAEYSKDVSVPALVTGQPFGVLNGSYTNNDLLTTGSQR
Ga0181401_104639033300017727SeawaterMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTTATADTFLNVSVNNAEYSKDVSVPAIVSGQPFGV
Ga0181401_104939833300017727SeawaterMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTSATADTFLNVSVNNAEYSKDV
Ga0181419_104906913300017728SeawaterMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTSATADTFLNVSVNNAEYSKDVSVPALVTGQPFGVLNGSYTN
Ga0181419_113257313300017728SeawaterMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRIASAVDTAGTTATADTFLNVSVNNAEYSKDVSVNALVTGQPSA
Ga0181417_101135913300017730SeawaterMPLVQKTLTLAAGATSDNILANTNYEFIDGNVRLRVASAVDTAGTSATADTFLNVSVNNAEYSKDVSVPALVTGQPFGVLNGSYLNNDL
Ga0181426_109276513300017733SeawaterMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTSATADTFLNVSVNNAEYSKDVSVPALVTGQPFGVLNGSYLNN
Ga0187222_105663913300017734SeawaterMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTSATADTFLNVSVNNAEYSKDVSVPALVTGQPFAVLNGS
Ga0181433_104380333300017739SeawaterMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTSATADTFLNVSVNNAEYSKDVSVPALVTGQPFGVL
Ga0181418_109471113300017740SeawaterMPLVQKTLTLAAGATSDNILANTNYEFIDGNVRLRVASAVDTAGTSATSDTFLNVSVNNAEYSKDVSVPALTTGQPFGVLNGSYINNDL
Ga0181399_105520823300017742SeawaterMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTSATADTFLNVSVNNAEYSKDVSVPALTTGQPFGV
Ga0181393_107291513300017748SeawaterMPLVQKTLTLAAGATSDNILANTNYEFIDGNVRLRVASAVDTAGTSATADTFLNVSVNNAEYSKDVS
Ga0181405_104441513300017750SeawaterMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTTATADTFLNVSVNNAEYSKDVSVPALVSGQPFGVLNG
Ga0181400_105519813300017752SeawaterMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTSATADTFLNVSVNNAEYSKDVSVPALVTGQPFGVLNGSYI
Ga0181407_101635443300017753SeawaterMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTSSTADTFLNVSVNNAEYSKDVSVPALVTGQPFGVLNGSYINNDLLTTGSQR
Ga0181411_106201933300017755SeawaterMPLVQKTLTLASGATSDNILANTNYEFVDGNVRLRVASAVDTAGTTATADTFLNVSVNNAEYSKDVSVPALV
Ga0181411_112346823300017755SeawaterMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTSATADTFLNVSVNNAEYSKDVSVPALVTGQPFGVLNGSYTNNDLL
Ga0181411_118709813300017755SeawaterMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTTATADTFLNVSVNNAEYSKDVSVPALVTGQPFGVLNGSYTNN
Ga0181420_105329333300017757SeawaterMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTSATSDTFLNVSVNNAEYSKDVSVPALVTGQPFGVLNGSYTNNDLITTGSQR
Ga0181420_109385313300017757SeawaterMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVSSAVDTAGTSATADTFLNVSVNNAEYSKD
Ga0181420_121880923300017757SeawaterMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTSSTSDTFLNVSVNNAEYSKDVSVPALVTGQPFGVLNGSYT
Ga0181409_117885923300017758SeawaterMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTSSTSDTFLNVSVNNAEYSKDVSVPALVTGQPFGVLNGSYTNND
Ga0181414_116970613300017759SeawaterMPLVQKTLTLAAGATSDNILANTNYEFIDGNTRLRVASAVDTAGTSATADTFLNVSVNNAEYSKD
Ga0181408_104647033300017760SeawaterMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTTATADTFLNVSVNNAEYSKDVSVPALVTGQPFGVLNG
Ga0181408_107515613300017760SeawaterMPLVQKTLTLAAGATSDNILANTNYEFIDGNVRLRVASAVDTAGTSATADTFLNVSVNNAEYSKDVSVPALVTGQPFGVLNGSYLNN
Ga0181422_101838713300017762SeawaterMPLVQKTITLAAGATSDNLLANTNYEFIDGNVRLRVASAVDTAGTSATADTFLNVSVNNAEYSKDVSVPALVTGQPFGV
Ga0181422_105381033300017762SeawaterMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTTATADTFLNVSVNNAEFSKDVSVPALNAGQPFGVL
Ga0181422_125387523300017762SeawaterMPLVQKTLTLTAGATSDNILANTNYEFVDGNVRVRVASAVDTAGTSATADTFLNVSVNNAEYSKDVSVPALTSGQPFGVLNGSYVNNDLLTT
Ga0181410_105767433300017763SeawaterMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTTATADTFLNVSVNNAEYSKDVSVPALVTGQPFGVLNGSYTN
Ga0181385_101818953300017764SeawaterMPLVQKTLTLAAGATSDNILADTNYEFVDGNVRLRVASAVDTAGTSATADTFLNVSVNNAEYSKDVSVPALVTGQPFGVLNGSYVNNDLLT
Ga0181385_105392213300017764SeawaterATSDNILANTNYEFIDGNVRLRVASAVDVAGTSETADTFLNVSVNNAEYSKDVSVPALVSGQPFGV
Ga0181413_102729513300017765SeawaterMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTSATADTFLNVSVNNAEYSKDVSVPALVSGQPFG
Ga0181406_101720013300017767SeawaterMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTSATADTFLNVSVNNAEYSKDVSVPALVSGQPFGVLNQS
Ga0181406_105468733300017767SeawaterMPLVQKTLTLAAGATSDNILANTNYEFIDGNVRLRVASAVDTAGTSATADTFLNVSVNNAEYSKDVSVPALVTGQPFGVLNGSYINN
Ga0187220_113200323300017768SeawaterMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRISSAVDTAGTSATADTFLNVSVNNAEYSKDVSVPALVSGQPFGVL
Ga0187221_106452033300017769SeawaterMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTTATADTFLNVSVNNAEYSKDVSVPALVSGQPFGVLNGSYTNNDLLTT
Ga0181430_105176533300017772SeawaterMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTSATADTFLNVSVNKAKHSKHVSVPALVTGQPFGVLNGSYTNNDLLTTGS
Ga0181386_117963913300017773SeawaterMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRIASAVDTAGTSATADTFLNVSINIAEYSKDVSVPALVTG
Ga0181432_118233913300017775SeawaterMPLVQKTLTLAAGATSDNILANTNYEFIDGNVRLRVASAVDVAGTSETADTFLNVSVNNAEYSKDVSVPALVTGQPFGVLNGSYINNDLLTTG
Ga0181432_120355623300017775SeawaterMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTTATADTFLNVSVNNAEYSKDVSVPAL
Ga0181394_106246833300017776SeawaterMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTSATADTFLNVSVNNAEYSKDVSVPALVTGQPFGVLNGSYTNND
Ga0181395_119513913300017779SeawaterMPLVQKTLTLAAGATSDNILANTNYEFIDGNVRLRVASAVDTAGTSATADTFLNVSVNNAEYSKDVSVPALVTGQPFGVLNGSYINNDLLTT
Ga0181380_102294453300017782SeawaterMPLVQKTLTLAAGATSDNILANTNYEFIDGNVRLRVSSAVDTAGTTATADTFLNVSVNNAEFSKDVSVPAL
Ga0181380_107780133300017782SeawaterMPLVQKTLTLAAGATSDNILANTNYEFIDGNVRLRVASAVDTAGTSATADTFLNVSVNNAEYSKDVSV
Ga0181379_102700513300017783SeawaterMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTSATADTFLNVSVNNAEYSKDVSVPALVTGQPFGVLNGSYTNNDL
Ga0181424_1011422033300017786SeawaterMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRIASAVDTAGTTATADTFLNVSVNNAEYSKDVSVPALVTGQ
Ga0211621_105554313300020289MarineMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTSATADTFLNVSVNNAEYSKDVSVPALVSGQPFGVLNGAYLI
Ga0211510_114455923300020336MarineMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVSSAVDQAGTSATADTFLNVSVNNAEYSKDVSVPALVTGQPFGVLNGSYINNDL
Ga0211689_117047823300020358MarineMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVSSAVDTAGTTATADTFLNVSVNNAEFSKDVSVPALTTGQPFGVLN
Ga0211687_1011356933300020396MarineMPLVQKTLTLAAGATSDNILANTNYEFIDGNVRLRVSSAVDTAGTSATADTFLNVSVNNAEFSKDVSVPALNAGQPFGVLNGSYVNNDLITTG
Ga0212023_100855933300022061AqueousMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTSATADTFLNVSVNNAEYSKDVSVPA
Ga0224906_105528513300022074SeawaterMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDSAGTSSTSDTFLNVSVNNAEYSKDVSVPALVTGQPFGVLNGSYINNDLLT
Ga0224906_107474013300022074SeawaterMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTTATADTFLNVSVNNAEYSKDVSVPALVTG
Ga0224906_112903313300022074SeawaterMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTSATADTFLNVSVNNAEYSKDVSVPALVTGQPFGVLNG
Ga0212022_106602713300022164AqueousMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTSATADTFLNVSVNNAEYSKDVSVPAL
Ga0196887_106755723300022178AqueousMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTSATADTFLNVSVNNAEYSKDVSVPALVTGQPFG
Ga0196899_117578223300022187AqueousMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTSATADTFLNVSVNNAEYSKDVSVPALVTGQPFGVLN
Ga0228671_111687613300024334SeawaterMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTSATADTFLNVSVNNAEYSKDVSVPALVTGQPFGVLNGS
Ga0228672_108009923300024335SeawaterMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTSATADTFLNVSVNNAEYSKDVSVPALVTGQPFGVLNGSYTNN
Ga0228650_110986123300024417SeawaterMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTSATADTFLNVSVNNAEYSKDVS
(restricted) Ga0255048_1005913343300024518SeawaterMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRIASAVDTAGTTATADTFLNVSVNNAEYSKDVSVPALVTGQPFG
Ga0209634_104231913300025138MarineMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTTSTADTFLNVSVNNAEFSKDVSVPALNAGQPFGVLNGSYVNND
Ga0209634_111371313300025138MarineMPLVQKTLTLAAGATSDNILANTNYEFIDGNVRLRVASAVDTAGTSATLDTFLNVSVNNAEYSKDVSVPALVTGQPFGVLNGSYINN
Ga0208814_104580433300025276Deep OceanMPLVQKTLTLTSGATSDNILANTNYEFIDGNVRIRVASAVDSAGTTATADTFLNVSVNNAEFSKDVSVPGLVTGQPFGVLNGTYVNNDLIT
Ga0208134_106107633300025652AqueousMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTSATADTFLNVSVNNAEYSKDVSVPALVTGQPFGV
Ga0209666_104854653300025870MarineMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTSATADTFLNVSVNNAEYSKDVSVPALVTGQPFGVLNGSYTNNDLLTTGSQRN
Ga0208644_115550723300025889AqueousMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTSATADTFLNVSVNNAEYSKDVSVPALVTGQPFGVLNGSYTNNDLLTTGSQR
Ga0208815_101168813300026134Marine OceanicMPLVQKRVSLAAGATSDNILANTNYEFIDGNVRVRTAVACDTAGTSTADNLFNVSVNNSEYAKDVSIPVEVTGQPFSVLSGMYQTNDLITTGAQ
Ga0208815_101375513300026134Marine OceanicMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVSSAVDTAGTSATADTFLNVSVNNAEYSKDV
Ga0208815_104649123300026134Marine OceanicMPLVQKRVSLAAGATSDNILANTNYEFIDGNVRVRTAVATDTAGTATADNLFNVSVNNSEYAKDVSI
Ga0209482_112991413300027668MarineMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRISSAVDTAGTTATADTFINVSVNNAEFSKDVSVPALVT
Ga0209071_122946113300027686MarineMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRISSAVDTAGTTATADTFINVSVNNAEFSKDVSVPALV
Ga0209710_115136923300027687MarineMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRISSAVDTAGTSATADTFLNVSVNNAEYSKDVSVPALVTGQPFGVLNGNYVNNDLLTTGA
Ga0209815_111300913300027714MarineMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRISSAVDTAGTTATADTFLNVSVNNAEFSKDVSVPALVTGTPFGVLNGTY
Ga0209192_1017313823300027752MarineMPLVQKTITLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTAETVDTFLNVSVNNAEYSKDVSVPALVTGQPFGVLNGNYV
Ga0209090_1019000423300027813MarineMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVSSAVDTAGTSATADTFLNVSVNNAEYSKDVSVPALVTGQPFGVLNGNYVNNDLLTTGA
Ga0209402_1071963913300027847MarineMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRIASAVDTAGTTATVDTFLNVSVNNAEYSKDVSVPALV
(restricted) Ga0255052_1060067613300027865SeawaterMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTSATADTFLNVSVNNAEYSKDVSVPALVSGQPFGVLNGSY
Ga0257132_102566513300028671MarineMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRIASAVDTAGTSATADTFLNVSVNNAEYSKDVSVPALNAGQPFGVLNGSYVNND
Ga0135211_101778323300029293Marine HarborMPLVQKTLTLAAGATSDNILANTNYEFIDGNTRLRVASAVDTAGTSATSDTFLNVSVNNAEYSKDVSVPAMDRDWETNS
Ga0135226_103016323300029308Marine HarborMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTSATADTFLNVSVNNAEYSKDVSVPALVSGQPFGVLNGAYLNNDLLTTGSQRN
Ga0183683_101438433300029309MarineMPLVQKTLTLAAGATSDNILANTNYEFIDGNVRLRVASAVDTAGTSATADTFLNVSVNNAEYSKDVSVPALVSGQPFGVLNGSYLNNDLLTTGSQR
Ga0135210_100644513300029345Marine HarborMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTSATSDTFLNVSVNNAEYSKDVSVPALVSGQPFGS
Ga0302126_1004185443300031622MarineMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRISSAVDTAGTSATADTFLNVSVNNAEYSKDVSVPAL
Ga0302126_1026448523300031622MarineMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRISSAVDVAGTTATVDTFLNVSVNNAEFSKDVSVPALVTGSPFGVL
Ga0302138_1018745123300031637MarineMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRISSAVDVAGTTATVDTFLNVSVNNAEFSKDVSVPALVTGSPFGVLNGTYVNNDL
Ga0308000_1033080213300031848MarineMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRISSAVDTAGTSATADTFLNVSVNNAEFSKDVSVPALNAGQPFGVL
Ga0316203_121852523300032274Microbial MatMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTSATADTFLNVSVNNAEYSKDVSVPALVSGQPFGVLNGSYTNNDLL
Ga0316202_1003860013300032277Microbial MatMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRIASAVDTAGTSATADTFLNVSVNNAEYSKDVSVPALVTGQPFGVLNGSYTNN
Ga0348337_091961_2_2203300034418AqueousMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRIASAVDTAGTSATADTFLNVSVNNAEYSKDVSVPALVT

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.