| Basic Information | |
|---|---|
| Family ID | F056198 |
| Family Type | Metagenome |
| Number of Sequences | 138 |
| Average Sequence Length | 39 residues |
| Representative Sequence | SWYFSQKAVTVQGGYGALFAVMVQILLSITRVAVQV |
| Number of Associated Samples | 94 |
| Number of Associated Scaffolds | 138 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 96.38 % |
| % of genes from short scaffolds (< 2000 bps) | 83.33 % |
| Associated GOLD sequencing projects | 85 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (63.768 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment (21.014 % of family members) |
| Environment Ontology (ENVO) | Unclassified (44.203 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (48.551 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.56% β-sheet: 0.00% Coil/Unstructured: 48.44% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 138 Family Scaffolds |
|---|---|---|
| PF14319 | Zn_Tnp_IS91 | 1.45 |
| PF00691 | OmpA | 1.45 |
| PF13683 | rve_3 | 1.45 |
| PF09603 | Fib_succ_major | 1.45 |
| PF00583 | Acetyltransf_1 | 1.45 |
| PF12675 | DUF3795 | 0.72 |
| PF13534 | Fer4_17 | 0.72 |
| PF13181 | TPR_8 | 0.72 |
| PF01965 | DJ-1_PfpI | 0.72 |
| PF14534 | DUF4440 | 0.72 |
| PF01252 | Peptidase_A8 | 0.72 |
| PF12873 | DUF3825 | 0.72 |
| PF02687 | FtsX | 0.72 |
| PF05569 | Peptidase_M56 | 0.72 |
| PF14289 | DUF4369 | 0.72 |
| PF13601 | HTH_34 | 0.72 |
| PF13308 | YARHG | 0.72 |
| PF00857 | Isochorismatase | 0.72 |
| PF10604 | Polyketide_cyc2 | 0.72 |
| PF00326 | Peptidase_S9 | 0.72 |
| PF13365 | Trypsin_2 | 0.72 |
| PF09685 | DUF4870 | 0.72 |
| PF13443 | HTH_26 | 0.72 |
| PF07045 | DUF1330 | 0.72 |
| PF09719 | C_GCAxxG_C_C | 0.72 |
| PF00201 | UDPGT | 0.72 |
| PF05016 | ParE_toxin | 0.72 |
| PF13600 | DUF4140 | 0.72 |
| PF01738 | DLH | 0.72 |
| PF14870 | PSII_BNR | 0.72 |
| PF05168 | HEPN | 0.72 |
| PF04229 | GrpB | 0.72 |
| PF15869 | TolB_like | 0.72 |
| PF09491 | RE_AlwI | 0.72 |
| PF14903 | WG_beta_rep | 0.72 |
| PF08388 | GIIM | 0.72 |
| PF03692 | CxxCxxCC | 0.72 |
| PF14300 | DUF4375 | 0.72 |
| PF01850 | PIN | 0.72 |
| PF00144 | Beta-lactamase | 0.72 |
| PF08867 | FRG | 0.72 |
| COG ID | Name | Functional Category | % Frequency in 138 Family Scaffolds |
|---|---|---|---|
| COG0597 | Lipoprotein signal peptidase | Cell wall/membrane/envelope biogenesis [M] | 1.45 |
| COG1819 | UDP:flavonoid glycosyltransferase YjiC, YdhE family | Carbohydrate transport and metabolism [G] | 1.45 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.72 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.72 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.72 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.72 |
| COG1895 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 0.72 |
| COG2250 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 0.72 |
| COG2320 | GrpB domain, predicted nucleotidyltransferase, UPF0157 family | General function prediction only [R] | 0.72 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.72 |
| COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.72 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 63.77 % |
| Unclassified | root | N/A | 36.23 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2140918023|ConsensusfromContig47809 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1172 | Open in IMG/M |
| 2140918024|NODE_348978_length_1773_cov_7.264524 | All Organisms → cellular organisms → Bacteria | 1823 | Open in IMG/M |
| 3300002498|TOLCLC_10064836 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Prevotellaceae → Prevotella | 4685 | Open in IMG/M |
| 3300002551|JGI24135J36437_1018783 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium RBG_19FT_COMBO_42_7 | 1210 | Open in IMG/M |
| 3300003432|JGI20214J51088_10049187 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae | 2932 | Open in IMG/M |
| 3300003432|JGI20214J51088_10470702 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300003432|JGI20214J51088_11181089 | Not Available | 503 | Open in IMG/M |
| 3300003541|JGI20214J51650_10052350 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division CPR1 → candidate division CPR1 bacterium ADurb.Bin160 | 2713 | Open in IMG/M |
| 3300003541|JGI20214J51650_10201959 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae | 1371 | Open in IMG/M |
| 3300004155|Ga0066600_10393417 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium | 655 | Open in IMG/M |
| 3300004242|Ga0066601_10124053 | Not Available | 946 | Open in IMG/M |
| 3300006224|Ga0079037_101171677 | Not Available | 764 | Open in IMG/M |
| 3300006224|Ga0079037_102063885 | Not Available | 570 | Open in IMG/M |
| 3300007909|Ga0111548_1026269 | Not Available | 1100 | Open in IMG/M |
| 3300009053|Ga0105095_10321750 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium | 851 | Open in IMG/M |
| 3300009053|Ga0105095_10487243 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium 14752 | 683 | Open in IMG/M |
| 3300009053|Ga0105095_10517124 | Not Available | 662 | Open in IMG/M |
| 3300009078|Ga0105106_10419812 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 964 | Open in IMG/M |
| 3300009081|Ga0105098_10248684 | Not Available | 838 | Open in IMG/M |
| 3300009087|Ga0105107_10254955 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1225 | Open in IMG/M |
| 3300009087|Ga0105107_10345845 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium | 1036 | Open in IMG/M |
| 3300009087|Ga0105107_10452086 | Not Available | 895 | Open in IMG/M |
| 3300009087|Ga0105107_10488275 | Not Available | 858 | Open in IMG/M |
| 3300009087|Ga0105107_10700053 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 705 | Open in IMG/M |
| 3300009087|Ga0105107_10780917 | All Organisms → cellular organisms → Bacteria → Elusimicrobia → unclassified Elusimicrobiota → Elusimicrobia bacterium CG11_big_fil_rev_8_21_14_0_20_64_6 | 664 | Open in IMG/M |
| 3300009091|Ga0102851_10880268 | Not Available | 965 | Open in IMG/M |
| 3300009091|Ga0102851_11791816 | Not Available | 691 | Open in IMG/M |
| 3300009111|Ga0115026_10647660 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae | 808 | Open in IMG/M |
| 3300009167|Ga0113563_13654863 | Not Available | 521 | Open in IMG/M |
| 3300009179|Ga0115028_11872594 | Not Available | 524 | Open in IMG/M |
| 3300009676|Ga0116187_1311085 | Not Available | 704 | Open in IMG/M |
| 3300009692|Ga0116171_10055161 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2554 | Open in IMG/M |
| 3300009694|Ga0116170_10281970 | Not Available | 944 | Open in IMG/M |
| 3300009771|Ga0116155_10048516 | Not Available | 2056 | Open in IMG/M |
| 3300009838|Ga0116153_10168188 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300010293|Ga0116204_1136013 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
| 3300010346|Ga0116239_10592362 | Not Available | 721 | Open in IMG/M |
| 3300010429|Ga0116241_10137313 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2072 | Open in IMG/M |
| 3300010429|Ga0116241_10440258 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium | 1025 | Open in IMG/M |
| 3300012964|Ga0153916_10447664 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1357 | Open in IMG/M |
| (restricted) 3300013128|Ga0172366_10449793 | Not Available | 778 | Open in IMG/M |
| (restricted) 3300013128|Ga0172366_10912742 | Not Available | 507 | Open in IMG/M |
| (restricted) 3300013129|Ga0172364_10295040 | Not Available | 1062 | Open in IMG/M |
| (restricted) 3300013129|Ga0172364_10340387 | Not Available | 973 | Open in IMG/M |
| (restricted) 3300013130|Ga0172363_10106071 | All Organisms → cellular organisms → Bacteria | 1969 | Open in IMG/M |
| (restricted) 3300013133|Ga0172362_10300495 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1137 | Open in IMG/M |
| (restricted) 3300013133|Ga0172362_11161242 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium | 506 | Open in IMG/M |
| 3300014300|Ga0075321_1001953 | All Organisms → cellular organisms → Bacteria | 2627 | Open in IMG/M |
| 3300014300|Ga0075321_1043242 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 778 | Open in IMG/M |
| 3300014314|Ga0075316_1046286 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 934 | Open in IMG/M |
| 3300018070|Ga0184631_10129938 | Not Available | 1003 | Open in IMG/M |
| 3300023207|Ga0255811_10460029 | Not Available | 895 | Open in IMG/M |
| 3300024262|Ga0210003_1155899 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
| 3300025499|Ga0207931_1014496 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium RBG_19FT_COMBO_42_7 | 1860 | Open in IMG/M |
| 3300025499|Ga0207931_1088279 | Not Available | 579 | Open in IMG/M |
| 3300025716|Ga0209746_1055923 | All Organisms → cellular organisms → Bacteria | 1317 | Open in IMG/M |
| 3300025740|Ga0208940_1278614 | Not Available | 509 | Open in IMG/M |
| 3300025864|Ga0209429_10056514 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium RBG_19FT_COMBO_42_7 | 1811 | Open in IMG/M |
| 3300025865|Ga0209226_10034672 | Not Available | 2274 | Open in IMG/M |
| 3300026066|Ga0208290_1035950 | Not Available | 552 | Open in IMG/M |
| 3300027731|Ga0209592_1063737 | Not Available | 1369 | Open in IMG/M |
| 3300027739|Ga0209575_10098196 | Not Available | 1067 | Open in IMG/M |
| 3300027792|Ga0209287_10134632 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium RBG_13_43_22 | 933 | Open in IMG/M |
| 3300027818|Ga0209706_10140782 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1189 | Open in IMG/M |
| 3300027818|Ga0209706_10244306 | Not Available | 861 | Open in IMG/M |
| 3300027841|Ga0209262_10623423 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae → Chryseobacterium group → Kaistella → Kaistella daneshvariae | 523 | Open in IMG/M |
| 3300031255|Ga0315554_1108479 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium | 1013 | Open in IMG/M |
| 3300031257|Ga0315555_1152402 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 981 | Open in IMG/M |
| 3300031275|Ga0307437_1034858 | Not Available | 1830 | Open in IMG/M |
| 3300031278|Ga0307431_1019913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 2339 | Open in IMG/M |
| 3300031280|Ga0307428_1078455 | Not Available | 904 | Open in IMG/M |
| 3300031337|Ga0307430_1114184 | Not Available | 728 | Open in IMG/M |
| 3300031337|Ga0307430_1120583 | Not Available | 697 | Open in IMG/M |
| 3300031355|Ga0307421_1083984 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium | 1056 | Open in IMG/M |
| 3300031355|Ga0307421_1118846 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 838 | Open in IMG/M |
| 3300031356|Ga0307439_1114604 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae | 774 | Open in IMG/M |
| 3300031357|Ga0307435_1119789 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300031358|Ga0307438_1069943 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
| 3300031358|Ga0307438_1088255 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → Candidatus Woesebacteria → Candidatus Woesebacteria bacterium RBG_13_36_22 | 920 | Open in IMG/M |
| 3300031364|Ga0307445_10158030 | Not Available | 817 | Open in IMG/M |
| 3300031365|Ga0307443_1062579 | All Organisms → cellular organisms → Bacteria | 1135 | Open in IMG/M |
| 3300031369|Ga0307422_1037107 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1747 | Open in IMG/M |
| 3300031369|Ga0307422_1072648 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1093 | Open in IMG/M |
| 3300031369|Ga0307422_1135924 | Not Available | 700 | Open in IMG/M |
| 3300031369|Ga0307422_1146161 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 665 | Open in IMG/M |
| 3300031379|Ga0307434_1152712 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia | 631 | Open in IMG/M |
| 3300031537|Ga0307419_10349766 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium | 520 | Open in IMG/M |
| 3300031539|Ga0307380_11092808 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300031539|Ga0307380_11487234 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → Candidatus Woesebacteria → Candidatus Woesebacteria bacterium RBG_13_36_22 | 505 | Open in IMG/M |
| 3300031551|Ga0315548_1097666 | Not Available | 1158 | Open in IMG/M |
| 3300031553|Ga0315547_1030175 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2243 | Open in IMG/M |
| 3300031553|Ga0315547_1162051 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → Fluviicola → Fluviicola taffensis → Fluviicola taffensis DSM 16823 | 721 | Open in IMG/M |
| 3300031554|Ga0315544_1218446 | Not Available | 504 | Open in IMG/M |
| 3300031565|Ga0307379_11089556 | Not Available | 672 | Open in IMG/M |
| 3300031565|Ga0307379_11196724 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium | 630 | Open in IMG/M |
| 3300031575|Ga0315532_1024502 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia | 2650 | Open in IMG/M |
| 3300031575|Ga0315532_1132617 | Not Available | 746 | Open in IMG/M |
| 3300031578|Ga0307376_10236001 | All Organisms → cellular organisms → Bacteria | 1237 | Open in IMG/M |
| 3300031586|Ga0315541_1217579 | Not Available | 513 | Open in IMG/M |
| 3300031620|Ga0315552_1019456 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 3158 | Open in IMG/M |
| 3300031620|Ga0315552_1021461 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium | 2966 | Open in IMG/M |
| 3300031620|Ga0315552_1062236 | Not Available | 1435 | Open in IMG/M |
| 3300031620|Ga0315552_1116479 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Salinimicrobium → Salinimicrobium marinum | 907 | Open in IMG/M |
| 3300031620|Ga0315552_1140556 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 786 | Open in IMG/M |
| 3300031620|Ga0315552_1169569 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae | 680 | Open in IMG/M |
| 3300031624|Ga0315545_1018554 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 4546 | Open in IMG/M |
| 3300031650|Ga0315539_1122545 | Not Available | 863 | Open in IMG/M |
| 3300031652|Ga0315553_10437275 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → Candidatus Woesebacteria → Candidatus Woesebacteria bacterium RBG_13_36_22 | 511 | Open in IMG/M |
| 3300031653|Ga0315550_1085969 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1368 | Open in IMG/M |
| 3300031654|Ga0315549_1017593 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 4753 | Open in IMG/M |
| 3300031654|Ga0315549_1041707 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2624 | Open in IMG/M |
| 3300031654|Ga0315549_1110528 | Not Available | 1254 | Open in IMG/M |
| 3300031654|Ga0315549_1134608 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium | 1073 | Open in IMG/M |
| 3300031654|Ga0315549_1179055 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium | 855 | Open in IMG/M |
| 3300031698|Ga0315537_1156095 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Salinimicrobium → Salinimicrobium marinum | 1030 | Open in IMG/M |
| 3300031699|Ga0315535_1195616 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 712 | Open in IMG/M |
| 3300031707|Ga0315291_10142436 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 2519 | Open in IMG/M |
| 3300031772|Ga0315288_11725409 | Not Available | 503 | Open in IMG/M |
| 3300031864|Ga0315538_1060095 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium | 991 | Open in IMG/M |
| 3300031885|Ga0315285_10639737 | All Organisms → cellular organisms → Bacteria → FCB group | 697 | Open in IMG/M |
| 3300031949|Ga0214473_10276346 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1924 | Open in IMG/M |
| 3300032053|Ga0315284_10688117 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Limnovirga → Limnovirga soli | 1203 | Open in IMG/M |
| 3300032062|Ga0315551_10130072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae | 1112 | Open in IMG/M |
| 3300032062|Ga0315551_10137846 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium RBG_13_43_22 | 1066 | Open in IMG/M |
| 3300032118|Ga0315277_10468835 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium | 1272 | Open in IMG/M |
| 3300032156|Ga0315295_10093441 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → Candidatus Woesebacteria → Candidatus Woesebacteria bacterium RBG_13_36_22 | 2918 | Open in IMG/M |
| 3300032156|Ga0315295_10479640 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1264 | Open in IMG/M |
| 3300032156|Ga0315295_10751395 | Not Available | 981 | Open in IMG/M |
| 3300032156|Ga0315295_11865384 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium | 568 | Open in IMG/M |
| 3300032401|Ga0315275_12507492 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium | 533 | Open in IMG/M |
| 3300033433|Ga0326726_10007233 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 9923 | Open in IMG/M |
| 3300033485|Ga0316626_10261983 | All Organisms → cellular organisms → Bacteria | 1391 | Open in IMG/M |
| 3300033485|Ga0316626_10767394 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium | 844 | Open in IMG/M |
| 3300033489|Ga0299912_11095753 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 587 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Salt Marsh Sediment | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment | 21.01% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 13.77% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 12.32% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 11.59% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 6.52% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 5.07% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 3.62% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 3.62% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 3.62% |
| Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 2.90% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 2.90% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 1.45% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 1.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.45% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.45% |
| Anoxic Lake Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Lake Water | 0.72% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.72% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.72% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.72% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.72% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.72% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 0.72% |
| Anaerobic Digester Digestate | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Digester Digestate | 0.72% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2140918023 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog Site B3 | Environmental | Open in IMG/M |
| 2140918024 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog_all | Environmental | Open in IMG/M |
| 3300002498 | Hydrocarbon resource environments microbial communities from Canada and USA - Toluene degrading community from Alberta, Canada | Engineered | Open in IMG/M |
| 3300002551 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0011-211 | Environmental | Open in IMG/M |
| 3300003432 | Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk | Environmental | Open in IMG/M |
| 3300003541 | Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk | Environmental | Open in IMG/M |
| 3300004155 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11 | Environmental | Open in IMG/M |
| 3300004242 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Medium cellulose week 11 | Environmental | Open in IMG/M |
| 3300005219 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailB_D2 | Environmental | Open in IMG/M |
| 3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300007909 | Microbial communities from sediment of the River Tyne Estuary, UK ? Pasteurized_686d_2 | Environmental | Open in IMG/M |
| 3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009087 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
| 3300009676 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA6_MetaG | Engineered | Open in IMG/M |
| 3300009692 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW2_MetaG | Engineered | Open in IMG/M |
| 3300009694 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW1_MetaG | Engineered | Open in IMG/M |
| 3300009771 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC032_MetaG | Engineered | Open in IMG/M |
| 3300009838 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC028_MetaG | Engineered | Open in IMG/M |
| 3300010293 | Anoxic lake water microbial communities from Lake Kivu, Rwanda to study Microbial Dark Matter (Phase II) - Lake Kivu water 52m metaG | Environmental | Open in IMG/M |
| 3300010346 | AD_USMOca | Engineered | Open in IMG/M |
| 3300010429 | AD_USRAca | Engineered | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300013128 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 69cm | Environmental | Open in IMG/M |
| 3300013129 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 10cm | Environmental | Open in IMG/M |
| 3300013130 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment s2_kivu2a2 | Environmental | Open in IMG/M |
| 3300013133 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment s1_kivu2a2 | Environmental | Open in IMG/M |
| 3300014300 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D1 | Environmental | Open in IMG/M |
| 3300014314 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleA_D2 | Environmental | Open in IMG/M |
| 3300018070 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b1 | Environmental | Open in IMG/M |
| 3300023207 | Combined Assembly of Gp0238866, Gp0238878, Gp0238879 | Engineered | Open in IMG/M |
| 3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025499 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025716 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0011-211 (SPAdes) | Environmental | Open in IMG/M |
| 3300025740 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA6_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025836 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 004-21A (SPAdes) | Environmental | Open in IMG/M |
| 3300025864 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-212 (SPAdes) | Environmental | Open in IMG/M |
| 3300025865 | Arctic peat soil from Barrow, Alaska, USA - Barrow Graham LP Ref core NGADG0011-212 (SPAdes) | Environmental | Open in IMG/M |
| 3300026066 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027713 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027731 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027739 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Medium cellulose week 11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027792 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027818 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027841 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11 (SPAdes) | Environmental | Open in IMG/M |
| 3300031255 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1603-70 | Environmental | Open in IMG/M |
| 3300031257 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1603-80 | Environmental | Open in IMG/M |
| 3300031275 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-90 | Environmental | Open in IMG/M |
| 3300031278 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-170 | Environmental | Open in IMG/M |
| 3300031280 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-240 | Environmental | Open in IMG/M |
| 3300031337 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-130 | Environmental | Open in IMG/M |
| 3300031355 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1602-70 | Environmental | Open in IMG/M |
| 3300031356 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1604-90 | Environmental | Open in IMG/M |
| 3300031357 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1604-70 | Environmental | Open in IMG/M |
| 3300031358 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-110 | Environmental | Open in IMG/M |
| 3300031364 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - SW1603-30 | Environmental | Open in IMG/M |
| 3300031365 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - SW1601-220 | Environmental | Open in IMG/M |
| 3300031369 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1602-90 | Environmental | Open in IMG/M |
| 3300031379 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-220 | Environmental | Open in IMG/M |
| 3300031537 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1602-30 | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031551 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-110 | Environmental | Open in IMG/M |
| 3300031553 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-240 | Environmental | Open in IMG/M |
| 3300031554 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-130 | Environmental | Open in IMG/M |
| 3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
| 3300031575 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment WE1603-70 | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300031586 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-190 | Environmental | Open in IMG/M |
| 3300031620 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-70 | Environmental | Open in IMG/M |
| 3300031624 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1602-10 | Environmental | Open in IMG/M |
| 3300031650 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-150 | Environmental | Open in IMG/M |
| 3300031652 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-40 | Environmental | Open in IMG/M |
| 3300031653 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-90 | Environmental | Open in IMG/M |
| 3300031654 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-200 | Environmental | Open in IMG/M |
| 3300031698 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1602-70 | Environmental | Open in IMG/M |
| 3300031699 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1602-20 | Environmental | Open in IMG/M |
| 3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031864 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-230 | Environmental | Open in IMG/M |
| 3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032062 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1602-90 | Environmental | Open in IMG/M |
| 3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
| 3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
| 3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033485 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_A | Environmental | Open in IMG/M |
| 3300033489 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B3_GZBA_C_00699790 | 2140918023 | Soil | SWYFSQKVVTVQGGYGALFAVMVQILLSITSVAVQV |
| B_all_v_02439850 | 2140918024 | Soil | SCFFSREMVTVQGGYGVLFAIMVQIFLGFGAIAVQGF |
| TOLCLC_100648366 | 3300002498 | Hydrocarbon Resource Environments | SNLTVKLGIFFSQKAVTVQGGYGALFAVRVQILLSITRVAVQV* |
| JGI24135J36437_10187831 | 3300002551 | Arctic Peat Soil | GGCVTRREHRAGSWYFSQKTVTVQGGYGALFAVMVQILLSAGAIAVQF* |
| JGI20214J51088_100491874 | 3300003432 | Wetland | RKHRAGSWYFSQKAVTVQGGYGALFAVMVQILLSAGAIAVQF* |
| JGI20214J51088_104707022 | 3300003432 | Wetland | KHRAGSWYFSWKTVTVQGGYGVVFAIRVQVLIEDTCVAVQI* |
| JGI20214J51088_111810891 | 3300003432 | Wetland | VTRRKHRAGSWYFSRQIITVQGGYGALFAVMAQILLSITRVAVQG* |
| JGI20214J51650_100523501 | 3300003541 | Wetland | GGCVTRRKHRAGSWYFSQKAVTVQGGYGALFAVRVQILLSFTRVAVQV* |
| JGI20214J51650_102019593 | 3300003541 | Wetland | GGCVTRRKHRAGSWYFSQKAVTVQGGYGALFAVMVQILLSAGAIAVQF* |
| Ga0066600_103934172 | 3300004155 | Freshwater | HRAESWYFSREVVTVQGGYGVLFAVRIQVLLSITRVAVQG* |
| Ga0066601_101240531 | 3300004242 | Freshwater | IRAGSWYFSQKFVTVQGGYGAVFAVMAQILIRSGVIAVQV* |
| Ga0069004_103079671 | 3300005219 | Natural And Restored Wetlands | PGTRQLAGQKAVTVQGGYGVVFAVWVQTLFNITSVAEQV* |
| Ga0079037_1011716772 | 3300006224 | Freshwater Wetlands | FSQKAVTVQGGYGVVFAIQVQVLIEDTRVAVQI** |
| Ga0079037_1020638852 | 3300006224 | Freshwater Wetlands | YFSHKAVTVQGGYGALFAVMVQILLSITRVAVQV* |
| Ga0111548_10262693 | 3300007909 | Sediment | RLHRAGSWYFSQKAVTVQGGYGALFAIMVQILLCAGAIAVQF* |
| Ga0105095_103217502 | 3300009053 | Freshwater Sediment | YFSQKAVTVQGGYGALFAVRVQVLLSITRVAVQG* |
| Ga0105095_104872431 | 3300009053 | Freshwater Sediment | AGSWYFSHKTVTVQGGYGALFAVRVQILLNITRVAAQV* |
| Ga0105095_105171241 | 3300009053 | Freshwater Sediment | SRYFSQKAVTVQGGYGALFAVRVQILLSITRVAVQV* |
| Ga0105106_104198122 | 3300009078 | Freshwater Sediment | GSWYFSQKAVTVQGGYGALFAVMVQILLSITRVAVQV* |
| Ga0105098_102486841 | 3300009081 | Freshwater Sediment | GSSFFSQKTVTVQGGYGVVFAIRVQVMIEDTSVAVQV* |
| Ga0105107_102549551 | 3300009087 | Freshwater Sediment | SWYFSQKAVTVQGGYGALFAVMVQILLSITRVAVQV* |
| Ga0105107_103458451 | 3300009087 | Freshwater Sediment | HRAESWYFSQKAVTVQGGYGALFAVRVQILLNITRVAVQV* |
| Ga0105107_104520862 | 3300009087 | Freshwater Sediment | YFSQKAVTVQGGYGALFAVRVQIVLSITRVAVQS* |
| Ga0105107_104882752 | 3300009087 | Freshwater Sediment | FFSQKAVTVQGGYGALFAVMVQILLSITRVAVQV* |
| Ga0105107_107000532 | 3300009087 | Freshwater Sediment | WYFSHKIVTVQGGYGALFAVMVQILLSITRVAVQV* |
| Ga0105107_107809171 | 3300009087 | Freshwater Sediment | GIRQKAVTVQGGYGALFAVRVQILLSITRVAVQV* |
| Ga0102851_108802681 | 3300009091 | Freshwater Wetlands | GSWYFSQKAVTVQGGYGALFAVQVQILLSITRVAVQV* |
| Ga0102851_117918161 | 3300009091 | Freshwater Wetlands | VSWYFSHEAVTAQGGYGVLFVVMVQILLSITRVAVQV |
| Ga0115026_106476601 | 3300009111 | Wetland | YFSQKAVTVQGGYGALFAVRVQVLLSITRVAVQV* |
| Ga0113563_136548632 | 3300009167 | Freshwater Wetlands | VFFSHIAVTVQGKYGALFAVRVQILLSISRVAGQV* |
| Ga0115028_118725941 | 3300009179 | Wetland | YFSQKTVTVQGGYGALFAVRVQILLSITRVAVQV* |
| Ga0116187_13110851 | 3300009676 | Anaerobic Digestor Sludge | SWYFSQKAVTVQGGFGAVFGIQVQILIEAGRVAVQS* |
| Ga0116171_100551611 | 3300009692 | Anaerobic Digestor Sludge | RQRGQKAVTVQGGFGAVFGIQVQIFVRTTRVAVQV* |
| Ga0116170_102819701 | 3300009694 | Anaerobic Digestor Sludge | WGGCVTRRRIRAGSRYFSQQAVTVQGGYGAVFAVRVQVLLSITRVAVQV* |
| Ga0116155_100485164 | 3300009771 | Anaerobic Digestor Sludge | VPVGQKAVPVQGGFGVVFGIQVQMFVSITRVAVQG* |
| Ga0116153_101681883 | 3300009838 | Anaerobic Digestor Sludge | SRYFSQKAVTVQGGYGALFAIRVQVLMSITRVAVQS* |
| Ga0116204_11360132 | 3300010293 | Anoxic Lake Water | GSCFFSQKAVTVQGGYGVVFAVIVQSLTEAGRVAVQF* |
| Ga0116239_105923622 | 3300010346 | Anaerobic Digestor Sludge | DAASGHLSRYFSQKTVTVQGGYGALFAVMVQILLSITRVAVQV* |
| Ga0116241_101373131 | 3300010429 | Anaerobic Digestor Sludge | SSYFSQKAVTVQGGYGALFAVTVQILLSITRVAVQV* |
| Ga0116241_104402582 | 3300010429 | Anaerobic Digestor Sludge | KHRAESWYFSREAVTVQGGYGVVFAIRVQVLIKDTRVAVQS* |
| Ga0153916_104476642 | 3300012964 | Freshwater Wetlands | AGSWFFSREAVTVQGGYGAVFAIMIQILLSAGAIAVQV* |
| Ga0153916_116465081 | 3300012964 | Freshwater Wetlands | YPTQHRAESCFFSREVVTVQGGYGVLFADMVQISLSAGAIAVQV* |
| (restricted) Ga0172366_104497932 | 3300013128 | Sediment | YFSQNAVTVQGGYGALFAVMAQIFLSITRVAVQV* |
| (restricted) Ga0172366_109127422 | 3300013128 | Sediment | KVPAGQKAVTVQGGYGALFAVQVQSFVSITSVVVQG* |
| (restricted) Ga0172364_102950402 | 3300013129 | Sediment | WYFSQKAVTVQGGFGAVFGIQVQILIEAGRVAVQI* |
| (restricted) Ga0172364_103403872 | 3300013129 | Sediment | RAESWYFSRETVTVQGGYGALFAVQVQSFVSITRVAVQV* |
| (restricted) Ga0172363_101060711 | 3300013130 | Sediment | WGGCVTRRSIRAESWYFSHQVVPVQGGYGALFAVMVQILLRTGAVAIQV* |
| (restricted) Ga0172362_103004951 | 3300013133 | Sediment | QRGQKTVTVQGGYGALFAVRVQILLSITRVAVQVL* |
| (restricted) Ga0172362_111612421 | 3300013133 | Sediment | ESWYFSREAVTVQGGYGVVFAVMVQVLLSASAIAVHV* |
| Ga0075321_10019531 | 3300014300 | Natural And Restored Wetlands | QRGQKFVTVQGGYGALFAVMVQILLSITRVAIQG* |
| Ga0075321_10432422 | 3300014300 | Natural And Restored Wetlands | WYFSRETVTVQGGYGVLFAIMVQILLRTGAIAVQV* |
| Ga0075316_10462861 | 3300014314 | Natural And Restored Wetlands | RAGSWYFSHKAVTVQGGYGAFFAVMVQILMSITRVAVQG* |
| Ga0184631_101299382 | 3300018070 | Groundwater Sediment | SWYFSQKAVTVQGGYGALFAVMVQILLSAGAIAVQV |
| Ga0255811_104600291 | 3300023207 | Anaerobic Digester Digestate | SVPVGQKAVTVQGGFGAVFGIQVQILLSITCVAVQG |
| Ga0210003_11558991 | 3300024262 | Deep Subsurface | VFFSQKAVTVQGGYGALFAVRVQIFVSITSVAVQV |
| Ga0207931_10144962 | 3300025499 | Arctic Peat Soil | GSWYFSQKTVTVQGGYGALFAVMVQILLSAGAIAVQF |
| Ga0207931_10882791 | 3300025499 | Arctic Peat Soil | VTLFFSRSAITVQGGYGALFAVMVQVLLSITSVAVQV |
| Ga0209746_10559231 | 3300025716 | Arctic Peat Soil | YFSQKAVTVQGGYGALFAVMVQILLSSCAIAVQGF |
| Ga0208940_12786141 | 3300025740 | Anaerobic Digestor Sludge | SWYFSQKAVTVQGGFGAVFGIQVQILIEAGRVAVQS |
| Ga0209748_11033632 | 3300025836 | Arctic Peat Soil | SRRRIRARSRYFSQKFIPVQGGYGVLFAIMAQILLGAGAIAVQF |
| Ga0209429_100565143 | 3300025864 | Arctic Peat Soil | REHRAGSWYFSQKTVTVQGGYGALFAVMVQILLSAGAIAVQF |
| Ga0209226_100346724 | 3300025865 | Arctic Peat Soil | KHRAGSWYFSQKTVTVQGGYGALFAVMVQILLSITRVAVQV |
| Ga0208290_10359501 | 3300026066 | Natural And Restored Wetlands | PGRSWYFRQKIVTVQGGYGVLFAVMAGIILRTGAVAVQ |
| Ga0209286_11950871 | 3300027713 | Freshwater Sediment | LQGWHVTRRSIRAGFWYFSHKAVTVQGGYGALFAVMAKILLSI |
| Ga0209592_10637371 | 3300027731 | Freshwater Sediment | RRSIRAGSWYFSHKTVTVQGGYGALFAVRVQILLSITRVAVQGLSEP |
| Ga0209575_100981962 | 3300027739 | Freshwater | WGGCVTRRSIRSGSRYFSQKAVTVQGGYGALFAVRVQVLLSITRVAVQV |
| Ga0209287_101346321 | 3300027792 | Freshwater Sediment | REHRAGSWYFSREAVPVQGGYGALFAVMVQIMLNITRVAVQV |
| Ga0209706_101407821 | 3300027818 | Freshwater Sediment | SWYFSQKAVTVQGGYGALFAVMVQILLSITRVAVQV |
| Ga0209706_102443061 | 3300027818 | Freshwater Sediment | WYFSQKSVTVQGGYGALFAVRVQILLSITRVAVQS |
| Ga0209262_106234231 | 3300027841 | Freshwater | RVTRRKHRAESWYISQKAVTVQGGYGALFVVMVQILLSACAIAVQV |
| Ga0315554_11084792 | 3300031255 | Salt Marsh Sediment | RAVSWYFSREIVTVQGGYGALFAVMVQILLSITRVAVQG |
| Ga0315555_11524021 | 3300031257 | Salt Marsh Sediment | RRKHRAGSWYFSHIAVTVQGGYGALFAVRIQVLFSITRVAVQV |
| Ga0307437_10348581 | 3300031275 | Salt Marsh | IRAESWYFSPKAVTVQGGYGALFAVMVQILLSITRVAVQG |
| Ga0307431_10199131 | 3300031278 | Salt Marsh | TRRKHRAESWYFSQKAVTVQGGYGALFAVQVQILLSITRVAVQV |
| Ga0307428_10784551 | 3300031280 | Salt Marsh | RRSIRAESWYFSQKAVTVQGGYGALFAVMVQILLSITCVAVQV |
| Ga0307430_11141842 | 3300031337 | Salt Marsh | VTRRSIRAESWYFSQKAVTVQGGYGALFAVMVQVLLRAGTIAVQV |
| Ga0307430_11205831 | 3300031337 | Salt Marsh | MYFSHETVTVQGGYGALFAVRVQSFVSITRVAVQV |
| Ga0307421_10839842 | 3300031355 | Salt Marsh | SIRAESWFFSREAVTVQGGYGALFAVQVQVLLSITCVAVQG |
| Ga0307421_11188462 | 3300031355 | Salt Marsh | KHRAASWYFSQKTVTVQGGYGALFAVMVQILLSITRVAVQV |
| Ga0307439_11146042 | 3300031356 | Salt Marsh | IRVVSWYFSREAVTVQGGYGVLFAVMGQIVLSITRVAVQF |
| Ga0307435_11197891 | 3300031357 | Salt Marsh | RAESWYFSQKAVTVQGGYGALFAVQVQILLSITRVAVQV |
| Ga0307438_10699432 | 3300031358 | Salt Marsh | RPVNFSQKAVTVQGGYGALFAVMVQLLLSITSVAVQV |
| Ga0307438_10882551 | 3300031358 | Salt Marsh | PSTRGQKAVTVQGVYGALFAVMVQILLSTGEIALQV |
| Ga0307445_101580302 | 3300031364 | Salt Marsh | AGSWYFSQKAVTVQGGYGALFAVMVQILLSITSVEVQV |
| Ga0307443_10625791 | 3300031365 | Salt Marsh | RAESWHFSREVVTVQGGYGALFAVRVQILLSITSVAVQV |
| Ga0307422_10371074 | 3300031369 | Salt Marsh | WGGCVTRRKHRAESRFFSREAVTVQGGYGALFAVMVQILLSITRVAVQV |
| Ga0307422_10726481 | 3300031369 | Salt Marsh | AVSWYFSREIVTVQGGYGALFAVMVQILLSITRVAVQG |
| Ga0307422_11359241 | 3300031369 | Salt Marsh | ASRYFRQITVPVQARYGVLFAVMVQILLRAGAVAVQV |
| Ga0307422_11461612 | 3300031369 | Salt Marsh | GCVTRRKHRAGSWYFSREFVTVQGGYGALFAVQVQSFVSITRVAVQV |
| Ga0307434_11527122 | 3300031379 | Salt Marsh | AVSINFSQDTIPVQGRYGSLFAVMVQILLCSGVIALQV |
| Ga0307419_103497661 | 3300031537 | Salt Marsh | RRKHRVGSWYFSQKAVTVQGGYGALFAVMVQSWLSITRVAVQI |
| Ga0307380_110928081 | 3300031539 | Soil | WYFRREIVTVQGGYGAFFAVQVEGLLGYTSVVVQG |
| Ga0307380_114872341 | 3300031539 | Soil | RAGSWYFSQKAVTVQGGYGAVFAVMVQILLSITRVAVQV |
| Ga0315548_10976661 | 3300031551 | Salt Marsh Sediment | KHRPRPMFFSQKAVTVQGGYGALFAVQVQILLSITRVAVQV |
| Ga0315547_10301751 | 3300031553 | Salt Marsh Sediment | ESWHFSREVVTVQGGYGALFAVRVQILLSITSVAVQV |
| Ga0315547_11620511 | 3300031553 | Salt Marsh Sediment | GGCVTRRSIRAESWYFSQKAVTVQGGYGALFAVQVQSLLSITSVAVQG |
| Ga0315544_12184462 | 3300031554 | Salt Marsh Sediment | TPSTRGHKAVTVQGGYGALFAVRVQILLSITRVAIQV |
| Ga0307379_110895562 | 3300031565 | Soil | WYFSREAVTVQGGYGALFAVQVQSFVNITRVAVQV |
| Ga0307379_111967241 | 3300031565 | Soil | GSWYFSQKAVTVQGGYGALFAVRVQILLSITRVAVQG |
| Ga0315532_10245021 | 3300031575 | Salt Marsh Sediment | SWYFSRETVTVQGGYGALFAVQVQILLSITRVAVQV |
| Ga0315532_11326171 | 3300031575 | Salt Marsh Sediment | PSTRGQKAVTVQGGYGALFAVRVQSWLSITRVAVQV |
| Ga0307376_102360011 | 3300031578 | Soil | AGTWCFSQKTVTVQGGYGALFAVMVQILLLAGAIAVQV |
| Ga0315541_12175791 | 3300031586 | Salt Marsh Sediment | CVTRRKHLVRPVNFSQKTVTVQGGYGALFAVMVQILLSITRVAVQV |
| Ga0315552_10194565 | 3300031620 | Salt Marsh Sediment | REHRPRPVNFSEKTVTVQGGYGALFAVMVQIILSITRVAVQV |
| Ga0315552_10214611 | 3300031620 | Salt Marsh Sediment | HRAESWYFSQKAVTVQGGYGALFAVQVQILLSITRVAVQV |
| Ga0315552_10622361 | 3300031620 | Salt Marsh Sediment | RPLSLIFSQKTVTVQGGYGALFAVRVKILLSITSVAVQG |
| Ga0315552_11164792 | 3300031620 | Salt Marsh Sediment | RPRPVFFSHKAVTVQGGYGALFAVMVQILLNITRVAVQG |
| Ga0315552_11405561 | 3300031620 | Salt Marsh Sediment | RAVSMFFSQEAVTVQGGYGALFAVQVQILLNITRVAVQS |
| Ga0315552_11695691 | 3300031620 | Salt Marsh Sediment | GCVTRRSIRVVSWYFSREAVTVQGGYGVLFAVMGQIVLSITRVAVQF |
| Ga0315545_10185541 | 3300031624 | Salt Marsh Sediment | VTRRSIRAESWYFSQKAVTVQGGYGALFAVMVQILLSITCVAVQV |
| Ga0315539_11225452 | 3300031650 | Salt Marsh Sediment | PSTRGQKAVTVQGGYGALFAVMVQILLSITHVAVQF |
| Ga0315553_104372751 | 3300031652 | Salt Marsh Sediment | SIRAESWYFSREIVTVQGGYGALFAVRVQILLSITRVAVQV |
| Ga0315550_10859691 | 3300031653 | Salt Marsh Sediment | SWYFSQKAVTVQGGYGALFAIRVQILLSITRVAVQV |
| Ga0315549_10175936 | 3300031654 | Salt Marsh Sediment | STRGQKAVTVQGGYGALFAVMVQILLSITRVAVQV |
| Ga0315549_10417071 | 3300031654 | Salt Marsh Sediment | SRFFSREVVTVQGGYGALFAVMVQSFVSITRVAVQV |
| Ga0315549_11105281 | 3300031654 | Salt Marsh Sediment | VESWYFSQKVVTVQGGYGALFAVMVQILLSITSVAVQV |
| Ga0315549_11346081 | 3300031654 | Salt Marsh Sediment | SWYFSQKTVTVQGGYGALFAVMAGIILSIMCIAVQG |
| Ga0315549_11790552 | 3300031654 | Salt Marsh Sediment | IRVESWYFSRETVKVQGGYGALFAVMVQILLSITRVAVQV |
| Ga0315537_11560952 | 3300031698 | Salt Marsh Sediment | RREHRPRPVFFSHKAVTVQGGYGALFAVMVQILLNITRVAVQG |
| Ga0315535_11956161 | 3300031699 | Salt Marsh Sediment | IRQLSWYFSRKTVPVQGGYGVLFAVMVQILLRSGVVAVQV |
| Ga0315291_101424361 | 3300031707 | Sediment | AESRYFSRETVTVQGGYGALFAVRVQILLSITRVAVQV |
| Ga0315288_117254091 | 3300031772 | Sediment | SRYFSREAVTVQGGYGALFAVMVQFLLSITRVAVQG |
| Ga0315538_10600951 | 3300031864 | Salt Marsh Sediment | IRAESWFFSREAVTVQGGYGALFAVQVQVLLSITCVAVQG |
| Ga0315285_106397372 | 3300031885 | Sediment | RSIRAESWYFSQKAVTVQGGYGALFAVMVQILLSITRVAVQV |
| Ga0214473_102763461 | 3300031949 | Soil | GSWYFSQKAVTVQGGYGALFAVMVQILLSAGAIAVQF |
| Ga0315284_106881171 | 3300032053 | Sediment | RSIRAESWYFNQKAVTVQGGYGALFAVMVQFLLSAGAIAVQF |
| Ga0315551_101300721 | 3300032062 | Salt Marsh Sediment | GGCVTRREHRPRPVNFSQKAVTVQGGYGALFAIRVQILLSITSVAVQV |
| Ga0315551_101378461 | 3300032062 | Salt Marsh Sediment | PVFFSQEAVTVQGGYGALFAVRVQILLNIKSVAIQV |
| Ga0315277_104688351 | 3300032118 | Sediment | RKHWVESWYFSQKAVTVQGGYGALFAVRVQILLNITRVAVQV |
| Ga0315295_100934411 | 3300032156 | Sediment | GCVTRRSIRAGSWYFSQKTVTVQGGYGALFAVRVQILLSITRVAVQV |
| Ga0315295_104796401 | 3300032156 | Sediment | RRKHRAGSWYFSQKVVTVQGGYGALFAVMVQILLRAGAIAVQF |
| Ga0315295_107513951 | 3300032156 | Sediment | IRAESWYFSHKAVMVQGGYGALFAVMVQILFSITRVAVQV |
| Ga0315295_118653842 | 3300032156 | Sediment | AESWYFSQKAVTVQGGYGALFAVMVQILLSITRVAVQG |
| Ga0315275_125074921 | 3300032401 | Sediment | SIRAGSWYFSQKVVTVQGGYGVLFAVMVQILLSITRVAVQV |
| Ga0326726_100072334 | 3300033433 | Peat Soil | VFFSQEAVTVQALPAGRQGGYGALFAVMVQILLSITRVAVQV |
| Ga0316626_102619832 | 3300033485 | Soil | SQDAAAAVTRCSIWAGSRYFSNKAVTVQGGYGALFAVRVQILLSITRVAVQG |
| Ga0316626_107673941 | 3300033485 | Soil | WYFSQKAVTVQGGYGVVFAVQVQSFVSITRVAVQV |
| Ga0299912_110957531 | 3300033489 | Soil | WYFSQKAVTVQGGYGALFVVMVQILFRAGAIAVQV |
| ⦗Top⦘ |