NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F052624

Metagenome / Metatranscriptome Family F052624

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F052624
Family Type Metagenome / Metatranscriptome
Number of Sequences 142
Average Sequence Length 48 residues
Representative Sequence MIYANRITKEMYVFDKDGEWHDEGVYHDALSMDKTYNETNWYDEFSVHNF
Number of Associated Samples 122
Number of Associated Scaffolds 142

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 21.58 %
% of genes near scaffold ends (potentially truncated) 32.39 %
% of genes from short scaffolds (< 2000 bps) 97.89 %
Associated GOLD sequencing projects 118
AlphaFold2 3D model prediction Yes
3D model pTM-score0.25

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (97.887 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(18.310 % of family members)
Environment Ontology (ENVO) Unclassified
(50.704 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(50.000 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 8.97%    β-sheet: 10.26%    Coil/Unstructured: 80.77%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.25
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.89 %
UnclassifiedrootN/A2.11 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002835|B570J40625_101120655All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae664Open in IMG/M
3300004686|Ga0065173_1102360All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae513Open in IMG/M
3300004687|Ga0065174_1058895All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae723Open in IMG/M
3300004769|Ga0007748_10020908All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae572Open in IMG/M
3300004777|Ga0007827_10104874All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae635Open in IMG/M
3300004790|Ga0007758_11095077All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae596Open in IMG/M
3300005662|Ga0078894_11243575All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae629Open in IMG/M
3300005662|Ga0078894_11529210All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae553Open in IMG/M
3300005987|Ga0075158_10565242All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae626Open in IMG/M
3300005988|Ga0075160_10365352All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae785Open in IMG/M
3300006037|Ga0075465_10081854All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae704Open in IMG/M
3300006037|Ga0075465_10087365All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae684Open in IMG/M
3300006107|Ga0007836_1114349All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae581Open in IMG/M
3300006357|Ga0075502_1656192All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae648Open in IMG/M
3300006394|Ga0075492_1119999All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila658Open in IMG/M
3300006394|Ga0075492_1318257All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii583Open in IMG/M
3300006415|Ga0099654_10562702All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae576Open in IMG/M
3300006641|Ga0075471_10579629All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae552Open in IMG/M
3300007516|Ga0105050_10470548All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae745Open in IMG/M
3300007561|Ga0102914_1142583All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae741Open in IMG/M
3300007649|Ga0102912_1107780All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae803Open in IMG/M
3300007667|Ga0102910_1077172All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae768Open in IMG/M
3300007864|Ga0105749_1093439All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae657Open in IMG/M
3300007972|Ga0105745_1156267All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae701Open in IMG/M
3300008999|Ga0102816_1170367All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae677Open in IMG/M
3300009071|Ga0115566_10415562All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae773Open in IMG/M
3300009071|Ga0115566_10460271All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae726Open in IMG/M
3300009159|Ga0114978_10493665All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae720Open in IMG/M
3300009159|Ga0114978_10514904All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii701Open in IMG/M
3300009172|Ga0114995_10311706All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae866Open in IMG/M
3300009263|Ga0103872_1072001All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae532Open in IMG/M
3300009433|Ga0115545_1184341All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae716Open in IMG/M
3300009434|Ga0115562_1180471All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae767Open in IMG/M
3300009436|Ga0115008_10500606All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum868Open in IMG/M
3300009526|Ga0115004_10400492All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae813Open in IMG/M
3300009543|Ga0115099_10498707All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae609Open in IMG/M
3300009599|Ga0115103_1321869All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae589Open in IMG/M
3300009599|Ga0115103_1322737All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae605Open in IMG/M
3300009599|Ga0115103_1861521All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea577Open in IMG/M
3300009606|Ga0115102_10370701All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea579Open in IMG/M
3300009608|Ga0115100_10756109All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae621Open in IMG/M
3300010388|Ga0136551_1044466All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae815Open in IMG/M
3300012408|Ga0138265_1335083All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae629Open in IMG/M
3300012414|Ga0138264_1148064All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae651Open in IMG/M
3300012716|Ga0157605_1128881All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae547Open in IMG/M
3300012782|Ga0138268_1253881All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae656Open in IMG/M
3300012968|Ga0129337_1320465All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae605Open in IMG/M
3300013087|Ga0163212_1179057All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae666Open in IMG/M
3300013295|Ga0170791_13533698All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae610Open in IMG/M
3300016726|Ga0182045_1049389All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae522Open in IMG/M
3300017238|Ga0186197_116151All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae649Open in IMG/M
3300017262|Ga0186220_116395All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae636Open in IMG/M
3300017299|Ga0186338_1026867All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae700Open in IMG/M
3300018420|Ga0181563_10457754All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae721Open in IMG/M
3300018692|Ga0192944_1052952All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae576Open in IMG/M
3300018831|Ga0192949_1090981All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae584Open in IMG/M
3300018846|Ga0193253_1108592All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae638Open in IMG/M
3300018873|Ga0193553_1160191All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae501Open in IMG/M
3300018899|Ga0193090_1111804All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae617Open in IMG/M
3300018899|Ga0193090_1113138All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae612Open in IMG/M
3300018974|Ga0192873_10427735All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea523Open in IMG/M
3300018980|Ga0192961_10158993All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae687Open in IMG/M
3300019021|Ga0192982_10211118All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae693Open in IMG/M
3300019021|Ga0192982_10348544All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae530Open in IMG/M
3300019031|Ga0193516_10241390All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae590Open in IMG/M
3300019033|Ga0193037_10267634All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae596Open in IMG/M
3300019036|Ga0192945_10208073All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae627Open in IMG/M
3300019036|Ga0192945_10287033All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae515Open in IMG/M
3300019048|Ga0192981_10264709All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae653Open in IMG/M
3300019048|Ga0192981_10288300All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae616Open in IMG/M
3300019050|Ga0192966_10286306All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae582Open in IMG/M
3300019054|Ga0192992_10195056All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae656Open in IMG/M
3300019151|Ga0192888_10190496All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae629Open in IMG/M
3300019153|Ga0192975_10160603All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae810Open in IMG/M
3300019201|Ga0180032_1013179All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae504Open in IMG/M
3300020074|Ga0194113_10825547All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae632Open in IMG/M
3300020084|Ga0194110_10570514All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae724Open in IMG/M
3300020183|Ga0194115_10307426All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae720Open in IMG/M
3300020183|Ga0194115_10325280All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae691Open in IMG/M
3300021108|Ga0214162_1043958All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae753Open in IMG/M
3300021350|Ga0206692_1384323All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae627Open in IMG/M
3300021353|Ga0206693_1733438All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae548Open in IMG/M
3300021376|Ga0194130_10385164All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae749Open in IMG/M
3300021424|Ga0194117_10367320All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae665Open in IMG/M
3300021874|Ga0063147_125347All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae563Open in IMG/M
3300022374|Ga0210311_1029794All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae660Open in IMG/M
3300025388|Ga0208503_1021920All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae725Open in IMG/M
3300025451|Ga0208426_1044394All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae684Open in IMG/M
3300025809|Ga0209199_1176586All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae767Open in IMG/M
3300025848|Ga0208005_1099434All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii908Open in IMG/M
3300025848|Ga0208005_1121417All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae816Open in IMG/M
3300025881|Ga0209309_10366433All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae629Open in IMG/M
3300025890|Ga0209631_10299720All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae779Open in IMG/M
3300026449|Ga0247593_1117088All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae518Open in IMG/M
3300027781|Ga0209175_10312176All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae663Open in IMG/M
3300027781|Ga0209175_10314608All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae660Open in IMG/M
3300027883|Ga0209713_10442331All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae854Open in IMG/M
3300027883|Ga0209713_10971434All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae528Open in IMG/M
3300027885|Ga0209450_10661751All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae760Open in IMG/M
3300028137|Ga0256412_1285245All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae608Open in IMG/M
3300029910|Ga0311369_10636974All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae884Open in IMG/M
3300030532|Ga0210290_1489432All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae504Open in IMG/M
3300030548|Ga0210252_10745414All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae599Open in IMG/M
3300030564|Ga0210256_11042768All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae612Open in IMG/M
3300030602|Ga0210254_10525368All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae556Open in IMG/M
3300030653|Ga0307402_10636452All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae621Open in IMG/M
3300030670|Ga0307401_10402063All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae623Open in IMG/M
3300030670|Ga0307401_10441078All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae592Open in IMG/M
3300030671|Ga0307403_10492415All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae662Open in IMG/M
3300030671|Ga0307403_10700062All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae551Open in IMG/M
3300030709|Ga0307400_10710368All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae624Open in IMG/M
3300030740|Ga0265460_11661233All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae647Open in IMG/M
3300030741|Ga0265459_13110718All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae580Open in IMG/M
3300030909|Ga0074033_10461374All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae548Open in IMG/M
3300031036|Ga0073978_1628795All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae518Open in IMG/M
3300031446|Ga0170820_14792202All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae598Open in IMG/M
3300031474|Ga0170818_101681700All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae632Open in IMG/M
3300031522|Ga0307388_10736693All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae659Open in IMG/M
3300031569|Ga0307489_10465100All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae854Open in IMG/M
3300031729|Ga0307391_10643482All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea602Open in IMG/M
3300031735|Ga0307394_10325675All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae612Open in IMG/M
3300031784|Ga0315899_11625891All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae534Open in IMG/M
3300032150|Ga0314779_1024693All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae592Open in IMG/M
3300032462|Ga0335396_10509659All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae762Open in IMG/M
3300032470|Ga0314670_10449140All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae675Open in IMG/M
3300032481|Ga0314668_10391468All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae717Open in IMG/M
3300032519|Ga0314676_10574912All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae666Open in IMG/M
3300032521|Ga0314680_10816469All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae587Open in IMG/M
3300032711|Ga0314681_10694205All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae562Open in IMG/M
3300032728|Ga0314696_10474528All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae645Open in IMG/M
3300032734|Ga0314706_10420544All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae646Open in IMG/M
3300032745|Ga0314704_10615753All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae591Open in IMG/M
3300032746|Ga0314701_10462963All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae571Open in IMG/M
3300033572|Ga0307390_10934161All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae549Open in IMG/M
3300033984|Ga0334989_0402971All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae703Open in IMG/M
3300033984|Ga0334989_0474833All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae627Open in IMG/M
3300034022|Ga0335005_0294831All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae966Open in IMG/M
3300034355|Ga0335039_0394754All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae711Open in IMG/M
3300034355|Ga0335039_0415524All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae688Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine18.31%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine12.68%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater7.04%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous7.04%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater4.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.93%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake4.23%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine4.23%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine4.23%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater3.52%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake2.82%
Wastewater EffluentEngineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent2.82%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated2.11%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine2.11%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater1.41%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.41%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater1.41%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.41%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater1.41%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water1.41%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh1.41%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.41%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.70%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.70%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake0.70%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.70%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater0.70%
Pond Fresh WaterEnvironmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water0.70%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.70%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.70%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.70%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.70%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water0.70%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300004686Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Oct08 (version 2)EnvironmentalOpen in IMG/M
3300004687Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Jul08 (version 2)EnvironmentalOpen in IMG/M
3300004769Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004777Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Jul07EnvironmentalOpen in IMG/M
3300004790Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300005987Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 B DNAEngineeredOpen in IMG/M
3300005988Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 C2 DNAEngineeredOpen in IMG/M
3300006037Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNAEnvironmentalOpen in IMG/M
3300006107Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE23Oct07EnvironmentalOpen in IMG/M
3300006357Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006394Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006415Algae and Fungi communities from freshwater lake (pre-blooming) in Auvergne, France - collected by filtering lake water, a 'reference genome' of the lake communityEnvironmentalOpen in IMG/M
3300006641Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300007516Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01EnvironmentalOpen in IMG/M
3300007561Estuarine microbial communities from the Columbia River estuary - metaG 1561A-3EnvironmentalOpen in IMG/M
3300007649Estuarine microbial communities from the Columbia River estuary - metaG 1560A-3EnvironmentalOpen in IMG/M
3300007667Estuarine microbial communities from the Columbia River estuary - metaG 1558A-3EnvironmentalOpen in IMG/M
3300007864Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461B_3.0umEnvironmentalOpen in IMG/M
3300007972Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0umEnvironmentalOpen in IMG/M
3300008999Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545EnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009159Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaGEnvironmentalOpen in IMG/M
3300009172Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154EnvironmentalOpen in IMG/M
3300009263Eukaryotic communities of water from the North Atlantic ocean - ACM27EnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009433Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330EnvironmentalOpen in IMG/M
3300009434Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009526Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90EnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009608Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010388Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV, may 2015EnvironmentalOpen in IMG/M
3300012408Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA23.A_192.20151118 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012414Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA16.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012716Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES130 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012782Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA30.ICE_1m.20151125 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012968Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013087Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30LEnvironmentalOpen in IMG/M
3300013295northern Canada Lakes metatranscriptome co-assemblyEnvironmentalOpen in IMG/M
3300016726Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011504BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017238Metatranscriptome of marine eukaryotic communities from unknown location in Brackish water medium, at 19 C, 5 psu salinity and 389 ?mol photons light - Pseudokeronopsis sp. Brazil (MMETSP1396)Host-AssociatedOpen in IMG/M
3300017262Metatranscriptome of marine eukaryotic communities from Tyrrhenian Sea in autoclaved artificial seawater, 19 C, 33 psu salinity and 291 ?mol photons light - Pseudokeronopsis sp. OXSARD2 (MMETSP0211)Host-AssociatedOpen in IMG/M
3300017299Metatranscriptome of marine eukaryotic communities from northern Puget Sound, Washington in Ciliate medium, 15 C, 30 psu salinity and 405 ?mol photons light - Strombidinopsis acuminata SPMC142 (MMETSP0126)Host-AssociatedOpen in IMG/M
3300018420Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018692Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153)EnvironmentalOpen in IMG/M
3300018831Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001386 (ERX1789378-ERR1719149)EnvironmentalOpen in IMG/M
3300018846Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001299 (ERX1789404-ERR1719503)EnvironmentalOpen in IMG/M
3300018873Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001098EnvironmentalOpen in IMG/M
3300018899Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001029 (ERX1809754-ERR1740133)EnvironmentalOpen in IMG/M
3300018974Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000809 (ERX1782160-ERR1711971)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300019021Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)EnvironmentalOpen in IMG/M
3300019031Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782386-ERR1711939)EnvironmentalOpen in IMG/M
3300019033Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000067 (ERX1782334-ERR1712080)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019050Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782371-ERR1711865)EnvironmentalOpen in IMG/M
3300019054Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001590 (ERX1782183-ERR1711964)EnvironmentalOpen in IMG/M
3300019151Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000705 (ERX1789682-ERR1719501)EnvironmentalOpen in IMG/M
3300019153Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001019 (ERX1789708-ERR1719469)EnvironmentalOpen in IMG/M
3300019201Estuarine microbial communities from the Columbia River estuary - R6.10AS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020074Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200mEnvironmentalOpen in IMG/M
3300020084Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200mEnvironmentalOpen in IMG/M
3300020183Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surfaceEnvironmentalOpen in IMG/M
3300021108Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnionEnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021353Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021376Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surfaceEnvironmentalOpen in IMG/M
3300021424Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015009 Mahale N1 surfaceEnvironmentalOpen in IMG/M
3300021874Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S32 C1 B24 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300022374Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1166 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025388Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE31Jul07 (SPAdes)EnvironmentalOpen in IMG/M
3300025451Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025809Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 (SPAdes)EnvironmentalOpen in IMG/M
3300025848Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025881Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 (SPAdes)EnvironmentalOpen in IMG/M
3300025890Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes)EnvironmentalOpen in IMG/M
3300026449Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 56R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027781Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 C2 DNA (SPAdes)EngineeredOpen in IMG/M
3300027883Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027885Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029910III_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030532Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO410-VDE108SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030548Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR016SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030564Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR020S0 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030602Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR018SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030653Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-29 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030670Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030671Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-34 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030709Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-17 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030740Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assemblyEnvironmentalOpen in IMG/M
3300030741Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assemblyEnvironmentalOpen in IMG/M
3300030909Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Mineral N2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031036Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_X_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031522Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300031602Marine microbial communities from Ellis Fjord, Antarctic Ocean - #260EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031735Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031784Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112EnvironmentalOpen in IMG/M
3300032150Metatranscriptome of sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SB 2018 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300032462Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (spades assembly)EnvironmentalOpen in IMG/M
3300032470Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032481Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032519Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032521Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032711Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032728Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032734Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb9_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032745Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032746Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_28May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033572Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033984Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Mar2001-rr0030EnvironmentalOpen in IMG/M
3300034022Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058EnvironmentalOpen in IMG/M
3300034355Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Oct2015-rr0135EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
B570J40625_10112065513300002835FreshwaterMIYANRVTKEMYLFDKTGEWHDEGVYHESLSMDKTYNETHWYDEFSVHNF*
Ga0065173_110236013300004686FreshwaterMIYANHVTKEMYLFDKGGEWKDEGVYHESLNMENTYNETNWYDEFMANNF*
Ga0065174_105889513300004687FreshwaterMIYANHVTKEMYLFDKGGEWKDEGVYHESLNMENTFNETNWY
Ga0007748_1002090813300004769Freshwater LakeMIYANHVTKEMFVFDKNGQWNDQGINHKSLSMDATYNETNWYDEFSANNF*
Ga0007827_1010487423300004777FreshwaterMIYANHVTKEMYLFDKGGEWKDEGVYHESLNMENTFNETNWYDEFMANNF*
Ga0007758_1109507713300004790Freshwater LakeMIYANRNTREMYVFDKDGEWNDDGVYHEGLSMDKTYNETNWYDEFSVHNF*
Ga0078894_1124357523300005662Freshwater LakeMIYANHVTKEMFVFDKNGQWNDQGINHKSLSMDATYNETNWYDEFSANNF*FFTGV
Ga0078894_1152921023300005662Freshwater LakeMIYANRVTKEMYLFDKTGEWHDEGVYHESLSMDKTYNETHWY
Ga0075158_1056524213300005987Wastewater EffluentMVYANYLTKEMFLFDKNGEWKDEGIYHEALSMEKTFHETNWYDEFYAHNF*
Ga0075160_1036535213300005988Wastewater EffluentMIYANYITKEMFVFDKSGEWKDEGVYHEALSMEKTFHETNWYDEFYAHNF*
Ga0075465_1008185413300006037AqueousMIYANRNTKEMYVFDKDGEWNDDGVYHEGLSMDKTYNETNWYDEFSVHNF*
Ga0075465_1008736513300006037AqueousMYLFDKQGEWLDEGLNHEGLSLEKTYEESRWYDEFSVHNF*
Ga0007836_111434913300006107FreshwaterMIYANHVTKEMYLFDKGGEWKDEGVYHESLNMENT
Ga0075502_165619213300006357AqueousMIYANMNSKEMYVFDKEGQWHDEGVDHEKLSMDKTYNETNWYDEFNVHNF*
Ga0075492_111999913300006394AqueousMIYANRITKEMYVFDKEGEWNDEGVYHDKLSMDKTYNETNWYDEFSVHNF*
Ga0075492_131825713300006394AqueousMIYANSQTKEMYVFDKEGEWHDEGVYHENLNMDNTYNETQWYDEFNPHNFM*
Ga0099654_1056270213300006415LakeMIYANRITKEMYVFDKDGEWRDDGVYHESLSMDKTFNETNWYDEFSV
Ga0075471_1057962923300006641AqueousMIYADANTKGMYLFDKDGEWHDEGVYHEALSMDKTYNETMWYDEFNPHNFT*
Ga0105050_1047054813300007516FreshwaterMIYANHVTKEMYVFDKEGQWNDQGINHPALSMDATFSETNWYDEFSAHSF*
Ga0102914_114258313300007561EstuarineMIYANRITKEMYVFDKDGEWKDDGVYHEALSMDKTFNETNWYDEFSVHNL*
Ga0102912_110778013300007649EstuarineMIYANHVTKEMFVFDKSGQWNDEGINHKALSLESTYNETDWYDEFSAHSF*
Ga0102910_107717213300007667EstuarineMIYANQTSKEMYVFDKAGEWKDEGVYHKALDMENTFSETNWYDEFNVQSF*
Ga0105749_109343933300007864Estuary WaterMVYANRQTKEMFLFDKNGEWNDDGVYHEALSMDKTYNETNWYDEF
Ga0105745_115626713300007972Estuary WaterMIYANRNTKEMYVFDKDGEWNDDGVYHEGLSMDKTYNETNWYEEFSVHNF*
Ga0102816_117036733300008999EstuarineMVYANRQTKEMFLFDKNGEWNDDGVYHEALSMDKTYNETNWYDEFSAPNL*
Ga0115566_1041556223300009071Pelagic MarineMYVFDKEGTWEDEGVYHEALGMDNTYNETNWYDEFNPQSF*
Ga0115566_1046027123300009071Pelagic MarineMYVFDKYGEWKDEGVYHKALDMENTFSETNWYDEFNVQSF*
Ga0114978_1049366513300009159Freshwater LakeMVYANRITKEMYLFDKDGEWNDEGVYHDALGMDKTYNETNWYDEFSVHNF*
Ga0114978_1051490413300009159Freshwater LakeMIYANRNTKEMYVFDKHGEWNDDGVYHEGLSMDKTYNETNWYDEFSVHNF*
Ga0114995_1031170623300009172MarineMIYANHVTKEMFLFDKGGEWKDEGVYHEAVNMENTFNETNWYDEFNV*
Ga0103872_107200113300009263Surface Ocean WaterMFLFDKGGEWKDEGVYHKALDMESTYKETDWYDEFNVQSF*
Ga0115005_1088083523300009432MarineMIYAHIITKDMYVFDKMGNWHDEGVMHDALSLETTYNETDWYDEFSVHNF*TLSIIYLKLLLYKL
Ga0115545_118434123300009433Pelagic MarineMVYAHIITKDMYVFDKMGNWHDEGVYHDALNLDNTYNETDWYDEFSVHNF*
Ga0115562_118047113300009434Pelagic MarineMYVFDKSGEWKDEGVYHKALDMENTFSETNWYDEFNVQSF*
Ga0115008_1050060613300009436MarineMIYANHITKEMYVFDKTGEWNDEGVYHDALNLDSTFKETDWYDEFNP*
Ga0115004_1040049213300009526MarineMIYANHLTKEMYVFDKAGEWNDEGIYHECLNMENTFNETSWYDEFCAQNF*KLQINAFYLNNKS*
Ga0115099_1049870713300009543MarineMIYANHVTKEMFVFDKGGEWKDEGVYHEAVNMENTFNETNWYDEFNV*
Ga0115103_132186913300009599MarineMIYAHIITKDMFLFDKMGNWHDEGVYHEALNLDNTYNETDWYDEFSVHNF*
Ga0115103_132273733300009599MarineMYLFDKSGSWNDEGVYHKALDMENTFNETNWYDEFNPHNF*
Ga0115103_186152113300009599MarineMIYAHIITKDMYLFDKMGNWHDEGVMHDALSLETTYNETDWYDEF
Ga0115102_1037070113300009606MarineMIYAHIITKDMYVFDKMGNWHDEGVMHDALSLETTYNETDWYDEFS
Ga0115100_1075610913300009608MarineMIYAHIITKDMYLFDKMGNWHDEGVMHDALSLETTYNETDWYDEFSVHNF*
Ga0136551_104446613300010388Pond Fresh WaterMIYANHVTKEMFVFDKNGQWNDQGINHKSLSMDATYNETNWYDEFSANNF*KG*
Ga0138265_133508313300012408Polar MarineMIYAHIITKDMYLFDKMGNWHDEGVYHEALNLDATYNETDWYDEFSVHNF*
Ga0138264_114806423300012414Polar MarineMFLFDKSGTWNDDGVYHKALDMEHTFNETNWYDEFNPHNF*KTVNFRVHFYLNFMP
Ga0157605_112888113300012716FreshwaterMIYANRITKEMYVFDKDGEWKDDGVYHEALSMEKTFNE
Ga0138268_125388123300012782Polar MarineMIYGHINSKEMYVFDKEGEWKDEGVYHEALNMENTYNETNWYDEWIGNAFH*
Ga0129337_132046523300012968AqueousMIYANRITKSMYLFDKDGEWVDEGVYSDVLGLDKTYNEARWYDEFNVQSFM*
Ga0163212_117905713300013087FreshwaterMVYANRITKEMYLFDKDGEWHDDGIYHDALSMDKTYNETNWYDEFSVHNF*CTVSI
Ga0170791_1353369823300013295FreshwaterMYVFDKTGEWHDEGVYHEALSMDKTYNETNWYDEFSVHNF*
Ga0182045_104938923300016726Salt MarshMVYANRQTKEMFLFDKSGEWFDEGVYHESLSMDKTYNETNWYDEFSVHNFXKPSLSLFK
Ga0186197_11615113300017238Host-AssociatedMIYANYINKDMYVFDKYGQWHDEGVYHDALSLEKTYDEKNWYDEFDPTHF
Ga0186220_11639513300017262Host-AssociatedMIYANYITKEMYVFDKEGEWHDEGIYHDALSLDKTFSEKNWYDEFSPSHFXPFQLLFKS
Ga0186338_102686723300017299Host-AssociatedMIYANMNSKEMYVFDKEGQWHDEGIDHEALSMEKTYNETNWYDEFNVHNF
Ga0181563_1045775423300018420Salt MarshMVYANRQTKEMFLFDKSGEWFDEGVYHESLSMDKTYNETNWYDEFSVHNFXKPSLSLFKHKYTHSIQGFWGFG
Ga0192944_105295213300018692MarineMYLFDKSGEWKDEGVYHKALDMENTFSETNWYDEFNVQSF
Ga0192949_109098113300018831MarineMIYANQLTKEMYLFDKSGTWNDEGIYHESLNMENTFHETSWYDEFNPSHF
Ga0193253_110859213300018846MarineMIYANHVTKEMFVFDKGGEWKDEGVYHEAVNMENTFNETNWYDEFNV
Ga0193553_116019113300018873MarineMIYAHKATKEMYLFDKDGEWNDEGVYHDALSMEKTYNETDWYDEFSVHNFXLSRQTSQ
Ga0193090_111180413300018899MarineMVYASQNTKAMYLFDKAGQWNDDGVYHKALDMESTFNETNWYDEFNPHNFXKKEN
Ga0193090_111313813300018899MarineMVYAHIITKDMYLFDKMGNWHDEGVYHEALNLDNTYNETDWYDEFSVHNF
Ga0192873_1042773523300018974MarineMVYAHKTTKEMYLFDKEGEWHDDGVNHDVLSMDQRYKETDWYDEFNVHNF
Ga0192961_1015899333300018980MarineMIYANHVTKEMFLFDKGGEWKDEGVYHEAVNMENTFNETNWYDEFNV
Ga0192982_1021111823300019021MarineMVYASQNTKAMYLFDKAGQWNDDGVYHKALDMESTFNETNWYDEFNPHNF
Ga0192982_1034854413300019021MarineMIYANHVTKEMYLFDKGGEWKDEGVYHEAVNMENTFNETNWYDEFNV
Ga0193516_1024139023300019031MarineMVYANQITKEMFLFDKGGEWHDDVSYHEALNMDNTYSETNWYDEFTVNSFXKTNM
Ga0193037_1026763413300019033MarineMIYAHKNTKSMYLFDKNGEWHDDGVYHEALNLDNTYNETNWFDE
Ga0192945_1020807313300019036MarineMIYANHVTKEMFLFDKGGEWKDEGVYHEAVNMENTFNETNWYD
Ga0192945_1028703313300019036MarineMVYASQNTKAMYLFDKAGQWNDDGVYHKALDMESTFNETNWYDEFNPHNFXKNEDM
Ga0192981_1026470913300019048MarineMIYAHVNTKDMFLFDKMGNWHDEGVYHDALNLDNTYNETDWYDEFSVHNF
Ga0192981_1028830013300019048MarineMVYAHIITKDMYLFDKMGNWHDEGVYHEALNLDNTYNETDWYDEFSVH
Ga0192966_1028630613300019050MarineMYVFDKEGEWKDEGVYHKALDMDSTFNETNWYDEFNP
Ga0192992_1019505613300019054MarineMKQHNCLDLDMIYANMNTKEMYLFDKGGEWHDDGVYHEALNMDNTFSETNWYDEFNV
Ga0192888_1019049613300019151MarineMIYAHKATKEMFFFDKEGEWNDDGVYHEALSMDKTYNETDWYDEFNAHNFXSKEP
Ga0192975_1016060313300019153MarineMIYANANTKEMYLFDKDGEWHDEGIYHDALNMDATYNETRWYDDFNPHNFM
Ga0180032_101317913300019201EstuarineMIYANRNTKEMYVFDKDGEWNDDGVYHEGLSMDKTYNETNWYDEFSVHNF
Ga0194113_1082554713300020074Freshwater LakeMVYANRITKEMYLFDKDGEWHDDGIYHDALSMDKTYNETNWYDEFSVHNFXRTVSI
Ga0194110_1057051413300020084Freshwater LakeMVYANRITKEMYLFDKDGEWHDDGIYHDALSMDKTYNETNWYDEFSVHNF
Ga0194115_1030742623300020183Freshwater LakeMIYANRVTKEMYLFDKTGEWHDDGVYHESLSMDKTYNETHWYDEFSVHNF
Ga0194115_1032528013300020183Freshwater LakeMIYANRNTKEMYLFDKDGEWHDDGVYHEGLSMDKTYNETNWYDEFSVHNF
Ga0214162_104395823300021108FreshwaterMVYANRITKEMYVFDKDGEWHDEGVYHEALSMDKTYNETNWYDEFSVHNF
Ga0206692_138432323300021350SeawaterMIYAHIITKDMYLFDKMGNWHDEGVMHDALSLETTYNETDWYDEFSVHNF
Ga0206693_173343813300021353SeawaterMIYAHKNTKEIYMFDKGGEWNDDGVYHDALSVDKTYNE
Ga0194130_1038516413300021376Freshwater LakeMIYANRITKSMYLFDKDGEWVDEGVYSEALGLDKTYDEARWYDEFNVHSFM
Ga0194117_1036732013300021424Freshwater LakeMIYANRNTKEMYLFDKDGEWHDDGVYHEGLSMEKTYNETNWYDEFSVHNFXTFLFKQLI
Ga0063147_12534733300021874MarineMIYANHVTKEMFLFDKGGEWKDEGVYHEAVNMENTFNE
Ga0210311_102979413300022374EstuarineMVYANRQTKEMFLFDKNGEWNDDGVYHEALSMDKTYNETNWYDEFSAPNL
Ga0208503_102192013300025388FreshwaterMIYANHVTKEMYLFDKGGEWKDEGVYHESLNMENTFNETNWYDEFMANNF
Ga0208426_104439433300025451AqueousMYLFDKQGEWLDEGLNHEGLSLEKTYEESRWYDEFSVHNF
Ga0209199_117658613300025809Pelagic MarineMYVFDKSGEWKDEGVYHKALDMENTFSETNWYDEFNVQSF
Ga0208005_109943413300025848AqueousMIYADANTKGMYLFDKDGEWHDEGVYHEALSMDKTYNETMWYDEFNPHNFT
Ga0208005_112141723300025848AqueousMIYADRITKTMYFFDKEGEWVDDGVYCDALSLEKTYNELYWYDEFNVHNFSG
Ga0209309_1036643323300025881Pelagic MarineMYIFDKEGTWEDEGVYHEALGMDNTYNETNWYDEFNPQSF
Ga0209631_1029972023300025890Pelagic MarineMIYASQQTKAMFLFDKSGTWNDEGVYHKSLDMEHTFNETNWYDEFNPHNF
Ga0247593_111708813300026449SeawaterMYLFDKSGSWNDEGVYHKSLDMENTFNETNWYDEFN
Ga0209175_1031217613300027781Wastewater EffluentMIYANYITKEMFVFDKSGEWKDEGVYHEALSMEKTFHETNWYDEFYAHNF
Ga0209175_1031460813300027781Wastewater EffluentMVYANYLTKEMFLFDKNGEWKDEGIYHEALSMEKTFHETNWYDEFYAHNF
Ga0209713_1044233113300027883MarineMVYANSNTKEMFLFDKDGEWHDEGIYHEALNMENTFNETQWYDEFNPHNFM
Ga0209713_1097143413300027883MarineMIYAHIITKDMYVFDKMGNWHDEGVMHDALSLETTYNETDWYDEFSVHNF
Ga0209450_1066175123300027885Freshwater Lake SedimentMVYANRITKEMYVFDKDGEWHDEGVYHDALSMDKTYNETNWYDEFSVHNF
Ga0256412_128524513300028137SeawaterMYVFDKEGTWEDEGVYHEALGMDNTYNETNWYDEFNPQSF
Ga0311369_1063697423300029910PalsaMFLFDKKGEWNDEGTFHDALSMDKTFNETDWYDEFNVHNF
Ga0210290_148943213300030532SoilMIYANYITKEMFVFDKNGEWHNEGVDHESLSVDKIYNETNWYDEFSAHNF
Ga0210252_1074541413300030548SoilMIYANYITKEMFVFDKNGEWHNEGVDHESLSVDKIYNETNWYDEFSAHNFXVIFRL
Ga0210256_1104276823300030564SoilMIYANSITKEMFVFDKNGEWHDEGVDHESLSVDKVYNETNWYDEFSAHNFXVFFRLAILI
Ga0210254_1052536813300030602SoilMIYANYITKEMFVFDKNGEWHNEGVDHESLSVDKIYNETNWYDEFSAHNFXVIFRLAILI
Ga0307402_1063645213300030653MarineMFLFDKSGTWNDDGVYHKALDMEHTFNETNWYDEFNPHNFXKTVNFRV
Ga0307401_1040206323300030670MarineMIYANKTTKEMYLFDKDGEWNDDGIYHDALDMENTFNETDWYDEFSVHNF
Ga0307401_1044107823300030670MarineMYLFDKAGEWNDEGIYHESLNMDNTFHETSWYDEFN
Ga0307403_1049241513300030671MarineMYLFDKTGEWHEDGVYHEKLNMENTYNETNWYDEFSVHNF
Ga0307403_1070006223300030671MarineMYLFDKAGSWNDDGVYHKSLDMENTFNETNWYDEFNP
Ga0307400_1071036823300030709MarineMIYANQLTKEMYLFDKAGEWNDEGIYHKSLNMDNTFHETSWYDEFN
Ga0265460_1166123323300030740SoilMIYANYITKEMFVFDKKNGEWHNEGVDHESLSVDKIYNETNWYDEFSAHNFXVIFRLAILII
Ga0265459_1311071813300030741SoilMIYANSITKEMFVFDKNGEWHDEGVDHESLSVDKVYNETNWYDEFSAHNF
Ga0074033_1046137413300030909SoilMIYANHVTKEMYVFDKYGEWVDEGVYHEALSVDKTYTETDWYDEF
Ga0073978_162879513300031036MarineMVYAHINSKDMYLFDKTGTWHDEGVYHDVLSLDNTYNETNWYDEFSVHNF
Ga0170820_1479220213300031446Forest SoilMIYANQVSKEMYVFDKYGEWIDDGVYHEALSLDKTFNETDWYDEF
Ga0170818_10168170013300031474Forest SoilMIYANYVTKDMYVFDKEGEWHDDGIYHDALSLDKTYKETNWYDEFNVHNFXTLAFLFKFTFN
Ga0307388_1073669323300031522MarineMVYANHITKEMYVFDKTGEWNDDGVYHDVLSMENTFKETDWYDEFNPQSF
Ga0307489_1046510013300031569Sackhole BrineMFLFDKGGEWKDEGVYHKALDMDATFKETDWYDEFNPQSFI
Ga0307993_109682123300031602MarineMIYAHIITKDMYVFDKMGNWHDEGVMHDALSLETTYNETDWYDEFSVHNFXTLSIIYLKLLLYKLHGVLGFW
Ga0307391_1064348213300031729MarineMIYANRVTKEMYLVEKTGKWDDAGVEHEALSLEKTYNEKHWYD
Ga0307394_1032567513300031735MarineMVYAHLNTKEMYVFDKTGEWHDEGVYHEALSLENTYNETNWFDEFSVHNMXCTHLFN
Ga0315899_1162589123300031784FreshwaterMIYANRITKSMYLFDKDGEWVDEGVYSDVLGLDKTYNEARWYDEFNVQSFM
Ga0314779_102469313300032150SedimentMYFFDKSGEWKDEGVYHKALNMDATFKETDWYDEFNVQSF
Ga0335396_1050965913300032462FreshwaterMIYANHVTKEMYVFDKEGQWNDQGINHPALSMDATFSETNWYDEFSAHSF
Ga0314670_1044914013300032470SeawaterMYVFDKEGSWEDEGVYSKALDMENTYNETNWYDEFNV
Ga0314668_1039146823300032481SeawaterMIYANQMTKEMYVFDKEGEWHDEGIYHEALNMDNTFHETSWYDEFNPQHFSXKF
Ga0314676_1057491213300032519SeawaterMIYANQMTKEMYVFDKEGEWHDEGIYHEALNMDNTFHETSWYDEFNPQHFS
Ga0314680_1081646913300032521SeawaterMYVFDKEGSWEDEGVYSNALDMENTYNETNWYDEF
Ga0314681_1059878323300032711SeawaterMIYAHIITKDMYVFDKMGNWHDEGVMHDALSLETTYNETDWYDEFSVHNFXTLSIIYLK
Ga0314681_1069420513300032711SeawaterMVYAHIITKDMYLFDKMGNWHDEGVYHDTLNLDKTYNETDWY
Ga0314696_1047452813300032728SeawaterMIYANQMTKEMYVFDKEGEWHDEGIYHEALNMDNTFHETSWYDEFN
Ga0314706_1042054413300032734SeawaterMIYANQMTKEMYVFDKEGEWHDEGIYHEALNMDNTFHETSWYDEFNPQ
Ga0314704_1061575333300032745SeawaterMYLFDKSGSWNDEGVYHKALDMENTFNETNWYDEFNP
Ga0314701_1046296333300032746SeawaterMYLFDKSGSWNDEGVYHKALDMENTFNETNWYDEFNPHNFXKKQF
Ga0307390_1093416123300033572MarineMIYAHKTTKEMYVFDKDGEWNDEGVYHDALSLDKTYNE
Ga0334989_0402971_67_2193300033984FreshwaterMIYANRNTREMYVFDKDGEWNDDGVYHEGLSMDKTYNETNWYDEFSVHNF
Ga0334989_0474833_410_5623300033984FreshwaterMIYANRITKEMYVFDKDGEWHDEGVYHDALSMDKTYNETNWYDEFSVHNF
Ga0335005_0294831_157_2793300034022FreshwaterMYLFDKEGKWLDEGVYHKALNMDNTFNETNWYDEFNVQSF
Ga0335039_0394754_61_2133300034355FreshwaterMIYANRITKEMYLFDKDGEWNDEGVYHDALSMDKTYNETNWYDEFSVHNF
Ga0335039_0415524_93_2453300034355FreshwaterMIYANHVTKEMYLFDKGGEWKDEGVYHESLNMENTFVETNWYDEFNPNCF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.