| Basic Information | |
|---|---|
| Family ID | F055825 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 138 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MPDLNLIEHHPQRVLEAFRRGEFDQIEIIGQADEKEFFELCF |
| Number of Associated Samples | 119 |
| Number of Associated Scaffolds | 138 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 67.39 % |
| % of genes near scaffold ends (potentially truncated) | 93.48 % |
| % of genes from short scaffolds (< 2000 bps) | 97.10 % |
| Associated GOLD sequencing projects | 117 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.35 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.275 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil (16.667 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.188 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (39.855 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 25.71% β-sheet: 0.00% Coil/Unstructured: 74.29% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 138 Family Scaffolds |
|---|---|---|
| PF01420 | Methylase_S | 0.72 |
| PF14690 | zf-ISL3 | 0.72 |
| PF13432 | TPR_16 | 0.72 |
| PF13333 | rve_2 | 0.72 |
| PF10609 | ParA | 0.72 |
| PF01844 | HNH | 0.72 |
| PF03050 | DDE_Tnp_IS66 | 0.72 |
| COG ID | Name | Functional Category | % Frequency in 138 Family Scaffolds |
|---|---|---|---|
| COG0732 | Restriction endonuclease S subunit | Defense mechanisms [V] | 0.72 |
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.72 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.28 % |
| Unclassified | root | N/A | 0.72 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908032|Perma_A_C_ConsensusfromContig22930 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_107219442 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300002122|C687J26623_10158395 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300002961|JGI11641J44799_10187731 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300003994|Ga0055435_10068110 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300004282|Ga0066599_100841145 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300004282|Ga0066599_101436878 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300005555|Ga0066692_10961039 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300005829|Ga0074479_10385922 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300006224|Ga0079037_101512118 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300006224|Ga0079037_101799460 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300006224|Ga0079037_101995703 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300006797|Ga0066659_11531378 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300006930|Ga0079303_10260523 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300007521|Ga0105044_10807405 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300009030|Ga0114950_11155484 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300009037|Ga0105093_10558107 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300009038|Ga0099829_11085846 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300009089|Ga0099828_11248485 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300009131|Ga0115027_10450374 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
| 3300009137|Ga0066709_101752009 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300009139|Ga0114949_11254156 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300009143|Ga0099792_10623324 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300009157|Ga0105092_10341573 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300009179|Ga0115028_10732456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 760 | Open in IMG/M |
| 3300009179|Ga0115028_11580619 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300009502|Ga0114951_10080678 | All Organisms → cellular organisms → Bacteria | 1886 | Open in IMG/M |
| 3300009506|Ga0118657_11637866 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300009616|Ga0116111_1159398 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300009636|Ga0116112_1165723 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300009698|Ga0116216_10638007 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300010319|Ga0136653_10366941 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300010391|Ga0136847_11911103 | All Organisms → cellular organisms → Bacteria | 1120 | Open in IMG/M |
| 3300012361|Ga0137360_11140249 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300012976|Ga0134076_10491139 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300014153|Ga0181527_1289942 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300014155|Ga0181524_10278638 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300014159|Ga0181530_10589293 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300014164|Ga0181532_10489152 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300014165|Ga0181523_10259677 | All Organisms → cellular organisms → Bacteria | 990 | Open in IMG/M |
| 3300014502|Ga0182021_12445818 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300014839|Ga0182027_12072158 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300014839|Ga0182027_12323706 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300015356|Ga0134073_10364413 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300016294|Ga0182041_11276916 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300017938|Ga0187854_10410449 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300018017|Ga0187872_10407550 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300018020|Ga0187861_10285747 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300018021|Ga0187882_1030137 | All Organisms → cellular organisms → Bacteria | 2818 | Open in IMG/M |
| 3300018021|Ga0187882_1238732 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300018022|Ga0187864_10199947 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
| 3300018030|Ga0187869_10052352 | All Organisms → cellular organisms → Bacteria | 2152 | Open in IMG/M |
| 3300018030|Ga0187869_10327227 | Not Available | 735 | Open in IMG/M |
| 3300018040|Ga0187862_10278203 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
| 3300018057|Ga0187858_10631936 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300020015|Ga0193734_1080035 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300020180|Ga0163155_10249335 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300020221|Ga0194127_10616285 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300020603|Ga0194126_10536224 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300021415|Ga0193694_1038743 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 667 | Open in IMG/M |
| 3300022555|Ga0212088_10064140 | All Organisms → cellular organisms → Bacteria | 3737 | Open in IMG/M |
| 3300025008|Ga0210029_1110874 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300025376|Ga0208494_1017947 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300025410|Ga0208875_1075043 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300025533|Ga0208584_1095413 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300025616|Ga0208613_1130490 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300025878|Ga0209584_10338431 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300025906|Ga0207699_10377789 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
| 3300026456|Ga0255351_1068875 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| (restricted) 3300027799|Ga0233416_10280915 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300027877|Ga0209293_10684979 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300027887|Ga0208980_10374447 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300027899|Ga0209668_10841743 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300027903|Ga0209488_10734122 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300027905|Ga0209415_11073252 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300028032|Ga0265296_1288016 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300028178|Ga0265593_1090384 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300028283|Ga0268283_1102852 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300028623|Ga0257141_1097798 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| (restricted) 3300029286|Ga0247841_10707155 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300029889|Ga0246001_1068362 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300029998|Ga0302271_10369747 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300030000|Ga0311337_11333377 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300030019|Ga0311348_11258052 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300030620|Ga0302046_10889656 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300031232|Ga0302323_101485191 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300031344|Ga0265316_11048679 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300031524|Ga0302320_12052114 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300031722|Ga0311351_10823781 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300031726|Ga0302321_100839181 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
| 3300031834|Ga0315290_10641744 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
| 3300031862|Ga0315280_10343969 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300031885|Ga0315285_10652953 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300031902|Ga0302322_101573545 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300032018|Ga0315272_10521224 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300032070|Ga0315279_10795810 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300032143|Ga0315292_10786785 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300032143|Ga0315292_11020075 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300032156|Ga0315295_11914956 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300032173|Ga0315268_11662450 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300032177|Ga0315276_11639882 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300032342|Ga0315286_10199011 | All Organisms → cellular organisms → Bacteria | 2143 | Open in IMG/M |
| 3300032397|Ga0315287_12500967 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300032401|Ga0315275_11562566 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300032516|Ga0315273_11207280 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
| 3300032516|Ga0315273_12484327 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300032770|Ga0335085_11504139 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300032782|Ga0335082_11618822 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300032783|Ga0335079_11291318 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300032783|Ga0335079_11367198 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300032893|Ga0335069_10394527 | All Organisms → cellular organisms → Bacteria | 1625 | Open in IMG/M |
| 3300033158|Ga0335077_12168826 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300033233|Ga0334722_10665048 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300033402|Ga0326728_10764149 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300033402|Ga0326728_11161440 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300033416|Ga0316622_100481643 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1410 | Open in IMG/M |
| 3300033416|Ga0316622_102962033 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300033418|Ga0316625_101427934 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300033433|Ga0326726_12364468 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300033434|Ga0316613_10683278 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300033480|Ga0316620_11205187 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300033482|Ga0316627_102464471 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300033485|Ga0316626_11374277 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300033487|Ga0316630_11172348 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300033487|Ga0316630_11316707 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300033521|Ga0316616_102118500 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300033521|Ga0316616_102556574 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300033521|Ga0316616_104009746 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300033521|Ga0316616_104129090 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300033557|Ga0316617_101443616 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300033557|Ga0316617_101579207 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300033557|Ga0316617_102102274 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300033557|Ga0316617_102486453 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300033755|Ga0371489_0518731 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300033797|Ga0334815_044056 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300033822|Ga0334828_076569 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
| 3300033982|Ga0371487_0464276 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300034691|Ga0370488_254232 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 16.67% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 12.32% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 7.25% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 4.35% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 3.62% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.62% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 3.62% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 2.90% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 2.17% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 2.17% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 2.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.17% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 2.17% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 2.17% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.45% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.45% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.45% |
| Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 1.45% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 1.45% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 1.45% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.45% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.45% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.45% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.45% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.72% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.72% |
| Freshwater Lake Hypolimnion | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion | 0.72% |
| Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat | 0.72% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.72% |
| Anoxic Lake Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Lake Water | 0.72% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.72% |
| Aquifer | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Aquifer | 0.72% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.72% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.72% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.72% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.72% |
| Mangrove Sediment | Environmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment | 0.72% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.72% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.72% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.72% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.72% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.72% |
| Peat | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat | 0.72% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.72% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908032 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Perma_all | Environmental | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300002122 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_2 | Environmental | Open in IMG/M |
| 3300002961 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site A1 Bulk | Environmental | Open in IMG/M |
| 3300003994 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300004282 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sediment | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005829 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC | Environmental | Open in IMG/M |
| 3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006930 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC | Environmental | Open in IMG/M |
| 3300007521 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-01 | Environmental | Open in IMG/M |
| 3300009030 | Deep subsurface microbial communities from Kermadec Trench to uncover new lineages of life (NeLLi) - N075 metaG | Environmental | Open in IMG/M |
| 3300009037 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009139 | Deep subsurface microbial communities from Kermadec Trench to uncover new lineages of life (NeLLi) - N074 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
| 3300009502 | Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaG | Environmental | Open in IMG/M |
| 3300009506 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8 | Environmental | Open in IMG/M |
| 3300009616 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 | Environmental | Open in IMG/M |
| 3300009636 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300010319 | Anoxic lake water microbial communities from Lake Kivu, Rwanda to study Microbial Dark Matter (Phase II) - Lake Kivu water 275m metaG | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300014153 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaG | Environmental | Open in IMG/M |
| 3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
| 3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018020 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100 | Environmental | Open in IMG/M |
| 3300018021 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150 | Environmental | Open in IMG/M |
| 3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
| 3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300020015 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m1 | Environmental | Open in IMG/M |
| 3300020180 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.SP4.G1 | Environmental | Open in IMG/M |
| 3300020221 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100m | Environmental | Open in IMG/M |
| 3300020603 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015035 Kigoma Deep Cast 150m | Environmental | Open in IMG/M |
| 3300021415 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s1 | Environmental | Open in IMG/M |
| 3300022555 | Alinen_combined assembly | Environmental | Open in IMG/M |
| 3300025008 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025376 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA10M (SPAdes) | Environmental | Open in IMG/M |
| 3300025410 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH25Aug08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025533 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025616 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA6M (SPAdes) | Environmental | Open in IMG/M |
| 3300025878 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026456 | Peat soil microbial communities from Stordalen Mire, Sweden - H.B.S.T-25.r2 | Environmental | Open in IMG/M |
| 3300027799 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0_MG | Environmental | Open in IMG/M |
| 3300027877 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027887 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 Bulk | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028032 | Groundwater microbial communities from a municipal landfill in Southern Ontario, Canada - Pumphouse #1 | Environmental | Open in IMG/M |
| 3300028178 | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_36m | Environmental | Open in IMG/M |
| 3300028283 | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2013_06_06_36m | Environmental | Open in IMG/M |
| 3300028623 | Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_1_27_36m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029286 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_18m | Environmental | Open in IMG/M |
| 3300029889 | Peat microbial communities from Marcell Experimental Forest bog in Minnesota, USA - MG_T3F_30cm | Environmental | Open in IMG/M |
| 3300029998 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N1_1 | Environmental | Open in IMG/M |
| 3300030000 | I_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300030019 | II_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
| 3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
| 3300031722 | II_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300031862 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_40 | Environmental | Open in IMG/M |
| 3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300032018 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_middle | Environmental | Open in IMG/M |
| 3300032070 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_20 | Environmental | Open in IMG/M |
| 3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
| 3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
| 3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033416 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033434 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_CT_b | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| 3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033485 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_A | Environmental | Open in IMG/M |
| 3300033487 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_A | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
| 3300033755 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fraction | Environmental | Open in IMG/M |
| 3300033797 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-2-S | Environmental | Open in IMG/M |
| 3300033822 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 5-9 | Environmental | Open in IMG/M |
| 3300033982 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB22AY SIP fraction | Environmental | Open in IMG/M |
| 3300034691 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_04D_16 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Perma_A_C_04064370 | 2124908032 | Soil | MIDLNIIEYHPQRVLEAFRRGEFDQIEIIGQADEKEFFELCFKEKILEALA |
| JGIcombinedJ13530_1072194421 | 3300001213 | Wetland | MDLQIIEHHPQRVLAALRRGEFDALEIVGEADEKEFFERLFREKLL |
| C687J26623_101583951 | 3300002122 | Soil | MNVSFVESHPQRVLEAFRRGDFDELEVIGQADEKEFFELCFQKKMLESLA |
| JGI11641J44799_101877312 | 3300002961 | Wetland | MFSLNLIEHHPQRVLEAFRRGEFDQIEIIGQADEKEFFELCFKEKLLPALAKEMPTARKKEE |
| Ga0055435_100681102 | 3300003994 | Natural And Restored Wetlands | MELIEHHQQQVLEAFRSGEFDQIEIIGHADEKEFFELCLKEKMLEALADEM |
| Ga0066599_1008411451 | 3300004282 | Freshwater | MFNLNIIEHHPQRVLAAFRRGEFDQIEIIGQADEKEFFELC |
| Ga0066599_1014368782 | 3300004282 | Freshwater | MLNLNLIEHHPQRVLAAFRRGEFDQIEIIGQADEKEFFELC |
| Ga0066692_109610392 | 3300005555 | Soil | MLNLDLIEHHPQRVLEAFRRGEFDQIEIIGQADEKEFF |
| Ga0074479_103859222 | 3300005829 | Sediment (Intertidal) | MDLTIIEHHPRRVLEAFRRGEFDQIEIIGEADEKEFFELCFREK |
| Ga0079037_1015121183 | 3300006224 | Freshwater Wetlands | MDRELVEPHPRLVLEAFRRGAFDGLEVLGQADEKAFFE |
| Ga0079037_1017994601 | 3300006224 | Freshwater Wetlands | MNLALVEPHPRRVLEAFRQGQFDGIEIIGRADEKA |
| Ga0079037_1019957032 | 3300006224 | Freshwater Wetlands | MNLEIIEHHQQQVLEAFSQGKFDQIEIIGEADEKEFFELCFREKILA |
| Ga0066659_115313782 | 3300006797 | Soil | MPDLTIIEHHPQRVLEAFRRGEFDQIEIIGQADEKEFF |
| Ga0079303_102605232 | 3300006930 | Deep Subsurface | MDRELVEPHPRLVLEAFRRGAFDGLEVLGQADEKAFFELCFR |
| Ga0105044_108074052 | 3300007521 | Freshwater | VNLELVEPHPRRVLEAFRRGEFDGLEILGQADEKAFF* |
| Ga0114950_111554841 | 3300009030 | Deep Subsurface | MNLDIIEHHPRKVLEAFRRGEFDQIEIIGQADEKEFFELCFKEKILSALAGNMPTNRKK |
| Ga0105093_105581071 | 3300009037 | Freshwater Sediment | MQIIEHHPQRVLDALRRGEFDALEIVGEADERAFFQRLF |
| Ga0099829_110858461 | 3300009038 | Vadose Zone Soil | MPDLTIIEHHPHRVLEAFRRGEFDQIEIIGQADEKEFFE |
| Ga0099828_112484852 | 3300009089 | Vadose Zone Soil | MPDLTLIEHHPRRVLEAFRRGEFDQIEIIGQADEKRVL* |
| Ga0115027_104503741 | 3300009131 | Wetland | MNLELIEPHPRRVLEAFRRGEFDDLEVLGQADEKAFFELG |
| Ga0066709_1017520091 | 3300009137 | Grasslands Soil | MDIAIVEPHPRRVLDAFRNGQFDDLEIIGQADEKEFFELCFKEKILESL |
| Ga0114949_112541561 | 3300009139 | Deep Subsurface | MNLDIIEHHPRKVLEAFRRGEFDQIEIIGQADEKEFFELCFKEKILSA |
| Ga0099792_106233242 | 3300009143 | Vadose Zone Soil | MTDLSFIEYHPHRVLEAFRRGDFDQIEIIGQADEKEFFELCFAEKILHA |
| Ga0105092_103415731 | 3300009157 | Freshwater Sediment | MSLEIIEHHQQHVLEAFSQGEFDQIEIIGEADEKEFFELCFREKI |
| Ga0115028_107324561 | 3300009179 | Wetland | MNLELVEPHPRRVLEAFRRGEFDDLEVLGQADEKTFFEL |
| Ga0115028_115806191 | 3300009179 | Wetland | MSLELIEPHPRRVLEAFREGDFDGIEIIGRADEKAFFELCFREKL |
| Ga0114951_100806782 | 3300009502 | Freshwater | LNLEIIEPRQQWVLEAFRRGEFDQLEVIGAADEKEFFEWCFQEKILAALA* |
| Ga0118657_116378662 | 3300009506 | Mangrove Sediment | MDLILIEPHPRRVLDSFRQGEFDELEIIGQADEKEFFELCLRENL |
| Ga0116111_11593982 | 3300009616 | Peatland | MPDLNLIEHHPQRVLEAFRRGEFDQIEIIGQADEKEFFELCF |
| Ga0116112_11657232 | 3300009636 | Peatland | MFDLNIVEHHPQRVLEAFRRGEFDQIEIVGQADEKEFFELCFKEKILEALAK |
| Ga0116216_106380072 | 3300009698 | Peatlands Soil | MNLEIIEHHQQQVLEAFSRGEFDQIEIIGEADEKE |
| Ga0136653_103669412 | 3300010319 | Anoxic Lake Water | MDLRVIEHHPQRVLDALRRGEFDALEIVGEADERDFFERLFREKL |
| Ga0136847_119111031 | 3300010391 | Freshwater Sediment | VIDLHLIEHHPQRVLAAFRRGHFDQIEIIGQADEKEFFELCFTEKILEALAK |
| Ga0137360_111402492 | 3300012361 | Vadose Zone Soil | MDLSFVEPHPQRVLEAFRAGQFDDLEIIGQADEKEFF |
| Ga0134076_104911392 | 3300012976 | Grasslands Soil | MLNLDLIEHHPQRVLEAFRRGEFDQIEIIGQADEKEFFELCFQEKMLADLAK |
| Ga0181527_12899421 | 3300014153 | Bog | MPDIDFIEYHPQRVLEAFRLGEFDQIEIIGQADEKEFF |
| Ga0181524_102786383 | 3300014155 | Bog | MPDLNLIEHHPQRVLEAFRRGEFDQIEIIGQADEKEFF |
| Ga0181530_105892931 | 3300014159 | Bog | MPDLDLIEYHPQRVLEAFRSGEFDQIEIIGQADEKEF |
| Ga0181532_104891522 | 3300014164 | Bog | MPDLNLIEHHPQRVLEAFRRGEFDQIEIVGQADEKE |
| Ga0181523_102596773 | 3300014165 | Bog | MPDLDLIEHHPQRVLEAFRRGEFDQIEIIGQADEKEFFELCFK |
| Ga0182021_124458182 | 3300014502 | Fen | MLNLNLIEHHPQRVLAALRRGEFDQIEIIGQADEKEFFELCFKEKLLPALAKEMPTARKKEEV |
| Ga0182027_120721581 | 3300014839 | Fen | MPDIDLIEYHPQRVLEAFRRGEFDQIEIIGQADEKEFFELC |
| Ga0182027_123237061 | 3300014839 | Fen | MPDLNLIEHHPQRVLEAFRRGEFDQIEIIGQADEKEFFELCFQEK |
| Ga0134073_103644131 | 3300015356 | Grasslands Soil | MPDLTIIEHHPQRVLEAFRRGEFDQIEIIGQADEKE |
| Ga0182041_112769162 | 3300016294 | Soil | MEIIEPHQQAVLEAFRRGEFDQIEIIGHADEKEFFELCLKEKMLEALAKEMPTERKKE |
| Ga0187854_104104491 | 3300017938 | Peatland | MPDIDLIEHHPQRVLEAFRRGEFDQIEIIGQADEKEFFELCF |
| Ga0187872_104075502 | 3300018017 | Peatland | MFNLNLIEPHPQRVLEAFRRGEFDPLEIIGQADEKEFFELCFQEKILATLAKEMPTARKKEE |
| Ga0187861_102857472 | 3300018020 | Peatland | MNLEIIEHHQQWVLEAFRQGEFDQLEIIGEADEKEFF |
| Ga0187882_10301371 | 3300018021 | Peatland | MFNLNLIEPHPQRVLEAFRRGEFDPLEIIGQADEKE |
| Ga0187882_12387321 | 3300018021 | Peatland | MFDLNIVEHHPQRVLEAFRRGEFDQIEIIGQADEKEFFELCFKEKILE |
| Ga0187864_101999471 | 3300018022 | Peatland | MPDLHLIEHHPQRVLEAFRRGEFDQIEIIGQADEKEFFEL |
| Ga0187869_100523521 | 3300018030 | Peatland | MLDLNLIEPHPQRVLEAFPRGEFDQIEVVGQADEKEFFELCFKEKI |
| Ga0187869_103272272 | 3300018030 | Peatland | MPDLNLIEHHPHRVLEAFRRGEFDQIEIIGQADEKEFFELLTAQSKKIA |
| Ga0187862_102782033 | 3300018040 | Peatland | MFNLNLIEPHPQRVLEAFRRGEFDPLEIIGQADEKEFFELCFQ |
| Ga0187858_106319363 | 3300018057 | Peatland | MLDLNLIEPHPQRVLEAFPRGEFDQIEVVGQADEKEFFELCF |
| Ga0193734_10800351 | 3300020015 | Soil | MISLQIIEHHPQRVLEAFRRGEFDQIEVIGEADEKEFFEHALL |
| Ga0163155_102493352 | 3300020180 | Freshwater Microbial Mat | VNLELVEPHPRRVLEAFRRGEFDGLEILGQADEKAFF |
| Ga0194127_106162852 | 3300020221 | Freshwater Lake | MNLQLIEYHPQRVLEALRRGDFDDVEIIGEADEKEFFELLFREKMLDQLAA |
| Ga0194126_105362241 | 3300020603 | Freshwater Lake | MPELQLIEHHPQRVLEAFRRGEFDQIEIIGQADEKDFFELCQRERLL |
| Ga0193694_10387432 | 3300021415 | Soil | MFNLNLIEHHPKRVLEAFRRGEFDQIEIIGQSPPST |
| Ga0212088_100641404 | 3300022555 | Freshwater Lake Hypolimnion | LNLEIIEPRQQWVLEAFRRGEFDQLEVIGAADEKEFFEWCFQEKILAALA |
| Ga0210029_11108742 | 3300025008 | Aquifer | MHLQIIEHHPQRVREALRRGEFDALEIVGEADEKEFFERLFRTKLLEALAATMPTKR |
| Ga0208494_10179472 | 3300025376 | Freshwater | LNLEIIEHHQQWVLEAFRRGEFDQIEVIGEADEKEFFELCFKEKLLAALA |
| Ga0208875_10750432 | 3300025410 | Freshwater | MNLEIIEHHQQQVLEAFSQGEFDQIEIIGEADEKEFFELCFREKIL |
| Ga0208584_10954132 | 3300025533 | Arctic Peat Soil | MFSLNLIEHHPQRVLEAFRRGEFDQIEIIGQADEKEFFELCFQEKILVALAKELPTARKK |
| Ga0208613_11304902 | 3300025616 | Freshwater | VPDLNLIEHHPQRVLEAFRRGEFDQIEIIGQADEKEFFELCFK |
| Ga0209584_103384311 | 3300025878 | Arctic Peat Soil | MLNLNLIEHHPQRVLAAFRRGEFDQIEIIGQADEKEFFELCF |
| Ga0207699_103777892 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | VELIEHHQQQVLEAFRRGEFDQIEIIGYADEKQFFEVCFREKIL |
| Ga0255351_10688751 | 3300026456 | Soil | MPDIDLIEYHPQRVLEAFRRGEFDQIEIIGQADEKEFFELCFREKML |
| (restricted) Ga0233416_102809151 | 3300027799 | Sediment | VADLQLIEYHPQRVLEAFRRGEFDQLEIIGQADEKEFFELCLKEKI |
| Ga0209293_106849792 | 3300027877 | Wetland | MDRELVEPHPRLVLEAFRRGAFDGLEVLGQADEKAFFELCF |
| Ga0208980_103744471 | 3300027887 | Wetland | MNLEIIEHHQQQVLEAFGQGEFDQIEIIGEADEKEFFELCFGEKILARLAES |
| Ga0209668_108417432 | 3300027899 | Freshwater Lake Sediment | MVSLNLIEHHPQRVLEAFRRGEFDQIEIIGQADEKEFFELCFKEKLLPALAKEMPTARKK |
| Ga0209488_107341222 | 3300027903 | Vadose Zone Soil | MTDLSFIEYHPHRVLEAFRRGDFDQIEIIGQADEKEFFELCFAEKILHALAKEMPTAR |
| Ga0209415_110732521 | 3300027905 | Peatlands Soil | MNLEIIEHHQQQVLEAFSQGEFDQIEIIGEADEKEFFELCLREKILARLAASMPTARKKE |
| Ga0265296_12880161 | 3300028032 | Groundwater | MADLAIIEHHPQRVLEAFRRGEFDQIEIIGEADEKEFFELCF |
| Ga0265593_10903841 | 3300028178 | Saline Water | MFNLNIIEHRPQRVLEAFRRGEFDQIEIIGQADEKEFFELCFQEKILGALAKDMP |
| Ga0268283_11028522 | 3300028283 | Saline Water | MDLRVIEHHPQRVLEALRRGEFDALEIVGEADERDFFERLFREKLLARLAATM |
| Ga0257141_10977981 | 3300028623 | Marine | MFNLNLIEHHPQRVLEAFRRGEFDQIEIIGQADDKEFFELCFQEKIVAALAKDMPTARKKVVPGSSGGY |
| (restricted) Ga0247841_107071552 | 3300029286 | Freshwater | MDLQIIEHHPKLVLEALRRGEFDALEILGEADEKEFFERLFREKLLEK |
| Ga0246001_10683623 | 3300029889 | Peat | MPDIDLIEYHPQRVLEAFRRGEFDQIEIIGQADEKEFFELCFK |
| Ga0302271_103697471 | 3300029998 | Bog | MFNLNIIEHHPQRVLAASRRGEFDQIEIIGQADEKEFFELCFQEKILVALAQEM |
| Ga0311337_113333771 | 3300030000 | Fen | MFNLNIIEHHPQRVLAAFRRGEFDQIEIIGQADEKEFFELCFQEKIFVALAQEMPTARK |
| Ga0311348_112580521 | 3300030019 | Fen | MPDIDLIEYHPQRVLEAFRRGEFDQIEIIGQADEKEFF |
| Ga0302046_108896562 | 3300030620 | Soil | MTHLTLIEHHPRAVLEAFRRGEFDSFEWLGEADEREFFELLFREKMLPALAESM |
| Ga0302323_1014851912 | 3300031232 | Fen | MNLEIIEHHQQQVLEAFSQGEFDQIEIIGEADEKEFFELCFREKILARLAE |
| Ga0265316_110486792 | 3300031344 | Rhizosphere | MPDLNLIEHHPQRVLDAFRRGEFDQIEIVGQADEKEFFEL |
| Ga0302320_120521142 | 3300031524 | Bog | MPDLNLIEHHPQRVLEAFRRGEFDQIEIIGQADEKEFFEL |
| Ga0311351_108237811 | 3300031722 | Fen | MFNLNIIEHHPQRVLAAFRRGEFDQIEIIGQADEKEFFELCFQEKILVAL |
| Ga0302321_1008391812 | 3300031726 | Fen | MFNLNIIEHHPQRVLAASRRGEFDQIEIIGQADEKEFFELCFQEKILVALAQEMPTARK |
| Ga0315290_106417442 | 3300031834 | Sediment | MNLELVEPHPRRVLEAFRRGEFDDLEVLGQADEKAFFELCFRE |
| Ga0315280_103439691 | 3300031862 | Sediment | MDLRVIEHHPQRVLEALRRGEFDALEIVGEADERDFFERLF |
| Ga0315285_106529531 | 3300031885 | Sediment | MDLRVIEHHPQRVLEALRRGEFDALEIVGEADERDFFE |
| Ga0302322_1015735451 | 3300031902 | Fen | MIDLNIIEHHPQRVLEAFRRGEFDQIEIIGQADEKEFFELCFQEKILEKLAQ |
| Ga0315272_105212241 | 3300032018 | Sediment | MNLNIVEHHPQRVLEAFRRGEFDQIEIIGQADEKEFFELCIKE |
| Ga0315279_107958102 | 3300032070 | Sediment | MELIEHHQQRVVEAFRRGEFDQIEIIGQADEKQFFELC |
| Ga0315292_107867851 | 3300032143 | Sediment | MNLDLVEPHPRRVLEAFRRGEFDDLEVLGQADEKAFFE |
| Ga0315292_110200751 | 3300032143 | Sediment | LNLEIIEHRQQWVLEAFRRGEFDQIEVIGEADEKEFF |
| Ga0315295_119149562 | 3300032156 | Sediment | MADLEIIEHHPQRVMEAFRRGEFDQIEIIGEADEKEFFELCLREKI |
| Ga0315268_116624501 | 3300032173 | Sediment | MFNLNIIEHHPQRVLEAFRRGEFDQIEIIGQADEK |
| Ga0315276_116398821 | 3300032177 | Sediment | MFSLNLIEHHPQRVLEAFRRGEFDQIEIIGQADEKEFF |
| Ga0315286_101990115 | 3300032342 | Sediment | MDLELVEPHPRRVLEAFRRGEFDGLEVLGQADEQAFFELGFREKLL |
| Ga0315287_125009671 | 3300032397 | Sediment | MLSLNLIEHHPQRVLEAFRRGEFDQIEIIGQADEKEFFELCFK |
| Ga0315275_115625661 | 3300032401 | Sediment | MDLQIIEHHPQLVLEALRRGEFDALEIVGEADEKEFFDRLFR |
| Ga0315273_112072801 | 3300032516 | Sediment | MDLQVIEHHPQRVLDALRRGEFDAVEIVGEADEKEFFERLFREKLLEALAATMPTD |
| Ga0315273_124843271 | 3300032516 | Sediment | MDLQIIEHHPQRVLEALRRGEFDALEIVGEADEREFFERLFREKLLEALAAT |
| Ga0335085_115041392 | 3300032770 | Soil | MLDLQIIEHHPQRVLEAFRRGEFDQLEIIGEADEKEFFE |
| Ga0335082_116188221 | 3300032782 | Soil | MADLRLIEYHPQRVLEAFRRGEFDQLEIIGQADEKEFFELCLKEKILDALAEA |
| Ga0335079_112913182 | 3300032783 | Soil | MNLEIIEHHQQQVLDAFSQGEFDQIEIIGEADEKEFFELCFREKILTR |
| Ga0335079_113671982 | 3300032783 | Soil | MNLEIIEHHQQQVLEAFSRGEFDQIEIIGEADEKEFFELCFREK |
| Ga0335069_103945271 | 3300032893 | Soil | MNLEIIEHHQQQVLEAFSQGQFDQIEIIGEADEKEFFELCFREKILARLAQSMPTARKKGFFRNSLGIFHSRI |
| Ga0335077_121688261 | 3300033158 | Soil | MELIEHHQQRVLEAFRRGEFDQIEIIGEADEKQFF |
| Ga0334722_106650481 | 3300033233 | Sediment | MNLEIIEHHQQQVLEAFRQGDFDQIEMIGEADEKEFFELCFREKILARLAEQMPTERKKE |
| Ga0326728_107641492 | 3300033402 | Peat Soil | MLDLNIVEHHPQRVLEAFRRGDFDQIEIVGQADEKEFFELCFKEKILEA |
| Ga0326728_111614401 | 3300033402 | Peat Soil | MPDLNLIEHHPQRVLEAFRRGEFDQIEIIGQADEKEFFELCFQEKML |
| Ga0316622_1004816433 | 3300033416 | Soil | MDRELVEPHPRRVLEAFRRGAFDGLEVLGQADEKAFFALCFREK |
| Ga0316622_1029620331 | 3300033416 | Soil | MDLSLIEHQPQRVLEDFRRGEFDQIEVIGEADEKEFFELCF |
| Ga0316625_1014279341 | 3300033418 | Soil | MELIEHHQQAVLEAFRRGEFDQIEIIGHADEKQFFELCFQ |
| Ga0326726_123644682 | 3300033433 | Peat Soil | MLSLNLIEHHPQRVLEAFRRGEFDQIEIIGQADEKEFFELCFKEKLLPAL |
| Ga0316613_106832781 | 3300033434 | Soil | MNLEIIEHHQPQVLEAFSQGEFDQIEIIGEADEKEFFELCFREKILGRLAESMPTARK |
| Ga0316620_112051871 | 3300033480 | Soil | MELIEHHPQRVLEAFRRGEFDQIEIIGQADEKQFFELCLKEKILTDLAEEMPTARKKE |
| Ga0316627_1024644712 | 3300033482 | Soil | MDLSLIEHQPQRVLEDFRRGEFDQIEIIGEADEKEFFELCIR |
| Ga0316626_113742772 | 3300033485 | Soil | MDLSLIEHQPQRVLEDFRQGEFDQIEIIGEADEKEFFELCFREKI |
| Ga0316630_111723481 | 3300033487 | Soil | MDLSLIEHQPQRVLEDFRRGEFDQIEVIGEADEKEFFELCFREKILDPLAER |
| Ga0316630_113167071 | 3300033487 | Soil | MDLSLIEYQPQRVLEDFRQGEFDQIEIIGEADEKEFFELCFREKILSALAEPMPSARKKVEVP |
| Ga0316616_1021185001 | 3300033521 | Soil | MELIEHHQQAVVEAFRRGEFDQIEIIGHADEKEFFELCFREKILEA |
| Ga0316616_1025565742 | 3300033521 | Soil | MDLELVEPHPRRVLEAFRQGDFDGLEILGQADEKAFFE |
| Ga0316616_1040097461 | 3300033521 | Soil | MNVEIIEHRQQWVLDAFRQGEFDQIEVIGEADEKEFFELCFQEKILAALAKAM |
| Ga0316616_1041290901 | 3300033521 | Soil | MNLELVEPHPRRVLEAFRRGEFDDLEVLGQADEKA |
| Ga0316617_1014436161 | 3300033557 | Soil | MDLELVEPHPRRVLEAFRQGDLDGLEILGQADEKAFFE |
| Ga0316617_1015792071 | 3300033557 | Soil | MNLEIIEHHQPQVLEALSQGEFDQIEIIGEADEKEF |
| Ga0316617_1021022741 | 3300033557 | Soil | MNLEIIEHHQQQVLEAFSQGQFDQIEIIGEADEKEFFELCFRE |
| Ga0316617_1024864532 | 3300033557 | Soil | MSLTLIEPHPRQVLEAFRQGDFDDLEIIGRADEKEFFELA |
| Ga0371489_0518731_385_525 | 3300033755 | Peat Soil | MPDLHLIEHHPQRVLEAFRRGEFDQIEIIGQADEKEFFELCFREKML |
| Ga0334815_044056_430_558 | 3300033797 | Soil | MDLHVIEHHPQRVLDALRRGEFDALEIVGEADEREFFERLFRE |
| Ga0334828_076569_3_146 | 3300033822 | Soil | MPDIDLIEYHPQRVLEAFRRGEFDQIEIIGQADEKEFFELCFREKMLD |
| Ga0371487_0464276_2_112 | 3300033982 | Peat Soil | MPDLHLIEHHPQRVLDAFRRGEFDQIEIIGQADEKEF |
| Ga0370488_254232_1_180 | 3300034691 | Untreated Peat Soil | MANLSLIEYHPQAVLEAFRRGEFDQIEIIGQADEKEFFELCFKEKILDALAKEMPTDRKK |
| ⦗Top⦘ |