Metagenome Family F056198

Basic Information
Family ID	F056198
Family Type	Metagenome
Number of Sequences	138
Average Sequence Length	39 residues
Representative Sequence	SWYFSQKAVTVQGGYGALFAVMVQILLSITRVAVQV
Number of Associated Samples	94
Number of Associated Scaffolds	138

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	0.00 %
% of genes near scaffold ends (potentially truncated)	96.38 %
% of genes from short scaffolds (< 2000 bps)	83.33 %
Associated GOLD sequencing projects	85
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.44

Most Common Taxonomy
Group	Bacteria (63.768 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment (21.014 % of family members)
Environment Ontology (ENVO)	Unclassified (44.203 % of family members)
Earth Microbiome Project Ontology (EMPO)	Unclassified (48.551 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 51.56% β-sheet: 0.00% Coil/Unstructured: 48.44%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 138 Family Scaffolds
PF14319	Zn_Tnp_IS91	1.45
PF00691	OmpA	1.45
PF13683	rve_3	1.45
PF09603	Fib_succ_major	1.45
PF00583	Acetyltransf_1	1.45
PF12675	DUF3795	0.72
PF13534	Fer4_17	0.72
PF13181	TPR_8	0.72
PF01965	DJ-1_PfpI	0.72
PF14534	DUF4440	0.72
PF01252	Peptidase_A8	0.72
PF12873	DUF3825	0.72
PF02687	FtsX	0.72
PF05569	Peptidase_M56	0.72
PF14289	DUF4369	0.72
PF13601	HTH_34	0.72
PF13308	YARHG	0.72
PF00857	Isochorismatase	0.72
PF10604	Polyketide_cyc2	0.72
PF00326	Peptidase_S9	0.72
PF13365	Trypsin_2	0.72
PF09685	DUF4870	0.72
PF13443	HTH_26	0.72
PF07045	DUF1330	0.72
PF09719	C_GCAxxG_C_C	0.72
PF00201	UDPGT	0.72
PF05016	ParE_toxin	0.72
PF13600	DUF4140	0.72
PF01738	DLH	0.72
PF14870	PSII_BNR	0.72
PF05168	HEPN	0.72
PF04229	GrpB	0.72
PF15869	TolB_like	0.72
PF09491	RE_AlwI	0.72
PF14903	WG_beta_rep	0.72
PF08388	GIIM	0.72
PF03692	CxxCxxCC	0.72
PF14300	DUF4375	0.72
PF01850	PIN	0.72
PF00144	Beta-lactamase	0.72
PF08867	FRG	0.72

COG ID	Name	Functional Category	% Frequency in 138 Family Scaffolds
COG0597	Lipoprotein signal peptidase	Cell wall/membrane/envelope biogenesis [M]	1.45
COG1819	UDP:flavonoid glycosyltransferase YjiC, YdhE family	Carbohydrate transport and metabolism [G]	1.45
COG1335	Nicotinamidase-related amidase	Coenzyme transport and metabolism [H]	0.72
COG1535	Isochorismate hydrolase	Secondary metabolites biosynthesis, transport and catabolism [Q]	0.72
COG1680	CubicO group peptidase, beta-lactamase class C family	Defense mechanisms [V]	0.72
COG1686	D-alanyl-D-alanine carboxypeptidase	Cell wall/membrane/envelope biogenesis [M]	0.72
COG1895	HEPN domain protein, predicted toxin of MNT-HEPN system	Defense mechanisms [V]	0.72
COG2250	HEPN domain protein, predicted toxin of MNT-HEPN system	Defense mechanisms [V]	0.72
COG2320	GrpB domain, predicted nucleotidyltransferase, UPF0157 family	General function prediction only [R]	0.72
COG2367	Beta-lactamase class A	Defense mechanisms [V]	0.72
COG5470	Uncharacterized conserved protein, DUF1330 family	Function unknown [S]	0.72

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	63.77 %
Unclassified	root	N/A	36.23 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	63.77 %
Unclassified	root	N/A	36.23 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	63.77 %
Unclassified	root	N/A	36.23 %

Name	Rank	Taxonomy	Distribution
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	46.38 %
Unclassified	root	N/A	36.23 %
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	3.62 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1.45 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.72 %
unclassified Bacteria	no rank	All Organisms → cellular organisms → Bacteria → unclassified Bacteria	0.72 %
Elusimicrobia	phylum	All Organisms → cellular organisms → Bacteria → Elusimicrobia	0.72 %

Name	Rank	Taxonomy	Distribution
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	45.65 %
Unclassified	root	N/A	36.23 %
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	3.62 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	1.45 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.72 %
unclassified Elusimicrobiota	no rank	All Organisms → cellular organisms → Bacteria → Elusimicrobia → unclassified Elusimicrobiota	0.72 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.72 %

Name	Rank	Taxonomy	Distribution
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	45.65 %
Unclassified	root	N/A	36.23 %
Patescibacteria group	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group	2.90 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	1.45 %
Elusimicrobia bacterium CG11_big_fil_rev_8_21_14_0_20_64_6	species	All Organisms → cellular organisms → Bacteria → Elusimicrobia → unclassified Elusimicrobiota → Elusimicrobia bacterium CG11_big_fil_rev_8_21_14_0_20_64_6	0.72 %
Enterobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales	0.72 %
candidate division CPR1	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division CPR1	0.72 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.72 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	36.23 %
Bacteroidia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia	14.49 %
Flavobacteriia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia	7.25 %
unclassified Bacteroidetes	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes	6.52 %
Microgenomates group	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group	2.90 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	1.45 %
candidate division CPR1 bacterium ADurb.Bin160	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division CPR1 → candidate division CPR1 bacterium ADurb.Bin160	0.72 %
Enterobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae	0.72 %
Chitinophagia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia	0.72 %
Elusimicrobia bacterium CG11_big_fil_rev_8_21_14_0_20_64_6	species	All Organisms → cellular organisms → Bacteria → Elusimicrobia → unclassified Elusimicrobiota → Elusimicrobia bacterium CG11_big_fil_rev_8_21_14_0_20_64_6	0.72 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.72 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	36.23 %
Bacteroidales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales	13.04 %
Flavobacteriales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales	7.25 %
Bacteroidetes bacterium RBG_19FT_COMBO_42_7	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium RBG_19FT_COMBO_42_7	2.17 %
Bacteroidetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	2.90 %
Candidatus Woesebacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → Candidatus Woesebacteria	2.90 %
Bacteroidetes bacterium RBG_13_43_22	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium RBG_13_43_22	1.45 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	1.45 %
Chitinophagales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales	0.72 %
candidate division CPR1 bacterium ADurb.Bin160	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division CPR1 → candidate division CPR1 bacterium ADurb.Bin160	0.72 %
Enterobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae	0.72 %
Elusimicrobia bacterium CG11_big_fil_rev_8_21_14_0_20_64_6	species	All Organisms → cellular organisms → Bacteria → Elusimicrobia → unclassified Elusimicrobiota → Elusimicrobia bacterium CG11_big_fil_rev_8_21_14_0_20_64_6	0.72 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.72 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	36.23 %
unclassified Bacteroidales	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales	12.32 %
Flavobacteriaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae	5.80 %
Bacteroidetes bacterium RBG_19FT_COMBO_42_7	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium RBG_19FT_COMBO_42_7	2.17 %
Candidatus Woesebacteria bacterium RBG_13_36_22	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → Candidatus Woesebacteria → Candidatus Woesebacteria bacterium RBG_13_36_22	2.90 %
Bacteroidetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	2.90 %
Bacteroidetes bacterium RBG_13_43_22	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium RBG_13_43_22	1.45 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	1.45 %
Weeksellaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae	0.72 %
Crocinitomicaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae	0.72 %
Prevotellaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Prevotellaceae	0.72 %
Chitinophagaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	0.72 %
candidate division CPR1 bacterium ADurb.Bin160	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division CPR1 → candidate division CPR1 bacterium ADurb.Bin160	0.72 %
Enterobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae	0.72 %
Elusimicrobia bacterium CG11_big_fil_rev_8_21_14_0_20_64_6	species	All Organisms → cellular organisms → Bacteria → Elusimicrobia → unclassified Elusimicrobiota → Elusimicrobia bacterium CG11_big_fil_rev_8_21_14_0_20_64_6	0.72 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.72 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	36.23 %
Bacteroidales bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium	12.32 %
Bacteroidetes bacterium RBG_19FT_COMBO_42_7	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium RBG_19FT_COMBO_42_7	2.17 %
Candidatus Woesebacteria bacterium RBG_13_36_22	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → Candidatus Woesebacteria → Candidatus Woesebacteria bacterium RBG_13_36_22	2.90 %
Bacteroidetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	2.90 %
Salinimicrobium	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Salinimicrobium	1.45 %
Bacteroidetes bacterium RBG_13_43_22	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium RBG_13_43_22	1.45 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	1.45 %
Limnovirga	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Limnovirga	0.72 %
Chryseobacterium group	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae → Chryseobacterium group	0.72 %
Prevotella	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Prevotellaceae → Prevotella	0.72 %
unclassified Flavobacteriaceae	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae	0.72 %
Fluviicola	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → Fluviicola	0.72 %
candidate division CPR1 bacterium ADurb.Bin160	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division CPR1 → candidate division CPR1 bacterium ADurb.Bin160	0.72 %
Enterobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae	0.72 %
Elusimicrobia bacterium CG11_big_fil_rev_8_21_14_0_20_64_6	species	All Organisms → cellular organisms → Bacteria → Elusimicrobia → unclassified Elusimicrobiota → Elusimicrobia bacterium CG11_big_fil_rev_8_21_14_0_20_64_6	0.72 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.72 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	36.23 %
Bacteroidales bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium	12.32 %
Bacteroidetes bacterium RBG_19FT_COMBO_42_7	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium RBG_19FT_COMBO_42_7	2.17 %
Candidatus Woesebacteria bacterium RBG_13_36_22	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → Candidatus Woesebacteria → Candidatus Woesebacteria bacterium RBG_13_36_22	2.90 %
Bacteroidetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	2.90 %
Salinimicrobium marinum	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Salinimicrobium → Salinimicrobium marinum	1.45 %
Bacteroidetes bacterium RBG_13_43_22	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium RBG_13_43_22	1.45 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	1.45 %
Kaistella	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae → Chryseobacterium group → Kaistella	0.72 %
Limnovirga soli	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Limnovirga → Limnovirga soli	0.72 %
Flavobacteriaceae bacterium 14752	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium 14752	0.72 %
Fluviicola taffensis	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → Fluviicola → Fluviicola taffensis	0.72 %
Prevotella	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Prevotellaceae → Prevotella	0.72 %
candidate division CPR1 bacterium ADurb.Bin160	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division CPR1 → candidate division CPR1 bacterium ADurb.Bin160	0.72 %
Enterobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae	0.72 %
Elusimicrobia bacterium CG11_big_fil_rev_8_21_14_0_20_64_6	species	All Organisms → cellular organisms → Bacteria → Elusimicrobia → unclassified Elusimicrobiota → Elusimicrobia bacterium CG11_big_fil_rev_8_21_14_0_20_64_6	0.72 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.72 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	36.23 %
Bacteroidales bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium	12.32 %
Bacteroidetes bacterium RBG_19FT_COMBO_42_7	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium RBG_19FT_COMBO_42_7	2.17 %
Candidatus Woesebacteria bacterium RBG_13_36_22	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → Candidatus Woesebacteria → Candidatus Woesebacteria bacterium RBG_13_36_22	2.90 %
Bacteroidetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	2.90 %
Salinimicrobium marinum	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Salinimicrobium → Salinimicrobium marinum	1.45 %
Bacteroidetes bacterium RBG_13_43_22	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium RBG_13_43_22	1.45 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	1.45 %
Kaistella daneshvariae	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae → Chryseobacterium group → Kaistella → Kaistella daneshvariae	0.72 %
Fluviicola taffensis DSM 16823	strain	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → Fluviicola → Fluviicola taffensis → Fluviicola taffensis DSM 16823	0.72 %
Limnovirga soli	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Limnovirga → Limnovirga soli	0.72 %
Flavobacteriaceae bacterium 14752	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium 14752	0.72 %
Prevotella	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Prevotellaceae → Prevotella	0.72 %
candidate division CPR1 bacterium ADurb.Bin160	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division CPR1 → candidate division CPR1 bacterium ADurb.Bin160	0.72 %
Enterobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae	0.72 %
Elusimicrobia bacterium CG11_big_fil_rev_8_21_14_0_20_64_6	species	All Organisms → cellular organisms → Bacteria → Elusimicrobia → unclassified Elusimicrobiota → Elusimicrobia bacterium CG11_big_fil_rev_8_21_14_0_20_64_6	0.72 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.72 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2140918023\|ConsensusfromContig47809	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1172	Open in IMG/M
2140918024\|NODE_348978_length_1773_cov_7.264524	All Organisms → cellular organisms → Bacteria	1823	Open in IMG/M
3300002498\|TOLCLC_10064836	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Prevotellaceae → Prevotella	4685	Open in IMG/M
3300002551\|JGI24135J36437_1018783	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium RBG_19FT_COMBO_42_7	1210	Open in IMG/M
3300003432\|JGI20214J51088_10049187	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae	2932	Open in IMG/M
3300003432\|JGI20214J51088_10470702	All Organisms → cellular organisms → Bacteria	822	Open in IMG/M
3300003432\|JGI20214J51088_11181089	Not Available	503	Open in IMG/M
3300003541\|JGI20214J51650_10052350	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division CPR1 → candidate division CPR1 bacterium ADurb.Bin160	2713	Open in IMG/M
3300003541\|JGI20214J51650_10201959	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae	1371	Open in IMG/M
3300004155\|Ga0066600_10393417	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium	655	Open in IMG/M
3300004242\|Ga0066601_10124053	Not Available	946	Open in IMG/M
3300006224\|Ga0079037_101171677	Not Available	764	Open in IMG/M
3300006224\|Ga0079037_102063885	Not Available	570	Open in IMG/M
3300007909\|Ga0111548_1026269	Not Available	1100	Open in IMG/M
3300009053\|Ga0105095_10321750	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium	851	Open in IMG/M
3300009053\|Ga0105095_10487243	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium 14752	683	Open in IMG/M
3300009053\|Ga0105095_10517124	Not Available	662	Open in IMG/M
3300009078\|Ga0105106_10419812	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	964	Open in IMG/M
3300009081\|Ga0105098_10248684	Not Available	838	Open in IMG/M
3300009087\|Ga0105107_10254955	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1225	Open in IMG/M
3300009087\|Ga0105107_10345845	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium	1036	Open in IMG/M
3300009087\|Ga0105107_10452086	Not Available	895	Open in IMG/M
3300009087\|Ga0105107_10488275	Not Available	858	Open in IMG/M
3300009087\|Ga0105107_10700053	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	705	Open in IMG/M
3300009087\|Ga0105107_10780917	All Organisms → cellular organisms → Bacteria → Elusimicrobia → unclassified Elusimicrobiota → Elusimicrobia bacterium CG11_big_fil_rev_8_21_14_0_20_64_6	664	Open in IMG/M
3300009091\|Ga0102851_10880268	Not Available	965	Open in IMG/M
3300009091\|Ga0102851_11791816	Not Available	691	Open in IMG/M
3300009111\|Ga0115026_10647660	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae	808	Open in IMG/M
3300009167\|Ga0113563_13654863	Not Available	521	Open in IMG/M
3300009179\|Ga0115028_11872594	Not Available	524	Open in IMG/M
3300009676\|Ga0116187_1311085	Not Available	704	Open in IMG/M
3300009692\|Ga0116171_10055161	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	2554	Open in IMG/M
3300009694\|Ga0116170_10281970	Not Available	944	Open in IMG/M
3300009771\|Ga0116155_10048516	Not Available	2056	Open in IMG/M
3300009838\|Ga0116153_10168188	All Organisms → cellular organisms → Bacteria	907	Open in IMG/M
3300010293\|Ga0116204_1136013	All Organisms → cellular organisms → Bacteria	828	Open in IMG/M
3300010346\|Ga0116239_10592362	Not Available	721	Open in IMG/M
3300010429\|Ga0116241_10137313	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	2072	Open in IMG/M
3300010429\|Ga0116241_10440258	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium	1025	Open in IMG/M
3300012964\|Ga0153916_10447664	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1357	Open in IMG/M
(restricted) 3300013128\|Ga0172366_10449793	Not Available	778	Open in IMG/M
(restricted) 3300013128\|Ga0172366_10912742	Not Available	507	Open in IMG/M
(restricted) 3300013129\|Ga0172364_10295040	Not Available	1062	Open in IMG/M
(restricted) 3300013129\|Ga0172364_10340387	Not Available	973	Open in IMG/M
(restricted) 3300013130\|Ga0172363_10106071	All Organisms → cellular organisms → Bacteria	1969	Open in IMG/M
(restricted) 3300013133\|Ga0172362_10300495	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1137	Open in IMG/M
(restricted) 3300013133\|Ga0172362_11161242	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium	506	Open in IMG/M
3300014300\|Ga0075321_1001953	All Organisms → cellular organisms → Bacteria	2627	Open in IMG/M
3300014300\|Ga0075321_1043242	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	778	Open in IMG/M
3300014314\|Ga0075316_1046286	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	934	Open in IMG/M
3300018070\|Ga0184631_10129938	Not Available	1003	Open in IMG/M
3300023207\|Ga0255811_10460029	Not Available	895	Open in IMG/M
3300024262\|Ga0210003_1155899	All Organisms → cellular organisms → Bacteria	973	Open in IMG/M
3300025499\|Ga0207931_1014496	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium RBG_19FT_COMBO_42_7	1860	Open in IMG/M
3300025499\|Ga0207931_1088279	Not Available	579	Open in IMG/M
3300025716\|Ga0209746_1055923	All Organisms → cellular organisms → Bacteria	1317	Open in IMG/M
3300025740\|Ga0208940_1278614	Not Available	509	Open in IMG/M
3300025864\|Ga0209429_10056514	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium RBG_19FT_COMBO_42_7	1811	Open in IMG/M
3300025865\|Ga0209226_10034672	Not Available	2274	Open in IMG/M
3300026066\|Ga0208290_1035950	Not Available	552	Open in IMG/M
3300027731\|Ga0209592_1063737	Not Available	1369	Open in IMG/M
3300027739\|Ga0209575_10098196	Not Available	1067	Open in IMG/M
3300027792\|Ga0209287_10134632	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium RBG_13_43_22	933	Open in IMG/M
3300027818\|Ga0209706_10140782	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1189	Open in IMG/M
3300027818\|Ga0209706_10244306	Not Available	861	Open in IMG/M
3300027841\|Ga0209262_10623423	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae → Chryseobacterium group → Kaistella → Kaistella daneshvariae	523	Open in IMG/M
3300031255\|Ga0315554_1108479	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium	1013	Open in IMG/M
3300031257\|Ga0315555_1152402	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	981	Open in IMG/M
3300031275\|Ga0307437_1034858	Not Available	1830	Open in IMG/M
3300031278\|Ga0307431_1019913	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	2339	Open in IMG/M
3300031280\|Ga0307428_1078455	Not Available	904	Open in IMG/M
3300031337\|Ga0307430_1114184	Not Available	728	Open in IMG/M
3300031337\|Ga0307430_1120583	Not Available	697	Open in IMG/M
3300031355\|Ga0307421_1083984	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium	1056	Open in IMG/M
3300031355\|Ga0307421_1118846	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	838	Open in IMG/M
3300031356\|Ga0307439_1114604	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae	774	Open in IMG/M
3300031357\|Ga0307435_1119789	All Organisms → cellular organisms → Bacteria	597	Open in IMG/M
3300031358\|Ga0307438_1069943	All Organisms → cellular organisms → Bacteria	1098	Open in IMG/M
3300031358\|Ga0307438_1088255	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → Candidatus Woesebacteria → Candidatus Woesebacteria bacterium RBG_13_36_22	920	Open in IMG/M
3300031364\|Ga0307445_10158030	Not Available	817	Open in IMG/M
3300031365\|Ga0307443_1062579	All Organisms → cellular organisms → Bacteria	1135	Open in IMG/M
3300031369\|Ga0307422_1037107	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1747	Open in IMG/M
3300031369\|Ga0307422_1072648	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1093	Open in IMG/M
3300031369\|Ga0307422_1135924	Not Available	700	Open in IMG/M
3300031369\|Ga0307422_1146161	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	665	Open in IMG/M
3300031379\|Ga0307434_1152712	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia	631	Open in IMG/M
3300031537\|Ga0307419_10349766	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium	520	Open in IMG/M
3300031539\|Ga0307380_11092808	All Organisms → cellular organisms → Bacteria	628	Open in IMG/M
3300031539\|Ga0307380_11487234	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → Candidatus Woesebacteria → Candidatus Woesebacteria bacterium RBG_13_36_22	505	Open in IMG/M
3300031551\|Ga0315548_1097666	Not Available	1158	Open in IMG/M
3300031553\|Ga0315547_1030175	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	2243	Open in IMG/M
3300031553\|Ga0315547_1162051	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → Fluviicola → Fluviicola taffensis → Fluviicola taffensis DSM 16823	721	Open in IMG/M
3300031554\|Ga0315544_1218446	Not Available	504	Open in IMG/M
3300031565\|Ga0307379_11089556	Not Available	672	Open in IMG/M
3300031565\|Ga0307379_11196724	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium	630	Open in IMG/M
3300031575\|Ga0315532_1024502	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia	2650	Open in IMG/M
3300031575\|Ga0315532_1132617	Not Available	746	Open in IMG/M
3300031578\|Ga0307376_10236001	All Organisms → cellular organisms → Bacteria	1237	Open in IMG/M
3300031586\|Ga0315541_1217579	Not Available	513	Open in IMG/M
3300031620\|Ga0315552_1019456	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	3158	Open in IMG/M
3300031620\|Ga0315552_1021461	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium	2966	Open in IMG/M
3300031620\|Ga0315552_1062236	Not Available	1435	Open in IMG/M
3300031620\|Ga0315552_1116479	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Salinimicrobium → Salinimicrobium marinum	907	Open in IMG/M
3300031620\|Ga0315552_1140556	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	786	Open in IMG/M
3300031620\|Ga0315552_1169569	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae	680	Open in IMG/M
3300031624\|Ga0315545_1018554	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	4546	Open in IMG/M
3300031650\|Ga0315539_1122545	Not Available	863	Open in IMG/M
3300031652\|Ga0315553_10437275	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → Candidatus Woesebacteria → Candidatus Woesebacteria bacterium RBG_13_36_22	511	Open in IMG/M
3300031653\|Ga0315550_1085969	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	1368	Open in IMG/M
3300031654\|Ga0315549_1017593	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	4753	Open in IMG/M
3300031654\|Ga0315549_1041707	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	2624	Open in IMG/M
3300031654\|Ga0315549_1110528	Not Available	1254	Open in IMG/M
3300031654\|Ga0315549_1134608	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium	1073	Open in IMG/M
3300031654\|Ga0315549_1179055	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium	855	Open in IMG/M
3300031698\|Ga0315537_1156095	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Salinimicrobium → Salinimicrobium marinum	1030	Open in IMG/M
3300031699\|Ga0315535_1195616	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	712	Open in IMG/M
3300031707\|Ga0315291_10142436	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	2519	Open in IMG/M
3300031772\|Ga0315288_11725409	Not Available	503	Open in IMG/M
3300031864\|Ga0315538_1060095	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium	991	Open in IMG/M
3300031885\|Ga0315285_10639737	All Organisms → cellular organisms → Bacteria → FCB group	697	Open in IMG/M
3300031949\|Ga0214473_10276346	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1924	Open in IMG/M
3300032053\|Ga0315284_10688117	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Limnovirga → Limnovirga soli	1203	Open in IMG/M
3300032062\|Ga0315551_10130072	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae	1112	Open in IMG/M
3300032062\|Ga0315551_10137846	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium RBG_13_43_22	1066	Open in IMG/M
3300032118\|Ga0315277_10468835	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium	1272	Open in IMG/M
3300032156\|Ga0315295_10093441	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → Candidatus Woesebacteria → Candidatus Woesebacteria bacterium RBG_13_36_22	2918	Open in IMG/M
3300032156\|Ga0315295_10479640	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1264	Open in IMG/M
3300032156\|Ga0315295_10751395	Not Available	981	Open in IMG/M
3300032156\|Ga0315295_11865384	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium	568	Open in IMG/M
3300032401\|Ga0315275_12507492	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium	533	Open in IMG/M
3300033433\|Ga0326726_10007233	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	9923	Open in IMG/M
3300033485\|Ga0316626_10261983	All Organisms → cellular organisms → Bacteria	1391	Open in IMG/M
3300033485\|Ga0316626_10767394	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium	844	Open in IMG/M
3300033489\|Ga0299912_11095753	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	587	Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	92.03%
Engineered	Engineered	7.97%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	75.36%
Terrestrial	Environmental → Terrestrial	16.67%
Wastewater	Engineered → Wastewater	7.25%
Bioreactor	Engineered → Bioreactor	0.72%

Habitat	Taxonomy	Distribution
Marine	Environmental → Aquatic → Marine	39.86%
Freshwater	Environmental → Aquatic → Freshwater	34.06%
Soil	Environmental → Terrestrial → Soil	15.94%
Anaerobic Digestor	Engineered → Wastewater → Anaerobic Digestor	6.52%
Sediment	Environmental → Aquatic → Sediment	1.45%
Peat	Environmental → Terrestrial → Peat	0.72%
Industrial Wastewater	Engineered → Wastewater → Industrial Wastewater	0.72%
Anaerobic	Engineered → Bioreactor → Anaerobic	0.72%

Habitat	Taxonomy	Distribution
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	34.78%
Sediment	Environmental → Aquatic → Freshwater → Sediment	13.04%
Lake	Environmental → Aquatic → Freshwater → Lake	13.04%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	7.97%
Unclassified	Engineered → Wastewater → Anaerobic Digestor → Unclassified	6.52%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	5.07%
Wetlands	Environmental → Aquatic → Marine → Wetlands	4.35%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	4.35%
Clay	Environmental → Terrestrial → Soil → Clay	3.62%
Pond	Environmental → Aquatic → Freshwater → Pond	2.90%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	1.45%
Oceanic	Environmental → Aquatic → Marine → Oceanic	0.72%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	0.72%
Petrochemical	Engineered → Wastewater → Industrial Wastewater → Petrochemical	0.72%
Unclassified	Engineered → Bioreactor → Anaerobic → Unclassified	0.72%

Habitat	Taxonomy	Distribution
Salt Marsh	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh	34.78%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	13.04%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	12.32%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	6.52%
Unclassified	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified	6.52%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	5.07%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	4.35%
Sediment	Environmental → Aquatic → Marine → Wetlands → Sediment	3.62%
Unclassified	Environmental → Terrestrial → Soil → Clay → Unclassified	3.62%
Sediment	Environmental → Aquatic → Freshwater → Pond → Sediment	2.90%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	1.45%
Uranium Contaminated	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated	1.45%
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	0.72%
Sediment	Environmental → Aquatic → Marine → Oceanic → Sediment	0.72%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	0.72%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	0.72%
Unclassified	Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified	0.72%
Unclassified	Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified	0.72%

Habitat	Taxonomy	Distribution
Salt Marsh Sediment	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment	21.01%
Salt Marsh	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh	13.77%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	12.32%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	11.59%
Anaerobic Digestor Sludge	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge	6.52%
Arctic Peat Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil	5.07%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	3.62%
Wetland	Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland	3.62%
Soil	Environmental → Terrestrial → Soil → Clay → Unclassified → Soil	3.62%
Freshwater	Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater	2.90%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	2.90%
Wetland	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland	1.45%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	1.45%
Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil	1.45%
Soil	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil	1.45%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	1.45%
Anoxic Lake Water	Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Lake Water	0.72%
Deep Subsurface	Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface	0.72%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	0.72%
Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment	0.72%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.72%
Peat Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil	0.72%
Hydrocarbon Resource Environments	Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments	0.72%
Anaerobic Digester Digestate	Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Digester Digestate	0.72%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2140918023	Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog Site B3	Environmental	Open in IMG/M
2140918024	Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog_all	Environmental	Open in IMG/M
3300002498	Hydrocarbon resource environments microbial communities from Canada and USA - Toluene degrading community from Alberta, Canada	Engineered	Open in IMG/M
3300002551	Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0011-211	Environmental	Open in IMG/M
3300003432	Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk	Environmental	Open in IMG/M
3300003541	Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk	Environmental	Open in IMG/M
3300004155	Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11	Environmental	Open in IMG/M
3300004242	Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Medium cellulose week 11	Environmental	Open in IMG/M
3300005219	Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailB_D2	Environmental	Open in IMG/M
3300006224	Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG	Environmental	Open in IMG/M
3300007909	Microbial communities from sediment of the River Tyne Estuary, UK ? Pasteurized_686d_2	Environmental	Open in IMG/M
3300009053	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015	Environmental	Open in IMG/M
3300009078	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015	Environmental	Open in IMG/M
3300009081	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015	Environmental	Open in IMG/M
3300009087	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015	Environmental	Open in IMG/M
3300009091	Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly)	Environmental	Open in IMG/M
3300009111	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1	Environmental	Open in IMG/M
3300009167	Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)	Environmental	Open in IMG/M
3300009179	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1	Environmental	Open in IMG/M
3300009676	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA6_MetaG	Engineered	Open in IMG/M
3300009692	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW2_MetaG	Engineered	Open in IMG/M
3300009694	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW1_MetaG	Engineered	Open in IMG/M
3300009771	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC032_MetaG	Engineered	Open in IMG/M
3300009838	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC028_MetaG	Engineered	Open in IMG/M
3300010293	Anoxic lake water microbial communities from Lake Kivu, Rwanda to study Microbial Dark Matter (Phase II) - Lake Kivu water 52m metaG	Environmental	Open in IMG/M
3300010346	AD_USMOca	Engineered	Open in IMG/M
3300010429	AD_USRAca	Engineered	Open in IMG/M
3300012964	Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG	Environmental	Open in IMG/M
3300013128 (restricted)	Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 69cm	Environmental	Open in IMG/M
3300013129 (restricted)	Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 10cm	Environmental	Open in IMG/M
3300013130 (restricted)	Sediment microbial communities from Lake Kivu, Rwanda - Sediment s2_kivu2a2	Environmental	Open in IMG/M
3300013133 (restricted)	Sediment microbial communities from Lake Kivu, Rwanda - Sediment s1_kivu2a2	Environmental	Open in IMG/M
3300014300	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D1	Environmental	Open in IMG/M
3300014314	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleA_D2	Environmental	Open in IMG/M
3300018070	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b1	Environmental	Open in IMG/M
3300023207	Combined Assembly of Gp0238866, Gp0238878, Gp0238879	Engineered	Open in IMG/M
3300024262	Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes)	Environmental	Open in IMG/M
3300025499	Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 deep-092012 (SPAdes)	Environmental	Open in IMG/M
3300025716	Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0011-211 (SPAdes)	Environmental	Open in IMG/M
3300025740	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA6_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025836	Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 004-21A (SPAdes)	Environmental	Open in IMG/M
3300025864	Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-212 (SPAdes)	Environmental	Open in IMG/M
3300025865	Arctic peat soil from Barrow, Alaska, USA - Barrow Graham LP Ref core NGADG0011-212 (SPAdes)	Environmental	Open in IMG/M
3300026066	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1 (SPAdes)	Environmental	Open in IMG/M
3300027713	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 (SPAdes)	Environmental	Open in IMG/M
3300027731	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 (SPAdes)	Environmental	Open in IMG/M
3300027739	Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Medium cellulose week 11 (SPAdes)	Environmental	Open in IMG/M
3300027792	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 (SPAdes)	Environmental	Open in IMG/M
3300027818	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 (SPAdes)	Environmental	Open in IMG/M
3300027841	Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11 (SPAdes)	Environmental	Open in IMG/M
3300031255	Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1603-70	Environmental	Open in IMG/M
3300031257	Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1603-80	Environmental	Open in IMG/M
3300031275	Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-90	Environmental	Open in IMG/M
3300031278	Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-170	Environmental	Open in IMG/M
3300031280	Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-240	Environmental	Open in IMG/M
3300031337	Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-130	Environmental	Open in IMG/M
3300031355	Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1602-70	Environmental	Open in IMG/M
3300031356	Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1604-90	Environmental	Open in IMG/M
3300031357	Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1604-70	Environmental	Open in IMG/M
3300031358	Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-110	Environmental	Open in IMG/M
3300031364	Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - SW1603-30	Environmental	Open in IMG/M
3300031365	Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - SW1601-220	Environmental	Open in IMG/M
3300031369	Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1602-90	Environmental	Open in IMG/M
3300031379	Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-220	Environmental	Open in IMG/M
3300031537	Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1602-30	Environmental	Open in IMG/M
3300031539	Soil microbial communities from Risofladan, Vaasa, Finland - UN-3	Environmental	Open in IMG/M
3300031551	Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-110	Environmental	Open in IMG/M
3300031553	Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-240	Environmental	Open in IMG/M
3300031554	Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-130	Environmental	Open in IMG/M
3300031565	Soil microbial communities from Risofladan, Vaasa, Finland - UN-2	Environmental	Open in IMG/M
3300031575	Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment WE1603-70	Environmental	Open in IMG/M
3300031578	Soil microbial communities from Risofladan, Vaasa, Finland - TR-2	Environmental	Open in IMG/M
3300031586	Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-190	Environmental	Open in IMG/M
3300031620	Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-70	Environmental	Open in IMG/M
3300031624	Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1602-10	Environmental	Open in IMG/M
3300031650	Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-150	Environmental	Open in IMG/M
3300031652	Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-40	Environmental	Open in IMG/M
3300031653	Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-90	Environmental	Open in IMG/M
3300031654	Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-200	Environmental	Open in IMG/M
3300031698	Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1602-70	Environmental	Open in IMG/M
3300031699	Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1602-20	Environmental	Open in IMG/M
3300031707	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20	Environmental	Open in IMG/M
3300031772	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20	Environmental	Open in IMG/M
3300031864	Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-230	Environmental	Open in IMG/M
3300031885	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36	Environmental	Open in IMG/M
3300031949	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197	Environmental	Open in IMG/M
3300032053	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16	Environmental	Open in IMG/M
3300032062	Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1602-90	Environmental	Open in IMG/M
3300032118	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15	Environmental	Open in IMG/M
3300032156	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0	Environmental	Open in IMG/M
3300032401	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0	Environmental	Open in IMG/M
3300033433	Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN	Environmental	Open in IMG/M
3300033485	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_A	Environmental	Open in IMG/M
3300033489	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.44
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.44
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F056198

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
B3_GZBA_C_00699790	2140918023	Soil	SWYFSQKVVTVQGGYGALFAVMVQILLSITSVAVQV
B_all_v_02439850	2140918024	Soil	SCFFSREMVTVQGGYGVLFAIMVQIFLGFGAIAVQGF
TOLCLC_100648366	3300002498	Hydrocarbon Resource Environments	SNLTVKLGIFFSQKAVTVQGGYGALFAVRVQILLSITRVAVQV*
JGI24135J36437_10187831	3300002551	Arctic Peat Soil	GGCVTRREHRAGSWYFSQKTVTVQGGYGALFAVMVQILLSAGAIAVQF*
JGI20214J51088_100491874	3300003432	Wetland	RKHRAGSWYFSQKAVTVQGGYGALFAVMVQILLSAGAIAVQF*
JGI20214J51088_104707022	3300003432	Wetland	KHRAGSWYFSWKTVTVQGGYGVVFAIRVQVLIEDTCVAVQI*
JGI20214J51088_111810891	3300003432	Wetland	VTRRKHRAGSWYFSRQIITVQGGYGALFAVMAQILLSITRVAVQG*
JGI20214J51650_100523501	3300003541	Wetland	GGCVTRRKHRAGSWYFSQKAVTVQGGYGALFAVRVQILLSFTRVAVQV*
JGI20214J51650_102019593	3300003541	Wetland	GGCVTRRKHRAGSWYFSQKAVTVQGGYGALFAVMVQILLSAGAIAVQF*
Ga0066600_103934172	3300004155	Freshwater	HRAESWYFSREVVTVQGGYGVLFAVRIQVLLSITRVAVQG*
Ga0066601_101240531	3300004242	Freshwater	IRAGSWYFSQKFVTVQGGYGAVFAVMAQILIRSGVIAVQV*
Ga0069004_103079671	3300005219	Natural And Restored Wetlands	PGTRQLAGQKAVTVQGGYGVVFAVWVQTLFNITSVAEQV*
Ga0079037_1011716772	3300006224	Freshwater Wetlands	FSQKAVTVQGGYGVVFAIQVQVLIEDTRVAVQI**
Ga0079037_1020638852	3300006224	Freshwater Wetlands	YFSHKAVTVQGGYGALFAVMVQILLSITRVAVQV*
Ga0111548_10262693	3300007909	Sediment	RLHRAGSWYFSQKAVTVQGGYGALFAIMVQILLCAGAIAVQF*
Ga0105095_103217502	3300009053	Freshwater Sediment	YFSQKAVTVQGGYGALFAVRVQVLLSITRVAVQG*
Ga0105095_104872431	3300009053	Freshwater Sediment	AGSWYFSHKTVTVQGGYGALFAVRVQILLNITRVAAQV*
Ga0105095_105171241	3300009053	Freshwater Sediment	SRYFSQKAVTVQGGYGALFAVRVQILLSITRVAVQV*
Ga0105106_104198122	3300009078	Freshwater Sediment	GSWYFSQKAVTVQGGYGALFAVMVQILLSITRVAVQV*
Ga0105098_102486841	3300009081	Freshwater Sediment	GSSFFSQKTVTVQGGYGVVFAIRVQVMIEDTSVAVQV*
Ga0105107_102549551	3300009087	Freshwater Sediment	SWYFSQKAVTVQGGYGALFAVMVQILLSITRVAVQV*
Ga0105107_103458451	3300009087	Freshwater Sediment	HRAESWYFSQKAVTVQGGYGALFAVRVQILLNITRVAVQV*
Ga0105107_104520862	3300009087	Freshwater Sediment	YFSQKAVTVQGGYGALFAVRVQIVLSITRVAVQS*
Ga0105107_104882752	3300009087	Freshwater Sediment	FFSQKAVTVQGGYGALFAVMVQILLSITRVAVQV*
Ga0105107_107000532	3300009087	Freshwater Sediment	WYFSHKIVTVQGGYGALFAVMVQILLSITRVAVQV*
Ga0105107_107809171	3300009087	Freshwater Sediment	GIRQKAVTVQGGYGALFAVRVQILLSITRVAVQV*
Ga0102851_108802681	3300009091	Freshwater Wetlands	GSWYFSQKAVTVQGGYGALFAVQVQILLSITRVAVQV*
Ga0102851_117918161	3300009091	Freshwater Wetlands	VSWYFSHEAVTAQGGYGVLFVVMVQILLSITRVAVQV
Ga0115026_106476601	3300009111	Wetland	YFSQKAVTVQGGYGALFAVRVQVLLSITRVAVQV*
Ga0113563_136548632	3300009167	Freshwater Wetlands	VFFSHIAVTVQGKYGALFAVRVQILLSISRVAGQV*
Ga0115028_118725941	3300009179	Wetland	YFSQKTVTVQGGYGALFAVRVQILLSITRVAVQV*
Ga0116187_13110851	3300009676	Anaerobic Digestor Sludge	SWYFSQKAVTVQGGFGAVFGIQVQILIEAGRVAVQS*
Ga0116171_100551611	3300009692	Anaerobic Digestor Sludge	RQRGQKAVTVQGGFGAVFGIQVQIFVRTTRVAVQV*
Ga0116170_102819701	3300009694	Anaerobic Digestor Sludge	WGGCVTRRRIRAGSRYFSQQAVTVQGGYGAVFAVRVQVLLSITRVAVQV*
Ga0116155_100485164	3300009771	Anaerobic Digestor Sludge	VPVGQKAVPVQGGFGVVFGIQVQMFVSITRVAVQG*
Ga0116153_101681883	3300009838	Anaerobic Digestor Sludge	SRYFSQKAVTVQGGYGALFAIRVQVLMSITRVAVQS*
Ga0116204_11360132	3300010293	Anoxic Lake Water	GSCFFSQKAVTVQGGYGVVFAVIVQSLTEAGRVAVQF*
Ga0116239_105923622	3300010346	Anaerobic Digestor Sludge	DAASGHLSRYFSQKTVTVQGGYGALFAVMVQILLSITRVAVQV*
Ga0116241_101373131	3300010429	Anaerobic Digestor Sludge	SSYFSQKAVTVQGGYGALFAVTVQILLSITRVAVQV*
Ga0116241_104402582	3300010429	Anaerobic Digestor Sludge	KHRAESWYFSREAVTVQGGYGVVFAIRVQVLIKDTRVAVQS*
Ga0153916_104476642	3300012964	Freshwater Wetlands	AGSWFFSREAVTVQGGYGAVFAIMIQILLSAGAIAVQV*
Ga0153916_116465081	3300012964	Freshwater Wetlands	YPTQHRAESCFFSREVVTVQGGYGVLFADMVQISLSAGAIAVQV*
(restricted) Ga0172366_104497932	3300013128	Sediment	YFSQNAVTVQGGYGALFAVMAQIFLSITRVAVQV*
(restricted) Ga0172366_109127422	3300013128	Sediment	KVPAGQKAVTVQGGYGALFAVQVQSFVSITSVVVQG*
(restricted) Ga0172364_102950402	3300013129	Sediment	WYFSQKAVTVQGGFGAVFGIQVQILIEAGRVAVQI*
(restricted) Ga0172364_103403872	3300013129	Sediment	RAESWYFSRETVTVQGGYGALFAVQVQSFVSITRVAVQV*
(restricted) Ga0172363_101060711	3300013130	Sediment	WGGCVTRRSIRAESWYFSHQVVPVQGGYGALFAVMVQILLRTGAVAIQV*
(restricted) Ga0172362_103004951	3300013133	Sediment	QRGQKTVTVQGGYGALFAVRVQILLSITRVAVQVL*
(restricted) Ga0172362_111612421	3300013133	Sediment	ESWYFSREAVTVQGGYGVVFAVMVQVLLSASAIAVHV*
Ga0075321_10019531	3300014300	Natural And Restored Wetlands	QRGQKFVTVQGGYGALFAVMVQILLSITRVAIQG*
Ga0075321_10432422	3300014300	Natural And Restored Wetlands	WYFSRETVTVQGGYGVLFAIMVQILLRTGAIAVQV*
Ga0075316_10462861	3300014314	Natural And Restored Wetlands	RAGSWYFSHKAVTVQGGYGAFFAVMVQILMSITRVAVQG*
Ga0184631_101299382	3300018070	Groundwater Sediment	SWYFSQKAVTVQGGYGALFAVMVQILLSAGAIAVQV
Ga0255811_104600291	3300023207	Anaerobic Digester Digestate	SVPVGQKAVTVQGGFGAVFGIQVQILLSITCVAVQG
Ga0210003_11558991	3300024262	Deep Subsurface	VFFSQKAVTVQGGYGALFAVRVQIFVSITSVAVQV
Ga0207931_10144962	3300025499	Arctic Peat Soil	GSWYFSQKTVTVQGGYGALFAVMVQILLSAGAIAVQF
Ga0207931_10882791	3300025499	Arctic Peat Soil	VTLFFSRSAITVQGGYGALFAVMVQVLLSITSVAVQV
Ga0209746_10559231	3300025716	Arctic Peat Soil	YFSQKAVTVQGGYGALFAVMVQILLSSCAIAVQGF
Ga0208940_12786141	3300025740	Anaerobic Digestor Sludge	SWYFSQKAVTVQGGFGAVFGIQVQILIEAGRVAVQS
Ga0209748_11033632	3300025836	Arctic Peat Soil	SRRRIRARSRYFSQKFIPVQGGYGVLFAIMAQILLGAGAIAVQF
Ga0209429_100565143	3300025864	Arctic Peat Soil	REHRAGSWYFSQKTVTVQGGYGALFAVMVQILLSAGAIAVQF
Ga0209226_100346724	3300025865	Arctic Peat Soil	KHRAGSWYFSQKTVTVQGGYGALFAVMVQILLSITRVAVQV
Ga0208290_10359501	3300026066	Natural And Restored Wetlands	PGRSWYFRQKIVTVQGGYGVLFAVMAGIILRTGAVAVQ
Ga0209286_11950871	3300027713	Freshwater Sediment	LQGWHVTRRSIRAGFWYFSHKAVTVQGGYGALFAVMAKILLSI
Ga0209592_10637371	3300027731	Freshwater Sediment	RRSIRAGSWYFSHKTVTVQGGYGALFAVRVQILLSITRVAVQGLSEP
Ga0209575_100981962	3300027739	Freshwater	WGGCVTRRSIRSGSRYFSQKAVTVQGGYGALFAVRVQVLLSITRVAVQV
Ga0209287_101346321	3300027792	Freshwater Sediment	REHRAGSWYFSREAVPVQGGYGALFAVMVQIMLNITRVAVQV
Ga0209706_101407821	3300027818	Freshwater Sediment	SWYFSQKAVTVQGGYGALFAVMVQILLSITRVAVQV
Ga0209706_102443061	3300027818	Freshwater Sediment	WYFSQKSVTVQGGYGALFAVRVQILLSITRVAVQS
Ga0209262_106234231	3300027841	Freshwater	RVTRRKHRAESWYISQKAVTVQGGYGALFVVMVQILLSACAIAVQV
Ga0315554_11084792	3300031255	Salt Marsh Sediment	RAVSWYFSREIVTVQGGYGALFAVMVQILLSITRVAVQG
Ga0315555_11524021	3300031257	Salt Marsh Sediment	RRKHRAGSWYFSHIAVTVQGGYGALFAVRIQVLFSITRVAVQV
Ga0307437_10348581	3300031275	Salt Marsh	IRAESWYFSPKAVTVQGGYGALFAVMVQILLSITRVAVQG
Ga0307431_10199131	3300031278	Salt Marsh	TRRKHRAESWYFSQKAVTVQGGYGALFAVQVQILLSITRVAVQV
Ga0307428_10784551	3300031280	Salt Marsh	RRSIRAESWYFSQKAVTVQGGYGALFAVMVQILLSITCVAVQV
Ga0307430_11141842	3300031337	Salt Marsh	VTRRSIRAESWYFSQKAVTVQGGYGALFAVMVQVLLRAGTIAVQV
Ga0307430_11205831	3300031337	Salt Marsh	MYFSHETVTVQGGYGALFAVRVQSFVSITRVAVQV
Ga0307421_10839842	3300031355	Salt Marsh	SIRAESWFFSREAVTVQGGYGALFAVQVQVLLSITCVAVQG
Ga0307421_11188462	3300031355	Salt Marsh	KHRAASWYFSQKTVTVQGGYGALFAVMVQILLSITRVAVQV
Ga0307439_11146042	3300031356	Salt Marsh	IRVVSWYFSREAVTVQGGYGVLFAVMGQIVLSITRVAVQF
Ga0307435_11197891	3300031357	Salt Marsh	RAESWYFSQKAVTVQGGYGALFAVQVQILLSITRVAVQV
Ga0307438_10699432	3300031358	Salt Marsh	RPVNFSQKAVTVQGGYGALFAVMVQLLLSITSVAVQV
Ga0307438_10882551	3300031358	Salt Marsh	PSTRGQKAVTVQGVYGALFAVMVQILLSTGEIALQV
Ga0307445_101580302	3300031364	Salt Marsh	AGSWYFSQKAVTVQGGYGALFAVMVQILLSITSVEVQV
Ga0307443_10625791	3300031365	Salt Marsh	RAESWHFSREVVTVQGGYGALFAVRVQILLSITSVAVQV
Ga0307422_10371074	3300031369	Salt Marsh	WGGCVTRRKHRAESRFFSREAVTVQGGYGALFAVMVQILLSITRVAVQV
Ga0307422_10726481	3300031369	Salt Marsh	AVSWYFSREIVTVQGGYGALFAVMVQILLSITRVAVQG
Ga0307422_11359241	3300031369	Salt Marsh	ASRYFRQITVPVQARYGVLFAVMVQILLRAGAVAVQV
Ga0307422_11461612	3300031369	Salt Marsh	GCVTRRKHRAGSWYFSREFVTVQGGYGALFAVQVQSFVSITRVAVQV
Ga0307434_11527122	3300031379	Salt Marsh	AVSINFSQDTIPVQGRYGSLFAVMVQILLCSGVIALQV
Ga0307419_103497661	3300031537	Salt Marsh	RRKHRVGSWYFSQKAVTVQGGYGALFAVMVQSWLSITRVAVQI
Ga0307380_110928081	3300031539	Soil	WYFRREIVTVQGGYGAFFAVQVEGLLGYTSVVVQG
Ga0307380_114872341	3300031539	Soil	RAGSWYFSQKAVTVQGGYGAVFAVMVQILLSITRVAVQV
Ga0315548_10976661	3300031551	Salt Marsh Sediment	KHRPRPMFFSQKAVTVQGGYGALFAVQVQILLSITRVAVQV
Ga0315547_10301751	3300031553	Salt Marsh Sediment	ESWHFSREVVTVQGGYGALFAVRVQILLSITSVAVQV
Ga0315547_11620511	3300031553	Salt Marsh Sediment	GGCVTRRSIRAESWYFSQKAVTVQGGYGALFAVQVQSLLSITSVAVQG
Ga0315544_12184462	3300031554	Salt Marsh Sediment	TPSTRGHKAVTVQGGYGALFAVRVQILLSITRVAIQV
Ga0307379_110895562	3300031565	Soil	WYFSREAVTVQGGYGALFAVQVQSFVNITRVAVQV
Ga0307379_111967241	3300031565	Soil	GSWYFSQKAVTVQGGYGALFAVRVQILLSITRVAVQG
Ga0315532_10245021	3300031575	Salt Marsh Sediment	SWYFSRETVTVQGGYGALFAVQVQILLSITRVAVQV
Ga0315532_11326171	3300031575	Salt Marsh Sediment	PSTRGQKAVTVQGGYGALFAVRVQSWLSITRVAVQV
Ga0307376_102360011	3300031578	Soil	AGTWCFSQKTVTVQGGYGALFAVMVQILLLAGAIAVQV
Ga0315541_12175791	3300031586	Salt Marsh Sediment	CVTRRKHLVRPVNFSQKTVTVQGGYGALFAVMVQILLSITRVAVQV
Ga0315552_10194565	3300031620	Salt Marsh Sediment	REHRPRPVNFSEKTVTVQGGYGALFAVMVQIILSITRVAVQV
Ga0315552_10214611	3300031620	Salt Marsh Sediment	HRAESWYFSQKAVTVQGGYGALFAVQVQILLSITRVAVQV
Ga0315552_10622361	3300031620	Salt Marsh Sediment	RPLSLIFSQKTVTVQGGYGALFAVRVKILLSITSVAVQG
Ga0315552_11164792	3300031620	Salt Marsh Sediment	RPRPVFFSHKAVTVQGGYGALFAVMVQILLNITRVAVQG
Ga0315552_11405561	3300031620	Salt Marsh Sediment	RAVSMFFSQEAVTVQGGYGALFAVQVQILLNITRVAVQS
Ga0315552_11695691	3300031620	Salt Marsh Sediment	GCVTRRSIRVVSWYFSREAVTVQGGYGVLFAVMGQIVLSITRVAVQF
Ga0315545_10185541	3300031624	Salt Marsh Sediment	VTRRSIRAESWYFSQKAVTVQGGYGALFAVMVQILLSITCVAVQV
Ga0315539_11225452	3300031650	Salt Marsh Sediment	PSTRGQKAVTVQGGYGALFAVMVQILLSITHVAVQF
Ga0315553_104372751	3300031652	Salt Marsh Sediment	SIRAESWYFSREIVTVQGGYGALFAVRVQILLSITRVAVQV
Ga0315550_10859691	3300031653	Salt Marsh Sediment	SWYFSQKAVTVQGGYGALFAIRVQILLSITRVAVQV
Ga0315549_10175936	3300031654	Salt Marsh Sediment	STRGQKAVTVQGGYGALFAVMVQILLSITRVAVQV
Ga0315549_10417071	3300031654	Salt Marsh Sediment	SRFFSREVVTVQGGYGALFAVMVQSFVSITRVAVQV
Ga0315549_11105281	3300031654	Salt Marsh Sediment	VESWYFSQKVVTVQGGYGALFAVMVQILLSITSVAVQV
Ga0315549_11346081	3300031654	Salt Marsh Sediment	SWYFSQKTVTVQGGYGALFAVMAGIILSIMCIAVQG
Ga0315549_11790552	3300031654	Salt Marsh Sediment	IRVESWYFSRETVKVQGGYGALFAVMVQILLSITRVAVQV
Ga0315537_11560952	3300031698	Salt Marsh Sediment	RREHRPRPVFFSHKAVTVQGGYGALFAVMVQILLNITRVAVQG
Ga0315535_11956161	3300031699	Salt Marsh Sediment	IRQLSWYFSRKTVPVQGGYGVLFAVMVQILLRSGVVAVQV
Ga0315291_101424361	3300031707	Sediment	AESRYFSRETVTVQGGYGALFAVRVQILLSITRVAVQV
Ga0315288_117254091	3300031772	Sediment	SRYFSREAVTVQGGYGALFAVMVQFLLSITRVAVQG
Ga0315538_10600951	3300031864	Salt Marsh Sediment	IRAESWFFSREAVTVQGGYGALFAVQVQVLLSITCVAVQG
Ga0315285_106397372	3300031885	Sediment	RSIRAESWYFSQKAVTVQGGYGALFAVMVQILLSITRVAVQV
Ga0214473_102763461	3300031949	Soil	GSWYFSQKAVTVQGGYGALFAVMVQILLSAGAIAVQF
Ga0315284_106881171	3300032053	Sediment	RSIRAESWYFNQKAVTVQGGYGALFAVMVQFLLSAGAIAVQF
Ga0315551_101300721	3300032062	Salt Marsh Sediment	GGCVTRREHRPRPVNFSQKAVTVQGGYGALFAIRVQILLSITSVAVQV
Ga0315551_101378461	3300032062	Salt Marsh Sediment	PVFFSQEAVTVQGGYGALFAVRVQILLNIKSVAIQV
Ga0315277_104688351	3300032118	Sediment	RKHWVESWYFSQKAVTVQGGYGALFAVRVQILLNITRVAVQV
Ga0315295_100934411	3300032156	Sediment	GCVTRRSIRAGSWYFSQKTVTVQGGYGALFAVRVQILLSITRVAVQV
Ga0315295_104796401	3300032156	Sediment	RRKHRAGSWYFSQKVVTVQGGYGALFAVMVQILLRAGAIAVQF
Ga0315295_107513951	3300032156	Sediment	IRAESWYFSHKAVMVQGGYGALFAVMVQILFSITRVAVQV
Ga0315295_118653842	3300032156	Sediment	AESWYFSQKAVTVQGGYGALFAVMVQILLSITRVAVQG
Ga0315275_125074921	3300032401	Sediment	SIRAGSWYFSQKVVTVQGGYGVLFAVMVQILLSITRVAVQV
Ga0326726_100072334	3300033433	Peat Soil	VFFSQEAVTVQALPAGRQGGYGALFAVMVQILLSITRVAVQV
Ga0316626_102619832	3300033485	Soil	SQDAAAAVTRCSIWAGSRYFSNKAVTVQGGYGALFAVRVQILLSITRVAVQG
Ga0316626_107673941	3300033485	Soil	WYFSQKAVTVQGGYGVVFAVQVQSFVSITRVAVQV
Ga0299912_110957531	3300033489	Soil	WYFSQKAVTVQGGYGALFVVMVQILFRAGAIAVQV

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign