NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F056707

Metagenome Family F056707

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F056707
Family Type Metagenome
Number of Sequences 137
Average Sequence Length 48 residues
Representative Sequence LKQKEIEAAAIMMRIFLAGLAFNFDANFHELEEITKRALLQVEAEEP
Number of Associated Samples 90
Number of Associated Scaffolds 137

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Archaea
% of genes with valid RBS motifs 83.94 %
% of genes near scaffold ends (potentially truncated) 16.06 %
% of genes from short scaffolds (< 2000 bps) 89.78 %
Associated GOLD sequencing projects 83
AlphaFold2 3D model prediction Yes
3D model pTM-score0.58

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Archaea (86.131 % of family members)
NCBI Taxonomy ID 2157
Taxonomy All Organisms → cellular organisms → Archaea

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil
(24.817 % of family members)
Environment Ontology (ENVO) Unclassified
(25.547 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(36.496 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 52.00%    β-sheet: 0.00%    Coil/Unstructured: 48.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.58
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 137 Family Scaffolds
PF00072Response_reg 1.46
PF01555N6_N4_Mtase 1.46
PF09082DUF1922 1.46
PF06500FrsA-like 0.73
PF02732ERCC4 0.73
PF00528BPD_transp_1 0.73
PF01891CbiM 0.73
PF00583Acetyltransf_1 0.73
PF00702Hydrolase 0.73
PF13248zf-ribbon_3 0.73
PF01022HTH_5 0.73
PF00589Phage_integrase 0.73
PF03167UDG 0.73
PF01850PIN 0.73
PF12840HTH_20 0.73

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 137 Family Scaffolds
COG0863DNA modification methylaseReplication, recombination and repair [L] 1.46
COG1041tRNA G10 N-methylase Trm11Translation, ribosomal structure and biogenesis [J] 1.46
COG2189Adenine specific DNA methylase ModReplication, recombination and repair [L] 1.46
COG0310ABC-type Co2+ transport system, permease componentInorganic ion transport and metabolism [P] 0.73
COG0692Uracil-DNA glycosylaseReplication, recombination and repair [L] 0.73
COG1573Uracil-DNA glycosylaseReplication, recombination and repair [L] 0.73
COG1948ERCC4-type crossover junction endonucleaseReplication, recombination and repair [L] 0.73
COG3663G:T/U-mismatch repair DNA glycosylaseReplication, recombination and repair [L] 0.73


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms87.59 %
UnclassifiedrootN/A12.41 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001213|JGIcombinedJ13530_102971650Not Available665Open in IMG/M
3300001213|JGIcombinedJ13530_103531281All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon985Open in IMG/M
3300003432|JGI20214J51088_10129999All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1782Open in IMG/M
3300004014|Ga0055456_10256783All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon612Open in IMG/M
3300004057|Ga0055496_10047790All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon905Open in IMG/M
3300004063|Ga0055483_10013977All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon2181Open in IMG/M
3300004063|Ga0055483_10239290All Organisms → cellular organisms → Archaea → TACK group → Candidatus Verstraetearchaeota → Candidatus Methanomethylicia → Candidatus Methanomethylicales → Candidatus Methanomethylicaceae → Candidatus Methanosuratincola → unclassified Candidatus Methanosuratincola → Candidatus Methanosuratincola sp.595Open in IMG/M
3300005832|Ga0074469_10060120All Organisms → cellular organisms → Archaea → TACK group → Candidatus Verstraetearchaeota → Candidatus Methanomethylicia → Candidatus Methanomethylicales → Candidatus Methanomethylicaceae → Candidatus Methanosuratincola → unclassified Candidatus Methanosuratincola → Candidatus Methanosuratincola sp.756Open in IMG/M
3300006224|Ga0079037_101010328All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon823Open in IMG/M
3300006636|Ga0075525_10023994All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1231Open in IMG/M
3300006950|Ga0075524_10095906All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1264Open in IMG/M
3300006950|Ga0075524_10326260All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon674Open in IMG/M
3300009009|Ga0105105_10081759All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota1525Open in IMG/M
3300009037|Ga0105093_10120130All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1289Open in IMG/M
3300009053|Ga0105095_10516585All Organisms → cellular organisms → Archaea → TACK group → Candidatus Verstraetearchaeota → Candidatus Methanomethylicia → Candidatus Methanomethylicales → Candidatus Methanomethylicaceae → Candidatus Methanosuratincola → unclassified Candidatus Methanosuratincola → Candidatus Methanosuratincola sp.663Open in IMG/M
3300009078|Ga0105106_10257890All Organisms → cellular organisms → Archaea → TACK group → Candidatus Verstraetearchaeota → Candidatus Methanomethylicia → Candidatus Methanomethylicales → Candidatus Methanomethylicaceae → Candidatus Methanosuratincola → unclassified Candidatus Methanosuratincola → Candidatus Methanosuratincola sp.1266Open in IMG/M
3300009078|Ga0105106_10318373All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1125Open in IMG/M
3300009078|Ga0105106_11352564All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon505Open in IMG/M
3300009085|Ga0105103_10706147All Organisms → cellular organisms → Archaea → TACK group → Candidatus Verstraetearchaeota → Candidatus Methanomethylicia → Candidatus Methanomethylicales → Candidatus Methanomethylicaceae → Candidatus Methanosuratincola → unclassified Candidatus Methanosuratincola → Candidatus Methanosuratincola sp.580Open in IMG/M
3300009087|Ga0105107_10559654All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon796Open in IMG/M
3300009087|Ga0105107_10813140All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon650Open in IMG/M
3300009091|Ga0102851_10270977All Organisms → cellular organisms → Bacteria1641Open in IMG/M
3300009091|Ga0102851_10841992All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon985Open in IMG/M
3300009111|Ga0115026_10345492All Organisms → cellular organisms → Archaea → TACK group1059Open in IMG/M
3300009131|Ga0115027_10387718All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon972Open in IMG/M
3300009131|Ga0115027_10850304All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon701Open in IMG/M
3300009153|Ga0105094_10089678All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1728Open in IMG/M
3300009153|Ga0105094_10810313All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon551Open in IMG/M
3300009166|Ga0105100_10082451All Organisms → cellular organisms → Archaea1880Open in IMG/M
3300009166|Ga0105100_10934159All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon542Open in IMG/M
3300009167|Ga0113563_10592437All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1226Open in IMG/M
3300009167|Ga0113563_12328582All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon644Open in IMG/M
3300009179|Ga0115028_10430597All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon937Open in IMG/M
3300009179|Ga0115028_10819364All Organisms → cellular organisms → Archaea → TACK group → Candidatus Verstraetearchaeota → Candidatus Methanomethylicia → Candidatus Methanomethylicales → Candidatus Methanomethylicaceae → Candidatus Methanosuratincola → unclassified Candidatus Methanosuratincola → Candidatus Methanosuratincola sp.727Open in IMG/M
3300009179|Ga0115028_11468100All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon577Open in IMG/M
3300009305|Ga0116592_1045228All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon953Open in IMG/M
3300009391|Ga0116591_1083941All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon541Open in IMG/M
3300009499|Ga0114930_10405024All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon631Open in IMG/M
3300009671|Ga0123334_1094200All Organisms → cellular organisms → Archaea → TACK group → Candidatus Verstraetearchaeota → Candidatus Methanomethylicia → Candidatus Methanomethylicales → Candidatus Methanomethylicaceae → Candidatus Methanosuratincola → unclassified Candidatus Methanosuratincola → Candidatus Methanosuratincola sp.1535Open in IMG/M
3300009680|Ga0123335_1146878All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1286Open in IMG/M
3300009680|Ga0123335_1495399All Organisms → cellular organisms → Archaea → TACK group → Candidatus Verstraetearchaeota → Candidatus Methanomethylicia → Candidatus Methanomethylicales → Candidatus Methanomethylicaceae → Candidatus Methanosuratincola → unclassified Candidatus Methanosuratincola → Candidatus Methanosuratincola sp.548Open in IMG/M
3300009687|Ga0116144_10398985All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon689Open in IMG/M
3300010344|Ga0116243_10389369Not Available868Open in IMG/M
3300010353|Ga0116236_10069486All Organisms → cellular organisms → Archaea → TACK group3583Open in IMG/M
3300012931|Ga0153915_10311652All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1760Open in IMG/M
3300012964|Ga0153916_11908319All Organisms → cellular organisms → Archaea → TACK group → Candidatus Verstraetearchaeota → Candidatus Methanomethylicia → Candidatus Methanomethylicales → Candidatus Methanomethylicaceae → Candidatus Methanosuratincola → unclassified Candidatus Methanosuratincola → Candidatus Methanosuratincola sp.665Open in IMG/M
3300014152|Ga0181533_1042332All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon2453Open in IMG/M
3300014257|Ga0075319_1111606Not Available565Open in IMG/M
3300014490|Ga0182010_10424990All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon727Open in IMG/M
3300014490|Ga0182010_10895822All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon506Open in IMG/M
3300014494|Ga0182017_10293295All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1020Open in IMG/M
3300014498|Ga0182019_10373391All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon967Open in IMG/M
3300014498|Ga0182019_10575003All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon788Open in IMG/M
3300014502|Ga0182021_10010491All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon10985Open in IMG/M
3300014502|Ga0182021_10400214All Organisms → cellular organisms → Archaea1629Open in IMG/M
3300014502|Ga0182021_10764715All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1159Open in IMG/M
3300014502|Ga0182021_10805405All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1128Open in IMG/M
3300014502|Ga0182021_10869611Not Available1083Open in IMG/M
3300014502|Ga0182021_13230076All Organisms → cellular organisms → Archaea544Open in IMG/M
3300014502|Ga0182021_13525789All Organisms → cellular organisms → Archaea520Open in IMG/M
3300014839|Ga0182027_10279315All Organisms → cellular organisms → Archaea1898Open in IMG/M
3300017925|Ga0187856_1210938Not Available699Open in IMG/M
3300017972|Ga0187781_10731393Not Available716Open in IMG/M
3300017988|Ga0181520_10878876All Organisms → cellular organisms → Archaea599Open in IMG/M
3300017996|Ga0187891_1010621All Organisms → cellular organisms → Archaea4901Open in IMG/M
3300018016|Ga0187880_1150322All Organisms → cellular organisms → Archaea → TACK group1094Open in IMG/M
3300018018|Ga0187886_1019980All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon3698Open in IMG/M
3300018033|Ga0187867_10818306All Organisms → cellular organisms → Archaea504Open in IMG/M
3300018062|Ga0187784_11393866Not Available555Open in IMG/M
3300018062|Ga0187784_11440723Not Available546Open in IMG/M
3300018089|Ga0187774_10798393All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon637Open in IMG/M
3300018090|Ga0187770_10418268Not Available1054Open in IMG/M
3300020814|Ga0214088_1258961All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon12873Open in IMG/M
3300021603|Ga0226659_10392936Not Available608Open in IMG/M
3300025888|Ga0209540_10355540All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon814Open in IMG/M
3300025888|Ga0209540_10605845All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon552Open in IMG/M
3300026311|Ga0209723_1181733All Organisms → cellular organisms → Archaea779Open in IMG/M
3300027726|Ga0209285_10041664All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1347Open in IMG/M
3300027818|Ga0209706_10260318All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon829Open in IMG/M
3300027877|Ga0209293_10628785All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon567Open in IMG/M
3300027877|Ga0209293_10787583All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon504Open in IMG/M
3300027896|Ga0209777_10125431All Organisms → cellular organisms → Archaea → TACK group2150Open in IMG/M
3300027896|Ga0209777_10757161All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon686Open in IMG/M
3300027896|Ga0209777_11130531Not Available527Open in IMG/M
3300027900|Ga0209253_10557705All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon846Open in IMG/M
3300027902|Ga0209048_10705145Not Available664Open in IMG/M
3300027979|Ga0209705_10376658All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon710Open in IMG/M
3300031707|Ga0315291_10202928All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon2019Open in IMG/M
3300031862|Ga0315280_10030257All Organisms → cellular organisms → Archaea → TACK group5294Open in IMG/M
3300031999|Ga0315274_10018599All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes9780Open in IMG/M
3300032046|Ga0315289_10001256Not Available39688Open in IMG/M
3300032163|Ga0315281_11115680All Organisms → cellular organisms → Archaea → TACK group → Candidatus Verstraetearchaeota → Candidatus Methanomethylicia → Candidatus Methanomethylicales → Candidatus Methanomethylicaceae → Candidatus Methanosuratincola → unclassified Candidatus Methanosuratincola → Candidatus Methanosuratincola sp.793Open in IMG/M
3300032173|Ga0315268_11073626All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon813Open in IMG/M
3300032177|Ga0315276_10107606All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon2846Open in IMG/M
3300032177|Ga0315276_10739061All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → MCG-6 → miscellaneous Crenarchaeota group-6 archaeon AD8-11055Open in IMG/M
3300032177|Ga0315276_11299947All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon763Open in IMG/M
3300032401|Ga0315275_11578418All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon703Open in IMG/M
3300032783|Ga0335079_11275827All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon735Open in IMG/M
3300032829|Ga0335070_10935675All Organisms → cellular organisms → Archaea → TACK group → Candidatus Verstraetearchaeota → Candidatus Methanomethylicia → Candidatus Methanomethylicales → Candidatus Methanomethylicaceae → Candidatus Methanosuratincola → unclassified Candidatus Methanosuratincola → Candidatus Methanosuratincola sp.802Open in IMG/M
3300033402|Ga0326728_10000013All Organisms → cellular organisms → Archaea793242Open in IMG/M
3300033402|Ga0326728_10606167All Organisms → cellular organisms → Archaea852Open in IMG/M
3300033405|Ga0326727_11225192All Organisms → cellular organisms → Archaea520Open in IMG/M
3300033408|Ga0316605_10368550All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1286Open in IMG/M
3300033408|Ga0316605_11299151All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon704Open in IMG/M
3300033413|Ga0316603_11440367Not Available653Open in IMG/M
3300033413|Ga0316603_11999039All Organisms → cellular organisms → Archaea548Open in IMG/M
3300033413|Ga0316603_12008730All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon547Open in IMG/M
3300033414|Ga0316619_10150211All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1600Open in IMG/M
3300033414|Ga0316619_10594552All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon919Open in IMG/M
3300033418|Ga0316625_100930625Not Available765Open in IMG/M
3300033419|Ga0316601_100157607Not Available1938Open in IMG/M
3300033419|Ga0316601_100377392All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1327Open in IMG/M
3300033419|Ga0316601_101571161All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon663Open in IMG/M
3300033419|Ga0316601_101589163All Organisms → cellular organisms → Archaea → TACK group → Candidatus Verstraetearchaeota → Candidatus Methanomethylicia → Candidatus Methanomethylicales → Candidatus Methanomethylicaceae → Candidatus Methanosuratincola → unclassified Candidatus Methanosuratincola → Candidatus Methanosuratincola sp.659Open in IMG/M
3300033419|Ga0316601_102303063All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon542Open in IMG/M
3300033419|Ga0316601_102518841All Organisms → cellular organisms → Archaea → TACK group → Candidatus Verstraetearchaeota → Candidatus Methanomethylicia → Candidatus Methanomethylicales → Candidatus Methanomethylicaceae → Candidatus Methanosuratincola → unclassified Candidatus Methanosuratincola → Candidatus Methanosuratincola sp.517Open in IMG/M
3300033433|Ga0326726_10971016Not Available825Open in IMG/M
3300033480|Ga0316620_11143035All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon762Open in IMG/M
3300033480|Ga0316620_11892414All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon592Open in IMG/M
3300033481|Ga0316600_11225794All Organisms → cellular organisms → Archaea → TACK group → Candidatus Verstraetearchaeota → Candidatus Methanomethylicia → Candidatus Methanomethylicales → Candidatus Methanomethylicaceae → Candidatus Methanosuratincola → unclassified Candidatus Methanosuratincola → Candidatus Methanosuratincola sp.533Open in IMG/M
3300033482|Ga0316627_100265169All Organisms → cellular organisms → Archaea → TACK group1382Open in IMG/M
3300033483|Ga0316629_11852592All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon500Open in IMG/M
3300033485|Ga0316626_11015905All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon736Open in IMG/M
3300033485|Ga0316626_11337841All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon643Open in IMG/M
3300033486|Ga0316624_10933955All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon779Open in IMG/M
3300033486|Ga0316624_11036336All Organisms → cellular organisms → Archaea → TACK group741Open in IMG/M
3300033486|Ga0316624_11132443All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon710Open in IMG/M
3300033486|Ga0316624_11200816All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon690Open in IMG/M
3300033487|Ga0316630_10414771All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1079Open in IMG/M
3300033513|Ga0316628_100660225All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1368Open in IMG/M
3300033513|Ga0316628_100939061All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1146Open in IMG/M
3300033513|Ga0316628_102715560All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon652Open in IMG/M
3300033521|Ga0316616_102303283All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon719Open in IMG/M
3300033521|Ga0316616_104386845All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon531Open in IMG/M
3300033557|Ga0316617_100444056All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1160Open in IMG/M
3300034125|Ga0370484_0196485All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon551Open in IMG/M
3300034128|Ga0370490_0229680All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon611Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil24.82%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment11.68%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen9.49%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment7.30%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland5.84%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment3.65%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland3.65%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands3.65%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil3.65%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.65%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands2.92%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil2.92%
Anaerobic Biogas ReactorEngineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Biogas Reactor2.92%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland2.19%
Anaerobic Digestor SludgeEngineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge2.19%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.46%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands1.46%
SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment1.46%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil1.46%
Granular SludgeEngineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Granular Sludge1.46%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface0.73%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.73%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.73%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300003432Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 BulkEnvironmentalOpen in IMG/M
3300004014Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLA_D2EnvironmentalOpen in IMG/M
3300004057Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleC_D2EnvironmentalOpen in IMG/M
3300004063Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLB_D2EnvironmentalOpen in IMG/M
3300005832Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.41_BBBEnvironmentalOpen in IMG/M
3300006224Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaGEnvironmentalOpen in IMG/M
3300006636Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-twoEnvironmentalOpen in IMG/M
3300006950Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-oneEnvironmentalOpen in IMG/M
3300009009Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300009037Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015EnvironmentalOpen in IMG/M
3300009053Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009078Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009085Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009087Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009091Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300009111Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1EnvironmentalOpen in IMG/M
3300009131Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1EnvironmentalOpen in IMG/M
3300009153Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015EnvironmentalOpen in IMG/M
3300009166Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015EnvironmentalOpen in IMG/M
3300009167Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)EnvironmentalOpen in IMG/M
3300009179Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1EnvironmentalOpen in IMG/M
3300009305Microbial communities from sediment of the River Tyne Estuary, UK ? Pasteurized_686d_2 SPAdesEnvironmentalOpen in IMG/M
3300009391Microbial communities from sediment of the River Tyne Estuary, UK ? Pasteurized_686d_1 SPAdesEnvironmentalOpen in IMG/M
3300009499Deep subsurface microbial communities from Anholt, Denmark to uncover new lineages of life (NeLLi) - Anholt_01485 metaGEnvironmentalOpen in IMG/M
3300009671Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1 time_0 SIP DNAEngineeredOpen in IMG/M
3300009680Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2 time_0 SIP DNAEngineeredOpen in IMG/M
3300009687Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC035_MetaGEngineeredOpen in IMG/M
3300010344AD_JPAScaEngineeredOpen in IMG/M
3300010353AD_USCAcaEngineeredOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012964Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaGEnvironmentalOpen in IMG/M
3300014152Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaGEnvironmentalOpen in IMG/M
3300014257Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleC_D1EnvironmentalOpen in IMG/M
3300014490Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaGEnvironmentalOpen in IMG/M
3300014494Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaGEnvironmentalOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300017925Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40EnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300017996Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40EnvironmentalOpen in IMG/M
3300018016Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40EnvironmentalOpen in IMG/M
3300018018Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150EnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018089Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300020814Granular sludge microbial community from anaerobic digester, University of Toronto, Ontario, Canada - UASBVu03_granules megahitEngineeredOpen in IMG/M
3300021603Granular sludge microbial community from anaerobic digester, University of Toronto, Ontario, Canada - UASBVu03_granules spadesEngineeredOpen in IMG/M
3300025888Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-21A (SPAdes)EnvironmentalOpen in IMG/M
3300026311Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2 time_0 SIP DNA (SPAdes)EngineeredOpen in IMG/M
3300027726Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027818Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027877Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300027896Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes)EnvironmentalOpen in IMG/M
3300027900Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes)EnvironmentalOpen in IMG/M
3300027902Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes)EnvironmentalOpen in IMG/M
3300027979Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300031707Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20EnvironmentalOpen in IMG/M
3300031862Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_40EnvironmentalOpen in IMG/M
3300031999Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20EnvironmentalOpen in IMG/M
3300032046Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40EnvironmentalOpen in IMG/M
3300032163Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0EnvironmentalOpen in IMG/M
3300032173Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_topEnvironmentalOpen in IMG/M
3300032177Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0EnvironmentalOpen in IMG/M
3300032401Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M
3300033408Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCTEnvironmentalOpen in IMG/M
3300033413Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCTEnvironmentalOpen in IMG/M
3300033414Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_BEnvironmentalOpen in IMG/M
3300033418Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_AEnvironmentalOpen in IMG/M
3300033419Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCTEnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033480Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_BEnvironmentalOpen in IMG/M
3300033481Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CTEnvironmentalOpen in IMG/M
3300033482Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_CEnvironmentalOpen in IMG/M
3300033483Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_AEnvironmentalOpen in IMG/M
3300033485Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_AEnvironmentalOpen in IMG/M
3300033486Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_AEnvironmentalOpen in IMG/M
3300033487Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_AEnvironmentalOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M
3300033521Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_BEnvironmentalOpen in IMG/M
3300033557Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_BEnvironmentalOpen in IMG/M
3300034125Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15EnvironmentalOpen in IMG/M
3300034128Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_16EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGIcombinedJ13530_10297165023300001213WetlandMNQTDINAAVVTMRIFLAGLAFNFNADFHELEEITRGALGAVESEVVLH*
JGIcombinedJ13530_10353128113300001213WetlandLNQKEIEVAALAMRIFLAGLALNFDADFHELEEITKRALLEVDVGASR*
JGI20214J51088_1012999923300003432WetlandLNQKEIEAAAILMRIFLSGLALNFDADFHELEEITKRALLEVEMEKY*
Ga0055456_1025678313300004014Natural And Restored WetlandsMKQREIELATVYMQMFLAGLALNFGANFHELEEITKRALFQVENPPSE*
Ga0055496_1004779013300004057Natural And Restored WetlandsGGYLMKQREIELATVYMQMFLAGLALNFGANFHELEEITKRALFQVENPAAQ*
Ga0055483_1001397723300004063Natural And Restored WetlandsVKQRQIELATVYMQMFLAGLALNFGANFHELEEITKRALFQVENPPSE*
Ga0055483_1023929023300004063Natural And Restored WetlandsMKQKEIDAAVIHMRIFLSGLGLNFDASFHELEEIVKRALVEIDDSGAK*
Ga0074469_1006012013300005832Sediment (Intertidal)MKQKEIELATVYMQMFLAGLALNFGANFHELEEITKRALFQVENPSSQ*
Ga0079037_10101032813300006224Freshwater WetlandsVKQKEIEAALVCTRIFLLGLGLNFDATFHELEEIVKRALFEIESSGAS*
Ga0075525_1002399433300006636Arctic Peat SoilLNQKELKAAALATQIYLSGLFFTFDANFHVLEEITKRALGTVESEVVEH*
Ga0075524_1009590613300006950Arctic Peat SoilLNQREIEAAAIMIRIFLAGLALNFDAIFHELEELTKRAPLEVEAGAS*
Ga0075524_1032626023300006950Arctic Peat SoilLNQKELEAAAIMMRIFLVGLALNFDSDFHELEEITKRALGAVESEVAEH*
Ga0105105_1008175943300009009Freshwater SedimentLNQKEIEVASIMMCIFLAGLALNFNANYHELEEITKRALLEVETEAP*
Ga0105093_1012013023300009037Freshwater SedimentMKQREIELATVYMRMFLAGLALNFGANFHELEEITKRVLFQVENPPSE*
Ga0105095_1051658523300009053Freshwater SedimentMKQKEIELATVYMQMFLAGLALNFGANFHELEEITERALFQVENPSTQ*
Ga0105106_1025789043300009078Freshwater SedimentMKQKEIELATVYMQMFLAGLALNFGANFHELEEITKRALFQVEN
Ga0105106_1031837323300009078Freshwater SedimentMDQKQLEAAAILTRIFLAGLTLNFDADFHELEEITKRALLQIEQEDR*
Ga0105106_1135256423300009078Freshwater SedimentRPGTGGYLMKQKEIELATVYMQMFLAGLALNFGANFHELEEITKRALFQVENPPSE*
Ga0105103_1070614723300009085Freshwater SedimentMKQREIELATVYMQMFLAGLALNFGANFHELEEITKRALFQVENPSVQ*
Ga0105107_1055965423300009087Freshwater SedimentMKQKEIELATVYMQMFLAGLALNFGANFHELEEITKRALFQVENPSSH*
Ga0105107_1081314023300009087Freshwater SedimentDYRPGTGGYLMKQKEIELATVYMQMFLAGLALNFGANFHELEEITKRALFQVENPAAQ*
Ga0102851_1027097713300009091Freshwater WetlandsLKQKEIEAAAIMTRIFLVGLALNFDSDFHELEEITKRALGAIELEVAEH*
Ga0102851_1084199233300009091Freshwater WetlandsMNQKEIDVAAVLMRIFLTGITLNFNADFHELEEIEKRALLQVEEAV*
Ga0115026_1034549233300009111WetlandMKQREIELATVYMQMFLAGLALNFDANFHELEEITKRALFQVENPAAQ*
Ga0115027_1038771823300009131WetlandMRAQGEGWLLNQKEIDVATVLMRIFLSGLALNFNANFHELEEIAKRSLLQIEEAA*
Ga0115027_1085030423300009131WetlandMNQKEIDVAAVLMRIFLTGITLNFNADFHELKEIAKRALLQVEEAV*
Ga0105094_1008967833300009153Freshwater SedimentMKQREIELATVYMQMFLAGLALNFGANFHELEEITKRALFQVENPSSQ*
Ga0105094_1081031323300009153Freshwater SedimentMKQKEIELATVYMQMFLAGLALNFGANFHELEEITKRALFQVENPPSK*
Ga0105100_1008245163300009166Freshwater SedimentMKQKEIELATVYMQMFLAGLALNFGANFHELEEITKRALFQVENPAAQ*
Ga0105100_1093415923300009166Freshwater SedimentLTQTIRDYRPGTGGYLMKQKEIELATVYMQMFLAGLALNFGANFHELEEITKRALFQVENPSTQ*
Ga0113563_1059243733300009167Freshwater WetlandsMNQKEIDVAAVLMRIFLSGLALNFNANFHELEEIAKRALLQFEEAV*
Ga0113563_1232858213300009167Freshwater WetlandsRAHGEGWLMNQKEIDVAAVLMQIFLTGIALNFNADFHELEEIAKRALLQVEEAV*
Ga0115028_1043059723300009179WetlandLKQKEIEAAAIMMRVFLAGLALNFNANFHELEEITKRALLQVEMEGP*
Ga0115028_1081936423300009179WetlandLKQREIELAAVYMQMFLAGLALNFGANFHELEEITKRALFQVENPSSQ*
Ga0115028_1146810023300009179WetlandMNQKEIDVAAVLMRIFLSWLALNFNADFHELEEIAKRALLQVEEAV*
Ga0116592_104522823300009305SedimentMKQKEIELATVYMQMFLAGLALNFGANFHELEEITKRALFQVENPATQE*
Ga0116591_108394113300009391SedimentLNQKEIEAAVICMRIFLSGLALNFDADFHELEEVTKRALDTVLR*
Ga0114930_1040502423300009499Deep SubsurfaceLNQKEIEVAALAMRIFLAGLALNFDADFHELEEITKRALLEVEGGGSQ*
Ga0123334_109420013300009671Anaerobic Biogas ReactorMKQREIELATVYMQMFLAGLALNFGANFHELEEITKRALFKVENPPSE*
Ga0123335_114687823300009680Anaerobic Biogas ReactorVNHKEIEAAAIMTRIFLTGLALNFNANYHELEEISKRALLKIETGAP*
Ga0123335_149539923300009680Anaerobic Biogas ReactorMKQREIELATVYMQMFLSGLALNFGADFNELEEITKRALLEIEQEDH*
Ga0116144_1039898523300009687Anaerobic Digestor SludgeVKQKEIEAAAIIMRIFLTGLALNFDANFHELEEIAKRALLQIESETT*
Ga0116243_1038936933300010344Anaerobic Digestor SludgeLNQKEIEAAAIMLRIFLTGLAFNFDANYPELEEITKRALLEIETDT*
Ga0116236_1006948643300010353Anaerobic Digestor SludgeLNQKEIEAAAIMMRIFLAGLSLNFNADFHELEEITKRALGEIEKLEVASN*
Ga0153915_1031165233300012931Freshwater WetlandsLKQKEIEAAVITMRIFLAGLAFSFDADFHELEEITRRALGAIESEAAMN*
Ga0153916_1190831923300012964Freshwater WetlandsMKQREIELATVYMQMFLAGLALNFGSNFHELEEITKRALFQVENPSAQ*
Ga0181533_104233223300014152BogLKQKEIEAAAVMLRIFLAGLAFNFDANFHELEEVTKRALLEIDTETSS*
Ga0075319_111160613300014257Natural And Restored WetlandsLNQKEIEAAAIMMRIFLTGLALNFDANFHELEEIAKRALLEIEAEAP*
Ga0182010_1042499013300014490FenLKQKEIEAAAIMMRIFLTGLAINFDADFHELEEITKRALLEVEAGAL*
Ga0182010_1089582213300014490FenLKQKEIEAAAIMMQIFLTGLALNFDADFHELEEITKRALLEVEAEVS*
Ga0182017_1029329543300014494FenLNQKEIEVAALAMRIFLAGLALNFDANFHELEEITHRALGAVESEALKH*
Ga0182019_1037339123300014498FenLKQKEIEAAAIMMQIFLAGLALNFDANFYELQEITTRALLEVESRV*
Ga0182019_1057500313300014498FenLKQKEIEAAAIMMRIFLAGLAFNFDANFHELEEITKRALLQVETEELQ*
Ga0182021_1001049143300014502FenVNQKEIEAAKVCMQIFLAGLTLNFNASFHEPEEITKRALLEVETEAT*
Ga0182021_1040021433300014502FenLNQKEIEAAVVMLRIFLAGLSFNFDANFHELEEITKRALLEIETEDPA*
Ga0182021_1076471533300014502FenLKQNEIEAAAIMMRIFLAGLAFNFDADFHELEEITKRALLQVETEELQ*
Ga0182021_1080540523300014502FenLKQKEIEAAAVMMQIFLTGLAFNFNANFHEPQEITKKVLLEIELGASS*
Ga0182021_1086961123300014502FenLKQKEIEAAAIMMRIFLAGLAFNFDANFHELEEITKRALLQVEAEEP*
Ga0182021_1323007623300014502FenLKQKEIEAASAMTKIFLAGLAFSFDANFHELEEITKRALLQVEAEAP*
Ga0182021_1352578933300014502FenLKQNEIEAAAIMMRIFLAGLALNFDADFHELEEITKRALLQVETEAP*
Ga0182027_1027931533300014839FenLNQKQIEAAALVMRIFLAGLAFNFDANFHELEEVTKRALLEIETETS*
Ga0187856_121093823300017925PeatlandLNQKQLEAAVVMLRIFLAGLSFNFDANFHELEEVTKRALLEIETETSS
Ga0187781_1073139323300017972Tropical PeatlandLNQKQIEAAAVMLRIFLSGLALNFDADYHELEEITKRALLEVESEAAH
Ga0181520_1087887623300017988BogCSKRRFNLNQKEIEAAAVMMRIFLAGLALNFNADFHELEEITKRALLEVESEVS
Ga0187891_101062123300017996PeatlandLKQKEIEAAAVMLRIFLAGLAFNFDANFHELEEVTKRALLEIDTETSS
Ga0187880_115032223300018016PeatlandLNQKQIDAAAAMMRIFLSGLAFNFDADFHELEEVTKRALLAIESEASS
Ga0187886_101998083300018018PeatlandMNQKEIEAAVVCMRIFLAGLALNFDADFHELEEIAKRALFQIENAEQAVS
Ga0187867_1081830613300018033PeatlandLNQKQIDAASVMLRIFLSGLALNFDADFHELEEITKRALLEIQTEAVQ
Ga0187784_1139386623300018062Tropical PeatlandLETSSLNQKQIEAAAVMMRIFLACLELNFNANYHELEEITKRALLEIEAEAS
Ga0187784_1144072313300018062Tropical PeatlandLNQKQIEAAAVMTRIFLAGLALNFDSNFHELEEVTKRALLEIKTETSS
Ga0187774_1079839313300018089Tropical PeatlandMNQKEIEAAAVIMRIFLTGLAFNFNANFHELEEITKRALLEIEP
Ga0187770_1041826823300018090Tropical PeatlandLDQKQIEAAAVMMCIFLAGLALNFDTDFHELEEIAKRDLLENIV
Ga0214088_1258961113300020814Granular SludgeMNQKEIEVAAVHMRFFLAGLALNFNANFHELEEITKRALLEIGQS
Ga0226659_1039293613300021603Granular SludgeLNQKEIEAAAIMLRIFLTGLAFNFDANYPELEEITKQALLEIETDA
Ga0209540_1035554033300025888Arctic Peat SoilMNQKDINAAVVTMRIFLAGLALNFDANFHELEEITRRALGAVESGVVER
Ga0209540_1060584513300025888Arctic Peat SoilLNQKEIEVAALAMRIFLTGLAINFDADFHELEKIAKRALLEIEVGASR
Ga0209723_118173323300026311Anaerobic Biogas ReactorVNHKEIEAAAIMTRIFLTGLALNFNANYHELEEISKRALLKIETGAP
Ga0209285_1004166423300027726Freshwater SedimentMKQREIELATVYMRMFLAGLALNFGANFHELEEITKRVLFQVENPPSE
Ga0209706_1026031823300027818Freshwater SedimentMKQKEIELATVYMQMFLAGLALNFGANFHELEEITKRALFQVENPAAQ
Ga0209293_1062878523300027877WetlandFKLKQKEIEAAAIMTRIFLVGLALNFDSDFHELEEITKRALGAIELEVAEH
Ga0209293_1078758323300027877WetlandELATVYMQMFLSGLALNFGANFHELEEITKRALFQVENPPSE
Ga0209777_1012543113300027896Freshwater Lake SedimentLKQKEIDAAAIMMRIFLTGLALNFDADFHDLEEITKRALLEVEAEVS
Ga0209777_1075716123300027896Freshwater Lake SedimentLNQKQIEAAAIMMRIFLAGLALNFDADFHELEEITKRALLQVGTE
Ga0209777_1113053113300027896Freshwater Lake SedimentLKQREIEAATIMMQIFFIILALNFDANFHELEEITKRALLQ
Ga0209253_1055770523300027900Freshwater Lake SedimentMRQREIELATVYMQMFLAGLALNFGANFHELEEITKRALFLVENPSAQ
Ga0209048_1070514513300027902Freshwater Lake SedimentLNQKEIEAVVVAMRIFLVGLALNFDPNFHELEEITKRTLLEIEVGASR
Ga0209705_1037665823300027979Freshwater SedimentMKQKEIELATVYMQMFLAGLALNFGANFHELEEITKRALFQVENPPSE
Ga0315291_1020292813300031707SedimentSTFACLAQTRNYRPGTGGYLMKQKEIELATVYMQMFLAGLALNFGANFHELEEITKRALFQVENPSSQ
Ga0315280_1003025773300031862SedimentLKQKEIEVAAFYMRFFLVGLAFNFKANFHELEEITQRALLEIESKDPSSS
Ga0315274_1001859983300031999SedimentMKQKEIELATVYMQMFLAGLALNFGANFHELEEITKRALFQVENPSSQ
Ga0315289_10001256403300032046SedimentVRFFDLKQKEIEAAALCMRIFLAGLALNFDANFHELEEITRRALGAIESEVAPH
Ga0315281_1111568023300032163SedimentMKQREIELATVYMQMFLAGLALNFGANFHELEEITKRALFQVENPPSE
Ga0315268_1107362623300032173SedimentMKQKEIELATVYMQMFLASLALNFGANFHELEEITKRALYQVENPSAQ
Ga0315276_1010760633300032177SedimentMKQKEIELATVYMQMFLAGLALNFGANFHELEEITKRALFQVENPSAQ
Ga0315276_1073906123300032177SedimentLNQKEIEVAALAMRVGLAFNFDADFLELEEITKRALGAVESEVVKH
Ga0315276_1129994723300032177SedimentLKQKEIEAAAVCMQIFLGGLALSFNANFHELEEITKRALLEVGTGVS
Ga0315275_1157841823300032401SedimentMKQKEIELATVYMQMFLAGLALNFGANFHELEEITKRALFQVENPSTQ
Ga0335079_1127582723300032783SoilMEAATAVMRIFLAGLAFNFDADFHELEEITKRALLEIEAEKP
Ga0335070_1093567523300032829SoilMRQKELEAAAVQMRIFLVGLGFSFDANFHELQEIAKRALLEIETQEAHLR
Ga0326728_100000136273300033402Peat SoilLNQKQIEAAAVLMRLFLSGLAFNFDANFHELEEVTKRALLEIETEASS
Ga0326728_1060616733300033402Peat SoilLNQKQIEAAAVMMRIFLAGLALNFDSNFHELEEITKRALLEVEAEGSS
Ga0326727_1122519213300033405Peat SoilLNQKEIEASAVMLRIFLSGLALNFDANFHELEEVTKRALLEIEAEKP
Ga0316605_1036855013300033408SoilMRAQGEGWLMNQKEIDVAAVLMRIFLSGLALNFNADFHELEEIVKRALLQVEEAV
Ga0316605_1129915123300033408SoilMNQKEIDVAAVLTRLFLTGIALNFNANFHELEEIAKR
Ga0316603_1144036713300033413SoilMNQKEIDVAAVLMQIFLTGIALNFNADFHELEEIAKRALLQVEEAV
Ga0316603_1199903923300033413SoilLKQKEIEAAAIMMRVFLAGLALNFNANFHELEEITKRALLQVEMEGP
Ga0316603_1200873023300033413SoilMRAYGEGWLMNQKEIDVAAVLMRIFLSGLALNFNANFHELEETAKRALLQIEEAA
Ga0316619_1015021133300033414SoilMRAYGEDLLMNQKEIDVAAVLMRIFLSGLALNFNANFHELEEIAKRALLQVEEAV
Ga0316619_1059455223300033414SoilMKQREIELATVYMQLFLAGLALNFGANFHELEEITKRALFQVENPPSE
Ga0316625_10093062523300033418SoilMPRRLLSLDQKQVEAAAIMLRIFLSGLAFNFNSDFYELEEITKRALLEIGQEDR
Ga0316601_10015760713300033419SoilMRAYGEDLLMNQKEIDVAAVLMRIFLSGLALNFNANFHELEETAKRALLQIEEAA
Ga0316601_10037739223300033419SoilMRAHGEDWLMNQKEIDVAAVLMRLFLTGIALNFNANFHELEEIAKRALLQVEEAV
Ga0316601_10157116123300033419SoilVKQKEIEAAVVCTRIFLLGLGLNFDATFHELEEIVKRALFEIESSGAS
Ga0316601_10158916323300033419SoilMKQREIELATVYMQMFLAGLALNFGANFHELEEITKRALFQVENPSSQ
Ga0316601_10230306313300033419SoilLKQKEIEAAAIMTRIFLVGLALNFDSDFHELEEITKRALGAIELEVAEH
Ga0316601_10251884123300033419SoilMKQREIELATVYMQMFLAGLALNFGANFHELEEITKRALFQVENPSTQE
Ga0326726_1097101613300033433Peat SoilLNQKEIEAAAIVMRIFLTGLALNFDANYHEVEEIAKRALLQVEAE
Ga0316620_1114303523300033480SoilLKQKEIEAASIMMRIFLSGLALNFDADFHELEEITKRALLQVELEAP
Ga0316620_1189241413300033480SoilLKQKEIEAAVITMRIFLAGLAFSFDADFHELEEITRRALGAIE
Ga0316600_1122579423300033481SoilMKQKEIELATVYMQIFLAGLALNFGANFHELEEITKRALFQVENPSSQ
Ga0316627_10026516923300033482SoilLKQKEIEAAAIMMQIFLAGLAFNFDADFHELEEITKRALLEVETEESK
Ga0316629_1185259223300033483SoilMKQKEIELATVYMQMFLAGLALNFGANFHELEEITKRALFQVENPSTQE
Ga0316626_1101590513300033485SoilFLFVCGGFLVKQKEIEAAVVCTRIFLLGLGLNFDATFHELEEIVKRALFEIESSGAS
Ga0316626_1133784123300033485SoilMRAYGEGWLMNQKEIDVAAVLMRIFLSGLALNFNANFHELEEIAKRALLQIEEAA
Ga0316624_1093395513300033486SoilIEAASIMMRIFLSGLALNFDADFHELEEITKRALLQVELEAP
Ga0316624_1103633623300033486SoilVNQREIDAAALVMQIFLAGLVLNFDADFHELEEIVKRAMLELELESPE
Ga0316624_1113244323300033486SoilMDQKEIDAAAMIMRIFLVGLAFNFDADFHELEEIVKRAMLQIEVVQ
Ga0316624_1120081623300033486SoilLKQKEIEAAVITMRIFLAGLAFSFDADFHELEEITRRALGAIESEAAMN
Ga0316630_1041477123300033487SoilMRAHGEGWLMNQKEIDVAAVLMRIFLSGLALNFNANLHELEEIAKRALLQFEEEV
Ga0316628_10066022543300033513SoilMDQKEIDAAVMVMRIFLVGLAFNFDADFHELEDIVKRAMLQIEVAQ
Ga0316628_10093906123300033513SoilLRQKEIEAAAICMQIFLMGLGFNFDATYHELEEITKRALHQIGEAKVSR
Ga0316628_10271556023300033513SoilVKQKEIDAAAISMQIFLVGLSCAFDANFHELEEITKRALLEIENPKTPK
Ga0316616_10230328323300033521SoilLNQKQIDAAAVILRVVLSGLAFNFDADFHELEEITKRALLEIGQEDR
Ga0316616_10438684513300033521SoilQKEIEAAAIMMRIFLAGLAFNFDADFHELEEITKRALLEVETEESK
Ga0316617_10044405623300033557SoilLKQKEIEAAAIMMRIFLAGLAFNFDADFHELEEITKRALLEVETEESK
Ga0370484_0196485_397_5463300034125Untreated Peat SoilLNYKEIEVAALAMRIFLAGLALNFDADFHELEEITKRALGAVESEVFKH
Ga0370490_0229680_48_2213300034128Untreated Peat SoilLASKQQGGFFLKQKEIEAAAIMLRIFLAGMSFNFDADFHKLEEITKRALLQVEMEGP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.