Basic Information | |
---|---|
Family ID | F056988 |
Family Type | Metagenome |
Number of Sequences | 137 |
Average Sequence Length | 42 residues |
Representative Sequence | VGEAEEIPLFFTLIPVLALLSNYDRENCLINVGTEG |
Number of Associated Samples | 90 |
Number of Associated Scaffolds | 137 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 27.21 % |
% of genes near scaffold ends (potentially truncated) | 93.43 % |
% of genes from short scaffolds (< 2000 bps) | 70.80 % |
Associated GOLD sequencing projects | 82 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.35 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (76.642 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil (24.817 % of family members) |
Environment Ontology (ENVO) | Unclassified (48.905 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.934 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 39.06% β-sheet: 0.00% Coil/Unstructured: 60.94% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 137 Family Scaffolds |
---|---|---|
PF01527 | HTH_Tnp_1 | 9.49 |
PF13683 | rve_3 | 7.30 |
PF00665 | rve | 3.65 |
PF05592 | Bac_rhamnosid | 3.65 |
PF13751 | DDE_Tnp_1_6 | 2.19 |
PF13378 | MR_MLE_C | 2.19 |
PF00078 | RVT_1 | 1.46 |
PF00689 | Cation_ATPase_C | 1.46 |
PF01676 | Metalloenzyme | 1.46 |
PF02518 | HATPase_c | 0.73 |
PF00128 | Alpha-amylase | 0.73 |
PF13242 | Hydrolase_like | 0.73 |
PF07676 | PD40 | 0.73 |
PF01272 | GreA_GreB | 0.73 |
PF01695 | IstB_IS21 | 0.73 |
PF04964 | Flp_Fap | 0.73 |
PF01061 | ABC2_membrane | 0.73 |
PF03796 | DnaB_C | 0.73 |
PF01850 | PIN | 0.73 |
PF00561 | Abhydrolase_1 | 0.73 |
PF12840 | HTH_20 | 0.73 |
PF12704 | MacB_PCD | 0.73 |
PF00121 | TIM | 0.73 |
PF04014 | MazE_antitoxin | 0.73 |
PF02899 | Phage_int_SAM_1 | 0.73 |
PF00176 | SNF2-rel_dom | 0.73 |
PF09285 | Elong-fact-P_C | 0.73 |
PF03625 | DUF302 | 0.73 |
PF14103 | DUF4276 | 0.73 |
PF00702 | Hydrolase | 0.73 |
PF03781 | FGE-sulfatase | 0.73 |
PF04255 | DUF433 | 0.73 |
PF01804 | Penicil_amidase | 0.73 |
PF13091 | PLDc_2 | 0.73 |
PF00023 | Ank | 0.73 |
PF03734 | YkuD | 0.73 |
PF00772 | DnaB | 0.73 |
PF01661 | Macro | 0.73 |
PF04055 | Radical_SAM | 0.73 |
PF05565 | Sipho_Gp157 | 0.73 |
PF08531 | Bac_rhamnosid_N | 0.73 |
PF00005 | ABC_tran | 0.73 |
PF13620 | CarboxypepD_reg | 0.73 |
PF00135 | COesterase | 0.73 |
PF02698 | DUF218 | 0.73 |
PF04655 | APH_6_hur | 0.73 |
PF14384 | BrnA_antitoxin | 0.73 |
PF08388 | GIIM | 0.73 |
PF00271 | Helicase_C | 0.73 |
PF04389 | Peptidase_M28 | 0.73 |
PF13784 | Fic_N | 0.73 |
PF00589 | Phage_integrase | 0.73 |
COG ID | Name | Functional Category | % Frequency in 137 Family Scaffolds |
---|---|---|---|
COG4584 | Transposase | Mobilome: prophages, transposons [X] | 3.65 |
COG3408 | Glycogen debranching enzyme (alpha-1,6-glucosidase) | Carbohydrate transport and metabolism [G] | 3.65 |
COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 3.65 |
COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 3.65 |
COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 3.65 |
COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 1.46 |
COG0474 | Magnesium-transporting ATPase (P-type) | Inorganic ion transport and metabolism [P] | 1.46 |
COG2366 | Acyl-homoserine lactone (AHL) acylase PvdQ | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.73 |
COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 0.73 |
COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 0.73 |
COG3847 | Flp pilus assembly protein, pilin Flp | Extracellular structures [W] | 0.73 |
COG3570 | Streptomycin 6-kinase | Defense mechanisms [V] | 0.73 |
COG3439 | Uncharacterized conserved protein, DUF302 family | Function unknown [S] | 0.73 |
COG3280 | Maltooligosyltrehalose synthase | Carbohydrate transport and metabolism [G] | 0.73 |
COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 0.73 |
COG2949 | Uncharacterized periplasmic protein SanA, affects membrane permeability for vancomycin | Cell wall/membrane/envelope biogenesis [M] | 0.73 |
COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 0.73 |
COG0149 | Triosephosphate isomerase | Carbohydrate transport and metabolism [G] | 0.73 |
COG2272 | Carboxylesterase type B | Lipid transport and metabolism [I] | 0.73 |
COG2110 | O-acetyl-ADP-ribose deacetylase (regulator of RNase III), contains Macro domain | Translation, ribosomal structure and biogenesis [J] | 0.73 |
COG1523 | Pullulanase/glycogen debranching enzyme | Carbohydrate transport and metabolism [G] | 0.73 |
COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 0.73 |
COG1434 | Lipid carrier protein ElyC involved in cell wall biogenesis, DUF218 family | Cell wall/membrane/envelope biogenesis [M] | 0.73 |
COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 0.73 |
COG1262 | Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domain | Posttranslational modification, protein turnover, chaperones [O] | 0.73 |
COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 0.73 |
COG0782 | Transcription elongation factor, GreA/GreB family | Transcription [K] | 0.73 |
COG0366 | Glycosidase/amylase (phosphorylase) | Carbohydrate transport and metabolism [G] | 0.73 |
COG0296 | 1,4-alpha-glucan branching enzyme | Carbohydrate transport and metabolism [G] | 0.73 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 76.64 % |
Unclassified | root | N/A | 23.36 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000567|JGI12270J11330_10138525 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 943 | Open in IMG/M |
3300000597|AF_2010_repII_A1DRAFT_10017073 | All Organisms → cellular organisms → Bacteria | 1995 | Open in IMG/M |
3300000955|JGI1027J12803_103536211 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300001396|JGI20175J14863_1024484 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
3300001423|JGI20199J14953_1002888 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1649 | Open in IMG/M |
3300001453|JGI20197J15136_1003792 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1719 | Open in IMG/M |
3300001870|JGI24129J20441_1038590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1144 | Open in IMG/M |
3300002066|JGIcombinedJ21911_10037979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1690 | Open in IMG/M |
3300006795|Ga0075520_1447062 | Not Available | 513 | Open in IMG/M |
3300006854|Ga0075425_100371897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca → Desulfobacca acetoxidans | 1646 | Open in IMG/M |
3300009029|Ga0066793_10320642 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 894 | Open in IMG/M |
3300009029|Ga0066793_10646783 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 601 | Open in IMG/M |
3300009094|Ga0111539_10136975 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2867 | Open in IMG/M |
3300009523|Ga0116221_1005205 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8148 | Open in IMG/M |
3300009523|Ga0116221_1020926 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3431 | Open in IMG/M |
3300009523|Ga0116221_1103638 | Not Available | 1256 | Open in IMG/M |
3300009523|Ga0116221_1119814 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1155 | Open in IMG/M |
3300009523|Ga0116221_1128625 | All Organisms → cellular organisms → Bacteria | 1109 | Open in IMG/M |
3300009523|Ga0116221_1555985 | Not Available | 504 | Open in IMG/M |
3300009524|Ga0116225_1074051 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 1601 | Open in IMG/M |
3300009524|Ga0116225_1142816 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
3300009524|Ga0116225_1490581 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 546 | Open in IMG/M |
3300009525|Ga0116220_10161035 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
3300009630|Ga0116114_1141341 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
3300009639|Ga0116122_1167611 | Not Available | 695 | Open in IMG/M |
3300009641|Ga0116120_1253080 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300009672|Ga0116215_1380417 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
3300009683|Ga0116224_10161902 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 1076 | Open in IMG/M |
3300009700|Ga0116217_10338563 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca → Desulfobacca acetoxidans | 962 | Open in IMG/M |
3300009700|Ga0116217_10599762 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
3300009824|Ga0116219_10061782 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2208 | Open in IMG/M |
3300009824|Ga0116219_10089716 | All Organisms → cellular organisms → Bacteria | 1797 | Open in IMG/M |
3300009824|Ga0116219_10106811 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1632 | Open in IMG/M |
3300009839|Ga0116223_10035406 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3358 | Open in IMG/M |
3300009839|Ga0116223_10248550 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 1073 | Open in IMG/M |
3300010379|Ga0136449_100921733 | All Organisms → cellular organisms → Bacteria | 1420 | Open in IMG/M |
3300010379|Ga0136449_101159325 | All Organisms → cellular organisms → Bacteria | 1222 | Open in IMG/M |
3300012913|Ga0157298_10191835 | Not Available | 648 | Open in IMG/M |
3300014160|Ga0181517_10008268 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 8500 | Open in IMG/M |
3300014160|Ga0181517_10043323 | Not Available | 2820 | Open in IMG/M |
3300014162|Ga0181538_10109596 | All Organisms → cellular organisms → Bacteria | 1617 | Open in IMG/M |
3300014164|Ga0181532_10022613 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4519 | Open in IMG/M |
3300014164|Ga0181532_10113472 | All Organisms → cellular organisms → Bacteria | 1671 | Open in IMG/M |
3300014200|Ga0181526_10119798 | All Organisms → cellular organisms → Bacteria | 1684 | Open in IMG/M |
3300014489|Ga0182018_10198501 | All Organisms → cellular organisms → Bacteria | 1123 | Open in IMG/M |
3300014490|Ga0182010_10081678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1593 | Open in IMG/M |
3300014491|Ga0182014_10028854 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 4352 | Open in IMG/M |
3300014491|Ga0182014_10344627 | Not Available | 754 | Open in IMG/M |
3300014494|Ga0182017_10191996 | All Organisms → cellular organisms → Bacteria | 1308 | Open in IMG/M |
3300014494|Ga0182017_10278296 | All Organisms → cellular organisms → Bacteria | 1052 | Open in IMG/M |
3300014494|Ga0182017_10355560 | Not Available | 911 | Open in IMG/M |
3300014494|Ga0182017_10943295 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300014495|Ga0182015_10212522 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1289 | Open in IMG/M |
3300014496|Ga0182011_10190436 | All Organisms → cellular organisms → Bacteria | 1399 | Open in IMG/M |
3300014496|Ga0182011_11016168 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300014498|Ga0182019_10248082 | All Organisms → cellular organisms → Bacteria | 1170 | Open in IMG/M |
3300014502|Ga0182021_10171744 | Not Available | 2528 | Open in IMG/M |
3300014502|Ga0182021_10384094 | All Organisms → cellular organisms → Bacteria | 1664 | Open in IMG/M |
3300014502|Ga0182021_10417784 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1592 | Open in IMG/M |
3300014502|Ga0182021_10825314 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
3300014839|Ga0182027_10042180 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5801 | Open in IMG/M |
3300014839|Ga0182027_10581385 | All Organisms → cellular organisms → Bacteria | 1208 | Open in IMG/M |
3300014839|Ga0182027_11201659 | Not Available | 762 | Open in IMG/M |
3300014839|Ga0182027_11541148 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
3300014839|Ga0182027_11874046 | Not Available | 578 | Open in IMG/M |
3300014839|Ga0182027_11999364 | Not Available | 555 | Open in IMG/M |
3300015360|Ga0163144_10135293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3712 | Open in IMG/M |
3300015360|Ga0163144_11420976 | Not Available | 616 | Open in IMG/M |
3300016294|Ga0182041_10099907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2128 | Open in IMG/M |
3300017988|Ga0181520_10000264 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 115835 | Open in IMG/M |
3300017988|Ga0181520_10083719 | Not Available | 2804 | Open in IMG/M |
3300017988|Ga0181520_10595803 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
3300018017|Ga0187872_10356253 | Not Available | 627 | Open in IMG/M |
3300018020|Ga0187861_10030582 | Not Available | 3044 | Open in IMG/M |
3300018037|Ga0187883_10433969 | Not Available | 674 | Open in IMG/M |
3300019082|Ga0187852_1395409 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 540 | Open in IMG/M |
3300020057|Ga0163151_10063383 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2584 | Open in IMG/M |
3300020083|Ga0194111_10409032 | Not Available | 896 | Open in IMG/M |
3300020084|Ga0194110_10413491 | Not Available | 907 | Open in IMG/M |
3300020186|Ga0163153_10043354 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 3163 | Open in IMG/M |
3300020192|Ga0163147_10049236 | All Organisms → cellular organisms → Bacteria | 3218 | Open in IMG/M |
3300020222|Ga0194125_10391424 | Not Available | 882 | Open in IMG/M |
3300022756|Ga0222622_10403259 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 963 | Open in IMG/M |
3300023088|Ga0224555_1013008 | All Organisms → cellular organisms → Bacteria | 4796 | Open in IMG/M |
3300023088|Ga0224555_1107719 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 861 | Open in IMG/M |
3300025477|Ga0208192_1017569 | All Organisms → cellular organisms → Bacteria | 1807 | Open in IMG/M |
3300025764|Ga0209539_1339937 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
3300025878|Ga0209584_10090716 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1121 | Open in IMG/M |
3300026377|Ga0257171_1080221 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 575 | Open in IMG/M |
3300027625|Ga0208044_1010081 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 3670 | Open in IMG/M |
3300027641|Ga0208827_1074396 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 1067 | Open in IMG/M |
3300027641|Ga0208827_1123143 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 745 | Open in IMG/M |
3300027676|Ga0209333_1015226 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2225 | Open in IMG/M |
3300027735|Ga0209261_10019277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1696 | Open in IMG/M |
3300027840|Ga0209683_10064850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1618 | Open in IMG/M |
3300027854|Ga0209517_10002443 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 26226 | Open in IMG/M |
3300027854|Ga0209517_10012780 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 8853 | Open in IMG/M |
3300027854|Ga0209517_10126295 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1675 | Open in IMG/M |
3300027854|Ga0209517_10183561 | All Organisms → cellular organisms → Bacteria | 1306 | Open in IMG/M |
3300027907|Ga0207428_10216395 | All Organisms → cellular organisms → Bacteria | 1438 | Open in IMG/M |
3300028653|Ga0265323_10003992 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Verrucomicrobium → unclassified Verrucomicrobium → Verrucomicrobium sp. GAS474 | 6402 | Open in IMG/M |
3300028679|Ga0302169_10155210 | Not Available | 577 | Open in IMG/M |
3300029817|Ga0247275_1016889 | All Organisms → cellular organisms → Bacteria | 2406 | Open in IMG/M |
3300029817|Ga0247275_1027824 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1717 | Open in IMG/M |
3300029999|Ga0311339_10141432 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2848 | Open in IMG/M |
3300030007|Ga0311338_11091895 | Not Available | 766 | Open in IMG/M |
3300030659|Ga0316363_10010338 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5597 | Open in IMG/M |
3300030659|Ga0316363_10024005 | All Organisms → cellular organisms → Bacteria | 3240 | Open in IMG/M |
3300030706|Ga0310039_10183284 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
3300031028|Ga0302180_10007930 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7460 | Open in IMG/M |
3300031028|Ga0302180_10081889 | All Organisms → cellular organisms → Bacteria | 1877 | Open in IMG/M |
3300031234|Ga0302325_10211505 | All Organisms → cellular organisms → Bacteria | 3314 | Open in IMG/M |
3300031235|Ga0265330_10197185 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 851 | Open in IMG/M |
3300031235|Ga0265330_10379648 | Not Available | 597 | Open in IMG/M |
3300031236|Ga0302324_100005799 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 26850 | Open in IMG/M |
3300031525|Ga0302326_10202249 | All Organisms → cellular organisms → Bacteria | 3313 | Open in IMG/M |
3300031576|Ga0247727_10004748 | All Organisms → cellular organisms → Bacteria | 28452 | Open in IMG/M |
3300031576|Ga0247727_10021573 | All Organisms → cellular organisms → Bacteria | 9714 | Open in IMG/M |
3300031847|Ga0310907_10781495 | Not Available | 533 | Open in IMG/M |
3300032070|Ga0315279_10236322 | Not Available | 1382 | Open in IMG/M |
3300032118|Ga0315277_10746967 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp. | 933 | Open in IMG/M |
3300032160|Ga0311301_11574450 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 802 | Open in IMG/M |
3300032160|Ga0311301_11647084 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 777 | Open in IMG/M |
3300032516|Ga0315273_10021798 | All Organisms → cellular organisms → Bacteria | 8454 | Open in IMG/M |
3300032805|Ga0335078_11373149 | Not Available | 800 | Open in IMG/M |
3300032805|Ga0335078_12114538 | Not Available | 597 | Open in IMG/M |
3300032828|Ga0335080_10061346 | All Organisms → cellular organisms → Bacteria | 4163 | Open in IMG/M |
3300032828|Ga0335080_10977995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 863 | Open in IMG/M |
3300032892|Ga0335081_10267392 | All Organisms → cellular organisms → Bacteria | 2293 | Open in IMG/M |
3300033158|Ga0335077_10730258 | Not Available | 1016 | Open in IMG/M |
3300033888|Ga0334792_014057 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3034 | Open in IMG/M |
3300033888|Ga0334792_031518 | All Organisms → cellular organisms → Bacteria | 1777 | Open in IMG/M |
3300034070|Ga0334822_061391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 807 | Open in IMG/M |
3300034070|Ga0334822_065774 | Not Available | 776 | Open in IMG/M |
3300034124|Ga0370483_0341435 | Not Available | 519 | Open in IMG/M |
3300034125|Ga0370484_0221086 | Not Available | 521 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 24.82% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 13.87% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 6.57% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 5.84% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.11% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.38% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 4.38% |
Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat | 3.65% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.92% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.92% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.19% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.19% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.19% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 2.19% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 1.46% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.46% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.46% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 1.46% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 1.46% |
Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 1.46% |
Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 1.46% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.73% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.73% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.73% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.73% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.73% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.73% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.73% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.73% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.73% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001396 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-072012 | Environmental | Open in IMG/M |
3300001423 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 deep-092012 | Environmental | Open in IMG/M |
3300001453 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 deep-092012 | Environmental | Open in IMG/M |
3300001870 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-211 | Environmental | Open in IMG/M |
3300002066 | Barrow Graham LP Ref core NGADG0002-211 (Barrow Graham LP Ref core NGADG0002-211,NGADG0004-311, ASSEMBLY_DATE=20131004) | Environmental | Open in IMG/M |
3300006795 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
3300009630 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 | Environmental | Open in IMG/M |
3300009639 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 | Environmental | Open in IMG/M |
3300009641 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 | Environmental | Open in IMG/M |
3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300012913 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2 | Environmental | Open in IMG/M |
3300014160 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaG | Environmental | Open in IMG/M |
3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
3300014490 | Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaG | Environmental | Open in IMG/M |
3300014491 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG | Environmental | Open in IMG/M |
3300014494 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaG | Environmental | Open in IMG/M |
3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
3300014496 | Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaG | Environmental | Open in IMG/M |
3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300015360 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.BULKMAT1 | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300017988 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG | Environmental | Open in IMG/M |
3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
3300018020 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100 | Environmental | Open in IMG/M |
3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
3300019082 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40 | Environmental | Open in IMG/M |
3300020057 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP5.IB-2 | Environmental | Open in IMG/M |
3300020083 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300m | Environmental | Open in IMG/M |
3300020084 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200m | Environmental | Open in IMG/M |
3300020186 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP6.IB-1 | Environmental | Open in IMG/M |
3300020192 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica- Oligotrophic Lake LV.19.MP6.G1 | Environmental | Open in IMG/M |
3300020222 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015034 Kigoma Deep Cast 250m | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300023088 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 30-34 | Environmental | Open in IMG/M |
3300025477 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 (SPAdes) | Environmental | Open in IMG/M |
3300025764 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0011-312 (SPAdes) | Environmental | Open in IMG/M |
3300025878 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes) | Environmental | Open in IMG/M |
3300026377 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-B | Environmental | Open in IMG/M |
3300027625 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027735 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare1Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027840 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Host-Associated | Open in IMG/M |
3300028679 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N1_3 | Environmental | Open in IMG/M |
3300029817 | Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Bog25 | Environmental | Open in IMG/M |
3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Host-Associated | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
3300031576 | Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25 | Environmental | Open in IMG/M |
3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
3300032070 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_20 | Environmental | Open in IMG/M |
3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033888 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-3-X1 | Environmental | Open in IMG/M |
3300034070 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-3-M | Environmental | Open in IMG/M |
3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
3300034125 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12270J11330_101385251 | 3300000567 | Peatlands Soil | PLFFTFIPILALLGNHDRENCLIYVDTEGLIPLTP* |
AF_2010_repII_A1DRAFT_100170731 | 3300000597 | Forest Soil | VGEAEEIPLFFTLIPVLALLSNYDRENCLINVGTEG |
JGI1027J12803_1035362112 | 3300000955 | Soil | MFAAGKTVEEAEEIPLIFKIDFVLALLCNYDRENCLINLGTE |
JGI20175J14863_10244843 | 3300001396 | Arctic Peat Soil | VGEAEDIPLFFTLIPVLALLSNYDRENCLINVGTEG |
JGI20199J14953_10028883 | 3300001423 | Arctic Peat Soil | VGEAEDIPLFFTLIPVLALLSNYDQGNCLINVGTEGQLR |
JGI20197J15136_10037923 | 3300001453 | Arctic Peat Soil | VGEAEDIPLFFTLIPVLALLSNYDQGNCLINVGTEGAL |
JGI24129J20441_10385903 | 3300001870 | Arctic Peat Soil | VGEAEDIPVFFTLIPVLALLSNYDRENCLINVGTE |
JGIcombinedJ21911_100379793 | 3300002066 | Arctic Peat Soil | VGEAEDIPVFFTLIPVLALLSNYDRENCLINVGTEGGI |
Ga0075520_14470622 | 3300006795 | Arctic Peat Soil | VGEAEEIPLFFTLIPVLALLSNYDQENCLINVGTEG |
Ga0075425_1003718971 | 3300006854 | Populus Rhizosphere | VEEVEEIPLIFKLISFLALLCNYDQESCLINLGTEGLERLG |
Ga0066793_103206423 | 3300009029 | Prmafrost Soil | LPEEIPLFFTLIPVLALLSNYDQENCLINVGTEGG |
Ga0066793_106467831 | 3300009029 | Prmafrost Soil | SLRSVAGKTVGEAEDIPLFVTLIPVLALLSNYDQGNCLINVGTEG* |
Ga0111539_101369751 | 3300009094 | Populus Rhizosphere | VGEAEEIPLFFTLIPILALLSNYDQENCLINVGTEG |
Ga0116221_10052051 | 3300009523 | Peatlands Soil | KTVGEAEEIPLFFTFIPILALLGNHDRENCLIYVDTEGQNVWM* |
Ga0116221_10209261 | 3300009523 | Peatlands Soil | AGKTVGEAEEIPLFFTFIPILALLGNHDRENCLIYVDTEGSPGSCFCPS* |
Ga0116221_11036381 | 3300009523 | Peatlands Soil | AGKTVGEAEEIPLFFTFIPILALLGNHDRENCLIYVDTEGLIPLTP* |
Ga0116221_11198141 | 3300009523 | Peatlands Soil | AGKTVGEAEEIPLFFTFIPILALLGNHDRENCLIYVDTEGRVP* |
Ga0116221_11286252 | 3300009523 | Peatlands Soil | EAEEIPLFFTFIPILALLGNHDRENCLIYVDTEG* |
Ga0116221_15559851 | 3300009523 | Peatlands Soil | TVGEAEDIPLFLTLIPVLALLSNYDQENCLINIGTEGAIRTALEWPIK* |
Ga0116225_10740513 | 3300009524 | Peatlands Soil | VGEAEEIPLFFTFIPILALLGNHDRENCLIYVDTEGQNVWM* |
Ga0116225_11428161 | 3300009524 | Peatlands Soil | EAEEIPLFFTFIPILALLGNHDRENCLIYVDTEGSPGSCFCPS* |
Ga0116225_14905811 | 3300009524 | Peatlands Soil | EEIPLFFTFIPILALLGNHDRENCLIYVDTEGRVP* |
Ga0116220_101610351 | 3300009525 | Peatlands Soil | VGEAEDIPLFLTLIPVLALLSNYDQENCLINIGTEGAKEASL* |
Ga0116114_11413411 | 3300009630 | Peatland | VGEAEEIPLLFTLIPILALLSNYDQENCLINVGTE |
Ga0116122_11676111 | 3300009639 | Peatland | VGEAEEIPLFFTLIPVLALLSNYDRENCLINVGTEGPNRLKRMYFQ* |
Ga0116120_12530801 | 3300009641 | Peatland | VGEAEEIPLFFTLIPVLALLSNYDRENCLINIGTEGGLKKLGWD |
Ga0116215_13804171 | 3300009672 | Peatlands Soil | IPLFFTFIPILALLGNHDRENCLIYVDTEGPVGSPACMI* |
Ga0116224_101619022 | 3300009683 | Peatlands Soil | EAEEIPLFFTFIPILALLGNHDRENCLIYVDTEGLIPLTP* |
Ga0116217_103385631 | 3300009700 | Peatlands Soil | VGEAEDIPLFLTLIPVLALLSNYDQENCLINIGTEG |
Ga0116217_105997621 | 3300009700 | Peatlands Soil | KTVGEAEEIPLFFTFIPILALLGNHDRENCLIYVDTEG* |
Ga0116219_100617821 | 3300009824 | Peatlands Soil | AGKTVGEAEEIPLFFTFIPILALLGNHDRENCLIYVDTEGQNVWM* |
Ga0116219_100897161 | 3300009824 | Peatlands Soil | AGKTVGEAEEIPLFFTFIPILALLGNHDRENCLIYVDTEGPVGSPACMI* |
Ga0116219_101068112 | 3300009824 | Peatlands Soil | EAEEIPLFFTFIPILALLGNHDRENCLIYVDTEGRVP* |
Ga0116223_100354063 | 3300009839 | Peatlands Soil | VGEAEDIPLFLTLIPVLALLSNYDQENCLINIGTEGAIRTALEWPIK* |
Ga0116223_102485502 | 3300009839 | Peatlands Soil | AAGKTVGEAEEIPLFFTFIPILALLGNHDRENCLIYVDTEGLIPLTP* |
Ga0136449_1009217331 | 3300010379 | Peatlands Soil | AEDIPLFLTLIPVLALLSNYDQENCLINIGTEGSKPNTSSPH* |
Ga0136449_1011593251 | 3300010379 | Peatlands Soil | AGKTVGEAEEIPLFFTFIPILALLGNHDRENCLIYVDTEG* |
Ga0157298_101918352 | 3300012913 | Soil | VGEVEEIPFFFTLIPLLALLSNYDQGNCLINVGTEGAIEIVSL* |
Ga0181517_100082681 | 3300014160 | Bog | AAGKTVGEAEEIPLFFTLIPVLALLSNYDRENCLINVGTEGP* |
Ga0181517_100433232 | 3300014160 | Bog | AAGKTVGEAEEIPLFFTLIPVLALLSNYDRENCLINVGTEGS* |
Ga0181538_101095961 | 3300014162 | Bog | VGEAEDIPLFFTLIPVLALLSNYDRENCLINIGTEG |
Ga0181532_100226135 | 3300014164 | Bog | AASNTVGEAEEIPLFFTLIPVLALLSNYDRENCLINVGTEGGN* |
Ga0181532_101134721 | 3300014164 | Bog | VGEAEEIPLFFTLIPVLALLSNYDRENCLINVGTE |
Ga0181526_101197983 | 3300014200 | Bog | VGEAEEIPLVFKLMSILALLSNYDQENCLINVGTE |
Ga0182018_101985011 | 3300014489 | Palsa | EAADIPLFFTWIPILALLSNYDQQICLIHVGTEG* |
Ga0182010_100816783 | 3300014490 | Fen | VEDAEEIPLLFTLIPVLALLSNYDQENCLINVGTEG |
Ga0182010_102686363 | 3300014490 | Fen | LLFTLIPVLALLSNYDQENCLINVGTEGRSRPSASTEA* |
Ga0182014_100288546 | 3300014491 | Bog | AAGKTVGEIEEIPLFFTLIPVLALLSNYDRENCLINIGTEGGSWARF* |
Ga0182014_103446272 | 3300014491 | Bog | AAGKTVGEIEEIPLFFTLIPVLALLSNYDRENCLINIGTEGHVIPS* |
Ga0182017_101919963 | 3300014494 | Fen | AAGQTVGEAEEIPLFFTLIPVLALLSNYDQENCLINVGTEGSTKPLRS* |
Ga0182017_102782961 | 3300014494 | Fen | TMGEAGEIPLFFTLIPVLALLSNYDQENCLINVGTEGTSQDRR* |
Ga0182017_103555602 | 3300014494 | Fen | AGKTVEDAEEIPLLFTLIPVLALLSNYDQENCLINVGTEGRQLSKSSTRLAFLRT* |
Ga0182017_109432952 | 3300014494 | Fen | VEEAEEIPLFFTLIPVLALLSNYDQENCLINVGTEG |
Ga0182015_102125223 | 3300014495 | Palsa | AAGKTVREAEDIPLFFTLIPVLALLSNYDRGNCLINIGTEGGAQR* |
Ga0182011_101904363 | 3300014496 | Fen | MGEAGEIPLFFTLIPVLALLSNYDQENCLINVGTEG |
Ga0182011_110161681 | 3300014496 | Fen | GEAEEIPLFFTLIPVLALLSNYDQENCLINVGTEECRRS* |
Ga0182019_102480821 | 3300014498 | Fen | VGEAEGIPLFFTLIPVLALLSNYDQENCLINVGTEG |
Ga0182021_101717445 | 3300014502 | Fen | AGKTVEDAEEIPLLFTLIPVLALLSNYDQENCLINVGTEGRSRPSASTEA* |
Ga0182021_103840941 | 3300014502 | Fen | AAGKTVEDAEEIPLLFTLIPVLALLSNYDQENCLINVGTEGTAPRS* |
Ga0182021_104177841 | 3300014502 | Fen | VEDAEEIPLLFTLIPVLALLSNYDQENCLINVGTE |
Ga0182021_108253143 | 3300014502 | Fen | MGEAGEIPLFFTLIPVLALLSNYDQENCLINVGTEGGDQVVGDPG |
Ga0182027_100421808 | 3300014839 | Fen | AAGKTVEKTEEIPLFFTLIPVLALLSNYDQENCLINVGTEGAC* |
Ga0182027_105813851 | 3300014839 | Fen | VGEAEGIPLFFTLIPVLALLSNYDQENCLINVGTE |
Ga0182027_112016591 | 3300014839 | Fen | AAGKTVGEAEDIPLFFTLIPVLALLSNYDRENCLINVGTEGTNRP* |
Ga0182027_115411482 | 3300014839 | Fen | VEEAIEIPLFFTLIPVLALLSNYDQENCLINVGTEGG |
Ga0182027_118740461 | 3300014839 | Fen | EAEDIPLFFTLIPVLALLSNYDRENCLINVGTEGKLARAQ* |
Ga0182027_119993642 | 3300014839 | Fen | AAGKTVGEAEDIPLFFTLIPVLALLSNYDRENCLINVGTEGWLVRS* |
Ga0163144_101352931 | 3300015360 | Freshwater Microbial Mat | KTVGEAEETPLFFTLIPVLAPLSNYDRETCLINVGTEGQSRSQQRAY* |
Ga0163144_114209761 | 3300015360 | Freshwater Microbial Mat | TPLFFTLIPVLAPLSNYDRETCLINVGTEGTLML* |
Ga0182041_100999073 | 3300016294 | Soil | MGEAGEIPLFFTLIPILALLSNYDQENCLINVGTEGQ |
Ga0181520_10000264109 | 3300017988 | Bog | AAGKTVGEAEEIPLFFTLIPVLALLSNYDRENCLINVGTEGP |
Ga0181520_100837192 | 3300017988 | Bog | AAGKTVGEAEEIPLFFTLIPVLALLSNYDRENCLINVGTEGS |
Ga0181520_105958031 | 3300017988 | Bog | VGEAEEIPLVFKLMSILALLSNYDQENCLINVGTEG |
Ga0187872_103562531 | 3300018017 | Peatland | TVGEAEEIPLLFTLIPILALLSNYDQENCLINVGTEGVADDQRRGVAYQ |
Ga0187861_100305822 | 3300018020 | Peatland | SAAGKTVREAEEIPLFFTLIPVLTLLSNYDRENCLINVGTEGRLRS |
Ga0187883_104339691 | 3300018037 | Peatland | AEDIPLFFTWIPILALLSNYDQEICLIHFGTEGSLRGP |
Ga0187852_13954092 | 3300019082 | Peatland | VGEAEEIPLVFKLMSILALLSNYDQENCLINVGTEGPKHW |
Ga0163151_100633831 | 3300020057 | Freshwater Microbial Mat | SAVGKTVGEAEETPLFFTLIPVLAPLSNYDRETCLINVGTEGRAR |
Ga0194111_104090321 | 3300020083 | Freshwater Lake | KTVREAEEIPLFFTLIPVLALLSNYDRGSCLINVGTEGASAD |
Ga0194110_104134913 | 3300020084 | Freshwater Lake | SAAGKTVREAEEIPLFFTLIPVLALLSNYDRGSCLINVGTEGASAD |
Ga0163153_100433541 | 3300020186 | Freshwater Microbial Mat | VGEAEETPLFFTLIPVLAPLSNYDRETCLINVGTEGLASMPAP |
Ga0163147_100492364 | 3300020192 | Freshwater Microbial Mat | AEETPLFFTLIPVLAPLSNYDRETCLINVGTEGTLML |
Ga0194125_103914241 | 3300020222 | Freshwater Lake | EAEEIPLFFTLIPVLALLSNYDRGSCLINVGTEGASAD |
Ga0222622_104032593 | 3300022756 | Groundwater Sediment | VGEAEEIPLFFTLIPVLALLSNYDRENCLINVGTEGA |
Ga0224555_10130085 | 3300023088 | Soil | AAEIPLFFTLIPVLALLSNYDQENCLINVGTEGSKPRRSPE |
Ga0224555_11077191 | 3300023088 | Soil | SAAGKTVGEIEEIPLFFTLIPVLALLSNYDRENCLINIGTEGGSWARF |
Ga0208192_10175693 | 3300025477 | Peatland | SAAGKTVREAEEIPLFFTLIPVLTLLSNYDQENCLINVGTEGATRS |
Ga0209539_13399372 | 3300025764 | Arctic Peat Soil | SAAGKTVGEAEEIPLIFKLISILALLCNYDQENCLINVGTEGPTSDNRFRN |
Ga0209584_100907161 | 3300025878 | Arctic Peat Soil | VGELEDIPLFFTLIPVLALLSNYDRENCLINVGTEGAF |
Ga0257171_10802212 | 3300026377 | Soil | MGEAEDIPLFFTLIPVLALLSNYDRENCLINVGTEG |
Ga0208044_10100811 | 3300027625 | Peatlands Soil | VGEAEEIPLFFTFIPILALLGNHDRENCLIYVDTEGGSLRQNILTP |
Ga0208827_10743962 | 3300027641 | Peatlands Soil | KTVGEAEEIPLFFTFIPILALLGNHDRENCLIYVDTEGLIPLTP |
Ga0208827_11231433 | 3300027641 | Peatlands Soil | SAAGKTVGEAEEIPLFFTFIPILALLGNHDRENCLIYVDTEGRVP |
Ga0209333_10152261 | 3300027676 | Forest Soil | AEDIPLFFTWIPILALLSNYDQEICLIHVGTEGQLRHPCR |
Ga0209261_100192771 | 3300027735 | Wetland Sediment | VGEAEEIPLFFTLIPILALLSNYDQVHCLINVGTEGTFRP |
Ga0209683_100648503 | 3300027840 | Wetland Sediment | VGEAEEIPLFFTLIPILALLSNYDQVHCLINVGTEGSYESAAE |
Ga0209517_100024431 | 3300027854 | Peatlands Soil | EEIPLFFTFIPILALLGNHDRENCLIYVDTEGQNVWM |
Ga0209517_100127804 | 3300027854 | Peatlands Soil | SAAGKTVGEAEEIPLFFTFIPILALLGNHDRENCLIYVDTEGLIPLTP |
Ga0209517_101262952 | 3300027854 | Peatlands Soil | AEEIPLFFTFIPILALLGNHDRENCLIYVDTEGRVP |
Ga0209517_101835611 | 3300027854 | Peatlands Soil | SAAGKTVGEAEEIPLFFTFIPILALLGNHDRENCLIYVDTEG |
Ga0207428_102163951 | 3300027907 | Populus Rhizosphere | VGEAEEIPLFFTLIPILALLSNYDQENCLINVGTEGREQLAK |
Ga0265323_100039929 | 3300028653 | Rhizosphere | AEEIPLFFTLIPVLALLSNYDQENCLINVGTEGFLRSRHTCVC |
Ga0302169_101552101 | 3300028679 | Fen | SAAGQTVGEAEEIPLFFTLIPVLALLSNYDQENCLINVGTEGSTKPLRS |
Ga0247275_10168891 | 3300029817 | Soil | VGEAEEIPLLFTLIPILALLSNYDQENCLINVGTEGRA |
Ga0247275_10278241 | 3300029817 | Soil | VGEAEEIPLVFKLMSILALLSNYDQENCLINVGTEGR |
Ga0311339_101414321 | 3300029999 | Palsa | VTEDIPLFFTWIPILALLSNYDQEICLIHVGTEGV |
Ga0311338_110918952 | 3300030007 | Palsa | AADIPLFFTWIPILALLSNYDQQICLIHVGTEGQA |
Ga0316363_100103381 | 3300030659 | Peatlands Soil | AAGKTVGEAEEIPLFFTFIPILALLGNHDRENCLIYVDTEGQNVWM |
Ga0316363_100240051 | 3300030659 | Peatlands Soil | AEEIPLFFTFIPILALLGNHDRENCLIYVDTEGLIPLTP |
Ga0310039_101832841 | 3300030706 | Peatlands Soil | EEIPLFFTFIPILALLGNHDRENCLIYVDTEGPVGSPACMI |
Ga0302180_1000793017 | 3300031028 | Palsa | GVTEDIPLFFTWIPILALLSNYDQEICLIHVGTEGL |
Ga0302180_100818894 | 3300031028 | Palsa | GGEAGEAEDVPLFFIWIPILALLSNYDQVTCLIHVGTEGV |
Ga0302325_102115056 | 3300031234 | Palsa | EAGEAADIPLFFTWIPILALLSNYDQQICLIHVGTEGTDAIPL |
Ga0265330_101971851 | 3300031235 | Rhizosphere | GKTVEEAEEIPLFFTLIPVLALLSNYDQENCLINVGTEGAPSNTR |
Ga0265330_103796481 | 3300031235 | Rhizosphere | SAAGKTVEEAEEIPLFFTLIPVLALLSNYDQENCLINVGTEGFLRSRHTCVC |
Ga0302324_10000579925 | 3300031236 | Palsa | GGEAGEAADIPLFFTWIPILALLSNYDQQICLIHVGTEGPA |
Ga0302326_102022491 | 3300031525 | Palsa | AGEAADIPLFFTWIPILALLSNYDQQICLIHVGTEGTDAIPL |
Ga0247727_1000474831 | 3300031576 | Biofilm | PAAGKTVGEAEEIPLFFTLIPVLALLSNYDRENCLINVGTEGQA |
Ga0247727_1002157313 | 3300031576 | Biofilm | PAAGKTVGEAEEIPLFFTLIPVLALLSNYDRENCLINVGTEGRPINKG |
Ga0310907_107814951 | 3300031847 | Soil | LFFTLIPILALLSNYDQENCLINVGTEGRYQPWLAKRASPVL |
Ga0315279_102363222 | 3300032070 | Sediment | LFFTLIPILALLSNYDQENCLINVGTEGSLSLERVAA |
Ga0315277_107469671 | 3300032118 | Sediment | SATGKTVGEAKDIPLFFTLIPVLALLSNYDQENCLINVGTEGASPIRTRAFTERWPTL |
Ga0311301_115744502 | 3300032160 | Peatlands Soil | TVGEAEDIPLFLTLIPVLALLSNYDQENCLINIGTEGAIRTALEWPIK |
Ga0311301_116470843 | 3300032160 | Peatlands Soil | AEDIPLFLTLIPVLALLSNYDQENCLINIGTEGSKPNTSSPH |
Ga0315273_100217986 | 3300032516 | Sediment | AAAGNTVGEAEEIPLFFTSIPILALLSNYDRGSCLIHVGTEG |
Ga0335078_113731491 | 3300032805 | Soil | SAAGKTVGEAEGIPLFFTLIPVLALLSNYDRENCLINVGTEGHIAYHPG |
Ga0335078_121145381 | 3300032805 | Soil | EEIPLIFTLIPVLALLSNYNRETCLINVGTEGEKGGLAA |
Ga0335080_100613469 | 3300032828 | Soil | AEEIPLFFTLIPVLALLSNYDRENCLINVGTEGPLRTSRASGTR |
Ga0335080_109779951 | 3300032828 | Soil | GKTVGEAEEIPLFFTLIPVLALLSNYDRENCLINVGTEGGLRQ |
Ga0335081_102673921 | 3300032892 | Soil | EEIPLFFTLIPVLALLSNYDRENCLINVGTEGPLRTSRASGTR |
Ga0335077_107302581 | 3300033158 | Soil | AAGKTVGEAEEIPLFFTLIPVLALLSNYDRENCLINVGTEGRPRRLVAPSR |
Ga0334792_014057_1_138 | 3300033888 | Soil | TAGAAAEIPLFFTLIPVLALLSNYDQENCLINVGTEGSKPRRSPE |
Ga0334792_031518_1649_1777 | 3300033888 | Soil | AAEIPLFFTLIPVLALLSNYDQENCLINVGTEGRGHKGPGGQ |
Ga0334822_061391_2_154 | 3300034070 | Soil | SAAGKTVEDAEEIPLLFTLIPVLALLSNYDQENCLINVGTEGPTPRRGRG |
Ga0334822_065774_647_775 | 3300034070 | Soil | GEAEEIPLFFTLIPVLALLSNYDQENCLINVGTEGSTKPLRS |
Ga0370483_0341435_225_386 | 3300034124 | Untreated Peat Soil | VGEVEDIPLFFTLIPVLALLTNYDRENCLINVGTEGALWRWLIRGHSGAVGKL |
Ga0370484_0221086_363_491 | 3300034125 | Untreated Peat Soil | VEEAEEIPLFFTLIPVLALLSNYDQENCLINVGTEGSPKPNS |
⦗Top⦘ |