| Basic Information | |
|---|---|
| Family ID | F052268 |
| Family Type | Metagenome |
| Number of Sequences | 143 |
| Average Sequence Length | 48 residues |
| Representative Sequence | SGDPEARAYPGLPGLWAGVPYDFVAGGAGLQIPGLPDEVVGCLSAT |
| Number of Associated Samples | 128 |
| Number of Associated Scaffolds | 143 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.91 % |
| % of genes near scaffold ends (potentially truncated) | 75.52 % |
| % of genes from short scaffolds (< 2000 bps) | 69.23 % |
| Associated GOLD sequencing projects | 123 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (51.748 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (20.280 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.573 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (30.070 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 10.81% β-sheet: 10.81% Coil/Unstructured: 78.38% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 143 Family Scaffolds |
|---|---|---|
| PF00480 | ROK | 30.07 |
| PF00441 | Acyl-CoA_dh_1 | 18.18 |
| PF06271 | RDD | 7.69 |
| PF02771 | Acyl-CoA_dh_N | 2.80 |
| PF02770 | Acyl-CoA_dh_M | 2.10 |
| PF13416 | SBP_bac_8 | 1.40 |
| PF01909 | NTP_transf_2 | 1.40 |
| PF13649 | Methyltransf_25 | 0.70 |
| PF01740 | STAS | 0.70 |
| PF01425 | Amidase | 0.70 |
| PF03807 | F420_oxidored | 0.70 |
| PF10518 | TAT_signal | 0.70 |
| PF00211 | Guanylate_cyc | 0.70 |
| PF04185 | Phosphoesterase | 0.70 |
| PF01979 | Amidohydro_1 | 0.70 |
| PF00133 | tRNA-synt_1 | 0.70 |
| PF08386 | Abhydrolase_4 | 0.70 |
| PF13478 | XdhC_C | 0.70 |
| COG ID | Name | Functional Category | % Frequency in 143 Family Scaffolds |
|---|---|---|---|
| COG1940 | Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain | Transcription [K] | 60.14 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 23.08 |
| COG1714 | Uncharacterized membrane protein YckC, RDD family | Function unknown [S] | 7.69 |
| COG0060 | Isoleucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.70 |
| COG0143 | Methionyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.70 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.70 |
| COG0495 | Leucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.70 |
| COG0525 | Valyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.70 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.70 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.70 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 51.75 % |
| Unclassified | root | N/A | 48.25 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352031|2206182271 | Not Available | 521 | Open in IMG/M |
| 3300001431|F14TB_100194496 | Not Available | 1204 | Open in IMG/M |
| 3300003993|Ga0055468_10001649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2965 | Open in IMG/M |
| 3300004643|Ga0062591_100929016 | Not Available | 819 | Open in IMG/M |
| 3300005093|Ga0062594_101856723 | Not Available | 637 | Open in IMG/M |
| 3300005356|Ga0070674_100750436 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300005438|Ga0070701_10779647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 650 | Open in IMG/M |
| 3300005558|Ga0066698_10355609 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1011 | Open in IMG/M |
| 3300005843|Ga0068860_102682665 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 517 | Open in IMG/M |
| 3300005937|Ga0081455_10697649 | Not Available | 647 | Open in IMG/M |
| 3300006049|Ga0075417_10008387 | All Organisms → cellular organisms → Bacteria | 3714 | Open in IMG/M |
| 3300006844|Ga0075428_100150881 | All Organisms → cellular organisms → Bacteria | 2525 | Open in IMG/M |
| 3300006844|Ga0075428_102397691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 542 | Open in IMG/M |
| 3300006845|Ga0075421_100574457 | Not Available | 1329 | Open in IMG/M |
| 3300006847|Ga0075431_102186274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 508 | Open in IMG/M |
| 3300007790|Ga0105679_10116262 | All Organisms → cellular organisms → Bacteria | 1383 | Open in IMG/M |
| 3300009081|Ga0105098_10090314 | Not Available | 1309 | Open in IMG/M |
| 3300009147|Ga0114129_10396755 | All Organisms → cellular organisms → Bacteria | 1819 | Open in IMG/M |
| 3300009147|Ga0114129_10406507 | All Organisms → cellular organisms → Bacteria | 1793 | Open in IMG/M |
| 3300009157|Ga0105092_10144349 | Not Available | 1320 | Open in IMG/M |
| 3300009166|Ga0105100_10974162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 531 | Open in IMG/M |
| 3300009167|Ga0113563_12681825 | Not Available | 603 | Open in IMG/M |
| 3300009167|Ga0113563_12709269 | Not Available | 600 | Open in IMG/M |
| 3300009169|Ga0105097_10849184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 522 | Open in IMG/M |
| 3300009821|Ga0105064_1008009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1836 | Open in IMG/M |
| 3300010038|Ga0126315_10167464 | Not Available | 1309 | Open in IMG/M |
| 3300010042|Ga0126314_10485841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 895 | Open in IMG/M |
| 3300010166|Ga0126306_11173786 | Not Available | 630 | Open in IMG/M |
| 3300010304|Ga0134088_10707293 | Not Available | 506 | Open in IMG/M |
| 3300011119|Ga0105246_10514305 | Not Available | 1019 | Open in IMG/M |
| 3300011266|Ga0151622_1077689 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300011267|Ga0151621_1213650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 621 | Open in IMG/M |
| 3300012353|Ga0137367_10868433 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 623 | Open in IMG/M |
| 3300012353|Ga0137367_10871969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 621 | Open in IMG/M |
| 3300012354|Ga0137366_10862009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 640 | Open in IMG/M |
| 3300012358|Ga0137368_10479303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 805 | Open in IMG/M |
| 3300012358|Ga0137368_10693039 | Not Available | 641 | Open in IMG/M |
| 3300012532|Ga0137373_10023367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6138 | Open in IMG/M |
| 3300014326|Ga0157380_11695621 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 689 | Open in IMG/M |
| 3300014829|Ga0120104_1115307 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300015251|Ga0180070_1027586 | Not Available | 709 | Open in IMG/M |
| 3300018000|Ga0184604_10344095 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300018032|Ga0187788_10141589 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
| 3300018056|Ga0184623_10151359 | Not Available | 1072 | Open in IMG/M |
| 3300018077|Ga0184633_10164017 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1152 | Open in IMG/M |
| 3300018078|Ga0184612_10130926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1313 | Open in IMG/M |
| 3300018079|Ga0184627_10240218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 955 | Open in IMG/M |
| 3300018082|Ga0184639_10037971 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2471 | Open in IMG/M |
| 3300018429|Ga0190272_10287756 | All Organisms → cellular organisms → Bacteria | 1263 | Open in IMG/M |
| 3300018465|Ga0190269_10569811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 756 | Open in IMG/M |
| 3300018465|Ga0190269_12000349 | Not Available | 504 | Open in IMG/M |
| 3300018466|Ga0190268_11786107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 553 | Open in IMG/M |
| 3300018466|Ga0190268_11988969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 534 | Open in IMG/M |
| 3300018476|Ga0190274_11183844 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300018920|Ga0190273_11943660 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 542 | Open in IMG/M |
| 3300021073|Ga0210378_10298100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 606 | Open in IMG/M |
| 3300021080|Ga0210382_10371801 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 632 | Open in IMG/M |
| 3300025174|Ga0209324_10424621 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 825 | Open in IMG/M |
| 3300025313|Ga0209431_10090132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2407 | Open in IMG/M |
| 3300025322|Ga0209641_10110519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2099 | Open in IMG/M |
| 3300025925|Ga0207650_10201572 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1594 | Open in IMG/M |
| 3300025937|Ga0207669_10939191 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300025941|Ga0207711_11489839 | Not Available | 620 | Open in IMG/M |
| 3300026033|Ga0208652_1017212 | Not Available | 856 | Open in IMG/M |
| 3300026062|Ga0208654_1009997 | All Organisms → cellular organisms → Bacteria | 1196 | Open in IMG/M |
| 3300026067|Ga0207678_11290804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 646 | Open in IMG/M |
| 3300026452|Ga0256821_1034582 | Not Available | 571 | Open in IMG/M |
| 3300027379|Ga0209842_1061450 | Not Available | 669 | Open in IMG/M |
| 3300027450|Ga0207478_102892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 548 | Open in IMG/M |
| (restricted) 3300027799|Ga0233416_10232850 | Not Available | 633 | Open in IMG/M |
| 3300027880|Ga0209481_10055517 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1844 | Open in IMG/M |
| 3300027909|Ga0209382_10577541 | Not Available | 1227 | Open in IMG/M |
| 3300027964|Ga0256864_1244753 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| (restricted) 3300027995|Ga0233418_10136180 | Not Available | 770 | Open in IMG/M |
| 3300028590|Ga0247823_10911805 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 659 | Open in IMG/M |
| 3300028716|Ga0307311_10089182 | Not Available | 853 | Open in IMG/M |
| 3300028722|Ga0307319_10238082 | Not Available | 598 | Open in IMG/M |
| 3300028744|Ga0307318_10205866 | Not Available | 681 | Open in IMG/M |
| 3300028771|Ga0307320_10037232 | All Organisms → cellular organisms → Bacteria | 1781 | Open in IMG/M |
| 3300028771|Ga0307320_10101613 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1093 | Open in IMG/M |
| 3300028771|Ga0307320_10332100 | Not Available | 606 | Open in IMG/M |
| 3300028791|Ga0307290_10188171 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300028807|Ga0307305_10039571 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2165 | Open in IMG/M |
| 3300028811|Ga0307292_10354644 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300028814|Ga0307302_10546830 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 575 | Open in IMG/M |
| 3300028889|Ga0247827_10129782 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1310 | Open in IMG/M |
| 3300030006|Ga0299907_10604632 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
| 3300030620|Ga0302046_10063995 | All Organisms → cellular organisms → Bacteria | 2985 | Open in IMG/M |
| 3300030620|Ga0302046_10125244 | All Organisms → cellular organisms → Bacteria | 2102 | Open in IMG/M |
| 3300031170|Ga0307498_10247299 | Not Available | 645 | Open in IMG/M |
| 3300031228|Ga0299914_11125855 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 633 | Open in IMG/M |
| 3300031455|Ga0307505_10589363 | Not Available | 540 | Open in IMG/M |
| 3300031548|Ga0307408_100436126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1133 | Open in IMG/M |
| 3300031740|Ga0307468_102036518 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300031854|Ga0310904_10255049 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1089 | Open in IMG/M |
| 3300031862|Ga0315280_10486889 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 540 | Open in IMG/M |
| 3300031908|Ga0310900_11536770 | Not Available | 562 | Open in IMG/M |
| 3300031949|Ga0214473_10638823 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1169 | Open in IMG/M |
| 3300031965|Ga0326597_11402286 | Not Available | 677 | Open in IMG/M |
| 3300032000|Ga0310903_10196268 | Not Available | 942 | Open in IMG/M |
| 3300032179|Ga0310889_10222225 | Not Available | 883 | Open in IMG/M |
| 3300032770|Ga0335085_11626220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 668 | Open in IMG/M |
| 3300033485|Ga0316626_12062347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 517 | Open in IMG/M |
| 3300033521|Ga0316616_100746296 | Not Available | 1181 | Open in IMG/M |
| 3300033521|Ga0316616_103997962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 555 | Open in IMG/M |
| 3300033551|Ga0247830_11720654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 502 | Open in IMG/M |
| 3300033811|Ga0364924_005374 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2262 | Open in IMG/M |
| 3300033814|Ga0364930_0279308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 563 | Open in IMG/M |
| 3300034151|Ga0364935_0320936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 513 | Open in IMG/M |
| 3300034354|Ga0364943_0429390 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 513 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 20.28% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 9.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.90% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.20% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.20% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.80% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.80% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.80% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.80% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 2.80% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 2.80% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 2.10% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.10% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.10% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 2.10% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 2.10% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.10% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.40% |
| Sediment | Environmental → Aquatic → Freshwater → Groundwater → Acid Mine Drainage → Sediment | 1.40% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.40% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.40% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.40% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.40% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.40% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.40% |
| Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment | 0.70% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.70% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.70% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.70% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.70% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.70% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.70% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.70% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.70% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.70% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.70% |
| Speleothem And Rock Wall Surfaces | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Speleothem And Rock Wall Surfaces | 0.70% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.70% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.70% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.70% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.70% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.70% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.70% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908043 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active Layer A2 | Environmental | Open in IMG/M |
| 2199352031 | Cave microbial community (Speleothem B) | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300003993 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 | Environmental | Open in IMG/M |
| 3300004047 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D1 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005893 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_202 | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300007790 | Microbial communities of desert soil contaminated with blood from dead anthrax infected zebra in Etosha National Park, Namibia. Combined Assembly of 14 sequencing projects | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009166 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009801 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30 | Environmental | Open in IMG/M |
| 3300009821 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 | Environmental | Open in IMG/M |
| 3300009836 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011266 | Acid mine drainage microbial communities from Malanjkhand copper mine, India - M16 k-mer 55 | Environmental | Open in IMG/M |
| 3300011267 | Acid mine drainage microbial communities from Malanjkhand copper mine, India - M16 k-mer-51 | Environmental | Open in IMG/M |
| 3300011439 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT820_2 | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014829 | Permafrost microbial communities from Nunavut, Canada - A10_35cm_6M | Environmental | Open in IMG/M |
| 3300014965 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T2 | Environmental | Open in IMG/M |
| 3300015251 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT293_16_10D | Environmental | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300021972 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2m2 | Environmental | Open in IMG/M |
| 3300025155 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 4 | Environmental | Open in IMG/M |
| 3300025174 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 3 | Environmental | Open in IMG/M |
| 3300025313 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300025318 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1 | Environmental | Open in IMG/M |
| 3300025322 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025327 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025956 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026033 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLA_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026062 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026452 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 7-17 PU4 | Environmental | Open in IMG/M |
| 3300027379 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300027450 | Soil microbial communities from Kellog Biological Station, Michigan, USA - Nitrogen cycling UWRJ-G07K3-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027799 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0_MG | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027964 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 HiSeq | Environmental | Open in IMG/M |
| 3300027995 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_1_MG | Environmental | Open in IMG/M |
| 3300028590 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day30 | Environmental | Open in IMG/M |
| 3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
| 3300028754 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031228 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 | Environmental | Open in IMG/M |
| 3300031455 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_S | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031862 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_40 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300033417 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155 | Environmental | Open in IMG/M |
| 3300033485 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_A | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300033811 | Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17 | Environmental | Open in IMG/M |
| 3300033814 | Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17 | Environmental | Open in IMG/M |
| 3300034151 | Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17 | Environmental | Open in IMG/M |
| 3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| A2_c1_00950200 | 2124908043 | Soil | RSADWVWFQFNSGDIVRKRYPGLPGRWSGIAYEFVRGGAGLKIPGLPDEVSGCLAGT |
| 2207823027 | 2199352031 | Speleothem And Rock Wall Surfaces | KGYPGLPGTWRGMPYDFVRGGAGLAIPGLPAEVGGCLEGT |
| F14TB_1001944962 | 3300001431 | Soil | SGDPEARAYPGLPGLWAGVPYDFVAGGAGLQIPGLPDEVVGCLSAT* |
| Ga0055468_100016491 | 3300003993 | Natural And Restored Wetlands | GFQWDSADTEARAYPGLPGRWAGIPYDFVRGGAGLDIPGLPDEVRGCLGGT* |
| Ga0055499_100688592 | 3300004047 | Natural And Restored Wetlands | YRSPDWIGFQYDSADTERRLYEGLPGSWSGIAYDFVKGGAGLEIVGLPPDVVGCLSGT* |
| Ga0063356_1053643701 | 3300004463 | Arabidopsis Thaliana Rhizosphere | QPRLVSGLPGTWTGVDYDFVKGGEGLDLPGLPAAVVGCLRSTS* |
| Ga0062591_1009290161 | 3300004643 | Soil | FQFDSGDPEARVYPGLPGSWAGVPYDFVSGGAGLQIPGLPDEVVGCLSAS* |
| Ga0062594_1018567231 | 3300005093 | Soil | MPKLYPGLPGAWSGVRYDFVRGGAGLSIPGLPDEVTGCLDGT* |
| Ga0066809_102349081 | 3300005168 | Soil | PDWVGFQFDSGDPDARAYPGLPGLWSGVPYDFATGGAGLQIPGLPDEVVGCLSAT* |
| Ga0070689_1005384941 | 3300005340 | Switchgrass Rhizosphere | PDWVGFQFDSATIARKSYPGLPGRWSGIPYDFVRGGAGLKIPGLPDEVLGCLAGT* |
| Ga0070668_1017248022 | 3300005347 | Switchgrass Rhizosphere | YVPGLPGRWSGIEYDFVKGGEGLDLPGLPSTLAGCLNGT* |
| Ga0070674_1007504361 | 3300005356 | Miscanthus Rhizosphere | PKLYPGLPGAWSGVRYDFVRGGAGLSIPGLPDEVTGCLDGT* |
| Ga0070701_107796471 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | TEGFSSPDWSGFQYDSAKRMPKLYPGLPGAWSGVRYDFVRGGAGLSIPGLPDEVTGCLDGT* |
| Ga0070700_1006055133 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | SPDWVGFQFDSAHAAMKSYPGLPGQWSGTPYDFVRGGAGLKIPGLPDEVLGCLAGT* |
| Ga0066698_103556091 | 3300005558 | Soil | KAYPGLPGQWEGVPYDFVKGGGGLTIPGLPPDVAGCLNGT* |
| Ga0068859_1024451211 | 3300005617 | Switchgrass Rhizosphere | GFQFDSSHAAMKSYPGLPGQWSGTPYDFVRGGAGLKIPGLPDEVLGCLAGT* |
| Ga0066905_1017426072 | 3300005713 | Tropical Forest Soil | FRSPDWTGFQFDAGDTQPRAYPGLPGAWSGVPYDFVDGGAGLQIPGLPDEIVGCLSGS* |
| Ga0068860_1026826652 | 3300005843 | Switchgrass Rhizosphere | ADPQARAYPGLPGLWAGVPYDFVAGGAGLQIPGLPDEVVGCLSAT* |
| Ga0075278_10087333 | 3300005893 | Rice Paddy Soil | AGFRSPDWVGFQYDSGDTRRRRYPGLPGRWSGIAYDFVRGGAGLKIPGLPDEVIGCLAGT |
| Ga0081455_106976492 | 3300005937 | Tabebuia Heterophylla Rhizosphere | KAYPGLPGTWSGVPYDFVHGGEGLRIPGLPNEVVGCISGT* |
| Ga0075417_100083874 | 3300006049 | Populus Rhizosphere | YPGLPGSWAGVPYDFVSGGAGLQFPGLPDEVVGCLSAS* |
| Ga0075428_1001508814 | 3300006844 | Populus Rhizosphere | PKAYPRLPGTWSGVSYDFVDGGAGLQIPGLPDEVVGCLSGT* |
| Ga0075428_1012416062 | 3300006844 | Populus Rhizosphere | SPDWVGFQLDTGDPEERSYAGLPGAWAGVPYDFVGGGAGLEIPGLPEEVMGCLSAT* |
| Ga0075428_1023976911 | 3300006844 | Populus Rhizosphere | PGAWAGVPYDFVGGGAGLQIPGLPEEVVGCLSAT* |
| Ga0075421_1005744573 | 3300006845 | Populus Rhizosphere | AGLPGAWAGVPYDFVGGGAGLQIPGLPEEVVGCLSAT* |
| Ga0075430_1011503721 | 3300006846 | Populus Rhizosphere | RSPDWTGFQFDSGHTQSTAYPGLPGTWSGVPYDFVDGGAGLQIPGLPDEVVGCLSGT* |
| Ga0075431_1021862742 | 3300006847 | Populus Rhizosphere | GDTQPKAYPRLPGTWSGVSYDFVDGGAGLQIPGLPDEVVGCLSGT* |
| Ga0105679_101162621 | 3300007790 | Soil | GFQWEDGSEPQRYPGLPGTWAGVPYDFVAGGEGLMIPGLPEDVGGCLAGT* |
| Ga0105098_100903143 | 3300009081 | Freshwater Sediment | QLDTGDPEERSYAGLPGAWAGVPYDFVGGGAGLQIPGLPDEVVGCLSAT* |
| Ga0114129_103967553 | 3300009147 | Populus Rhizosphere | EGLPGEWSGIPYDFVKGGAGLEIPGLPDGVVGCLSAT* |
| Ga0114129_104065073 | 3300009147 | Populus Rhizosphere | QWNEADPQPRAYPGLPGEWAGIRYDFVKGGAGIDIPGLPAAVTGCLDGA* |
| Ga0111538_112254022 | 3300009156 | Populus Rhizosphere | RSPDWVGFQFDSGDTQARAYPGLPGLWAGVPYDFVAGGAGLQIPGLPDEVVGCLSAT* |
| Ga0105092_101443493 | 3300009157 | Freshwater Sediment | PGVWAGVPYDFVGGGAGLEIPGLPDEVVGCLSAT* |
| Ga0105100_109741621 | 3300009166 | Freshwater Sediment | EPKAYPGLPGVWAGTPYDFVEGGGELTIPGLPDAVVGCLVAT* |
| Ga0113563_126818252 | 3300009167 | Freshwater Wetlands | WIGFQYDSADTQAKAYPGLPGLWSGIPYDFVEGGGGLTIPGLPDAVLGCLADT* |
| Ga0113563_127092692 | 3300009167 | Freshwater Wetlands | KAYPGLPGLWSGIPYDFVEGGGGIEIAGLPDAVLGCLADT* |
| Ga0105097_108491841 | 3300009169 | Freshwater Sediment | TERAAYEGLPGRWRGRPYDFVKGGGGLTIPGLPDDVHGCLEGT* |
| Ga0105249_122236571 | 3300009553 | Switchgrass Rhizosphere | RSPDWVGFQFDSADPQARAYPGLPGLWAGVPYDFVTGGAGLQIPGLPDEVVGCLSAT* |
| Ga0105056_10211311 | 3300009801 | Groundwater Sand | PDWVGFQFDSGDPEARVYPGLPGSWAGVPYDFVSGGAGLQIPGLPEEVVGCLSAT* |
| Ga0105064_10080093 | 3300009821 | Groundwater Sand | APYRSHGWRSPNWIGFQWNSADTTPKAYPGLPGAWEGIPYDFVKGGGGLTIPGLPRDVAGCLNGT* |
| Ga0105068_10014431 | 3300009836 | Groundwater Sand | PDWVGFQFDSGDPEARVYPGLPGTWDGVPYDFVSGGAGLEIPGLPDEVAGCLSAT* |
| Ga0126315_101674643 | 3300010038 | Serpentine Soil | FQFASGDPEARVYPRLPGTWAGVPYDFVRGGAGLQIPGLPDEVVGCLSAT* |
| Ga0126312_100873551 | 3300010041 | Serpentine Soil | DWVGFQFDSGDPEARVYPGLPGTWDGVPYDFASGGAGLQIPGLPDQVVGCLSAT* |
| Ga0126314_104858413 | 3300010042 | Serpentine Soil | SLPGGWSGTPYDFVNGGDGIEIPGLPDEVVGCLAGT* |
| Ga0126306_111737863 | 3300010166 | Serpentine Soil | PDWSGFQWDPGSDPVEYPGLPGAWVGTRYDFVDGGAGLDIPGLPEEVRGCLDTA* |
| Ga0134088_107072931 | 3300010304 | Grasslands Soil | DSEDTTPKTYPGLPGTWSGAEYDFVKGGAGLDLPGLPDEVVGCLRGT* |
| Ga0105246_105143052 | 3300011119 | Miscanthus Rhizosphere | DSGDPEARAYPGLPGSWAGVPYDFVSGGAGLQIPGLPDEVVGCLSAS* |
| Ga0151622_10776891 | 3300011266 | Sediment | DWIGFQYNSANETRKTYPGLPGRWSGRPYDFVAGGAGLKFPGLPAEVTGCLDGT* |
| Ga0151621_12136501 | 3300011267 | Sediment | WIGFQYNSANETRKTYPGLPGRWSGRPYDFVAGGAGLKFPGLPAEVTGCLDGT* |
| Ga0137432_10855781 | 3300011439 | Soil | GFQFDSGDPEARAYPGLPGLWAGVPYDFVAGGAGLQIPGLPDEVVGCLSAT* |
| Ga0137367_108684332 | 3300012353 | Vadose Zone Soil | WIGFQWNSADTTPKAYPGLPGVWEGIPYDFVKGGGGLTFPGLPRDVAGCLNGT* |
| Ga0137367_108719691 | 3300012353 | Vadose Zone Soil | AYPGLPGAWEGIPYDFVLGGGGLTIPGLPRDVAGCLNGT* |
| Ga0137366_108620091 | 3300012354 | Vadose Zone Soil | PKAYPGLPGRWSGTPYDFVRGGAGLKFPGLPAEVTGCLDGT* |
| Ga0137368_104793031 | 3300012358 | Vadose Zone Soil | NSADTTPKAYPGLPGAWEGIPYDFVVGGGGLTIPGLPRDVAGCLNGT* |
| Ga0137368_106930392 | 3300012358 | Vadose Zone Soil | PGLPGSWGGVPYDFVSGGAGLQIPGLPDEVVGCLSAS* |
| Ga0137373_100233677 | 3300012532 | Vadose Zone Soil | QWNSADTTPKAYPGLPGAWEGTPYDFVKGGGGLTIPGLPRDVAGCLNGT* |
| Ga0157380_116956211 | 3300014326 | Switchgrass Rhizosphere | RTGFQLSADPTPKAYPGLQGEEAGLPYDFVKGGEGLTIPGLPDQVTGCLDGT* |
| Ga0120104_11153071 | 3300014829 | Permafrost | DAGDLTRRTYPGLPGTWEGVRYDFVNGGAGLTVPGLPNTVTGCLAGT* |
| Ga0120193_100946411 | 3300014965 | Terrestrial | VLAFDQQNNLYMTWIGFQFDSSDTDLRPYEGLPGLWSGIPYDFVDGGEGLSIPGLPDEVVGCLKST* |
| Ga0180070_10275862 | 3300015251 | Soil | VDDSADLERRLYGGLPGTWAGVPYDFVEGGAGIEISGLPPDVVGCLSGT* |
| Ga0184604_103440952 | 3300018000 | Groundwater Sediment | PRPYAGLPGEWSGIRYDFVKGGAGLHLPGLPAEVTGCLDGA |
| Ga0187788_101415891 | 3300018032 | Tropical Peatland | FQFDSADLTAKAYPGLPGTWSGVRYDFVKGGAGLKFPGLPAEVTGCLEGT |
| Ga0184623_101513592 | 3300018056 | Groundwater Sediment | GLPGSWAGVPYDFVSGGAGLQIPGLPEEVVGCLSAT |
| Ga0184633_101640173 | 3300018077 | Groundwater Sediment | WRSPNWIGFQWDSADTTPKAYPGLPGQWEGIPYDFVKGGGGLTIPGLPRDVAGCLGGT |
| Ga0184612_101309263 | 3300018078 | Groundwater Sediment | PNWIGFQWDSADTTPKAYPGLPGQWEGIPYDFVKGGGGLTIPGLPRDVAGCLGGT |
| Ga0184627_102402181 | 3300018079 | Groundwater Sediment | QWDSADTTPKAYPGLPGQWEGIPYDFVKGGGGLTIPGLPRDVAGCLNGT |
| Ga0184639_100379713 | 3300018082 | Groundwater Sediment | ADTTPKAYPGLPGQWEGIPYDFVKGGGGLTIPGLPRDVAGCLNGT |
| Ga0190272_102877563 | 3300018429 | Soil | APYDTAGYESPDWSGFQWNEADPEPRSYGGLPGEWAGIRYDFVKGGAGLDIPGLPAEVRGCLDTT |
| Ga0190269_105698111 | 3300018465 | Soil | PGLPGTWTGVPYDFVEGGGGLTIPGLPDEVRGCLEGT |
| Ga0190269_120003491 | 3300018465 | Soil | SWTGFQWDSADTEARAYPGLPGRWQGIPYDFVRGGAGLEIPGLPDEVVGCLDGT |
| Ga0190268_117861071 | 3300018466 | Soil | GSEAEPYPGLPGRWAGTPYDFVEGGEGLTIPGLPADVAGCLDGT |
| Ga0190268_119889691 | 3300018466 | Soil | QWADTEPSPYPGLPGAWSGTRYDFVNGGEGLDIPGLPTEVTGCLDTA |
| Ga0190274_111838442 | 3300018476 | Soil | DTADPEARVYPGLPGVWSGIPYDFVKGGEDLTIPGIPDEVVGCVSDS |
| Ga0190273_119436601 | 3300018920 | Soil | SGFQWEDTEPSPYPGLPGEWSGTRYDFVRGGAGLDIAGLPAEVRGCLDTA |
| Ga0210378_102981002 | 3300021073 | Groundwater Sediment | FQWDSADTTPKAYPGLPGQWEGIPYDFVKGGGGLTIPGLPRDVAGCLGGT |
| Ga0210382_103718013 | 3300021080 | Groundwater Sediment | FQWNEADPAPRAYAGLPGEWSGIRYDFVKGGAGLDIPGLPAEVTGCLDGA |
| Ga0210380_101554401 | 3300021082 | Groundwater Sediment | NWVGFQFDSAHTAMKSYPGLPGRWSGTPYDFVRGGAGLKIPGLPDEVLGCLAGT |
| Ga0193737_10428562 | 3300021972 | Soil | SPDWVGFQFDSGDPEARVYPGLPGSWAGVPYDFVSGGAGLQIPGLPEEVVGCLSAT |
| Ga0209320_101358183 | 3300025155 | Soil | FRSPDWIGFQYDSADPERRTYEGLPGTWEGVPYDFVEGGAGIQIAGLPDDVVGCLSAT |
| Ga0209324_104246211 | 3300025174 | Soil | ADTEDRAYPGLPGLWSGTPYDFVEGGGGLEIAGLPEQVLGCLAGT |
| Ga0209431_100901324 | 3300025313 | Soil | AYEGLPGTWTGVPYDFVEGGAGIEIPGLPDDVVGCLSAT |
| Ga0209519_106170632 | 3300025318 | Soil | DSTGYGSPDWIGFQYDSADPERRTYEGLPGTWEGVPYDFVEGGAGIQIAGLPDDVVGCLSAT |
| Ga0209641_101105191 | 3300025322 | Soil | ERRTYEGLPGTWEGVPYDFVKGGAGIEIAGLPDDVVGCLSAT |
| Ga0209751_109666901 | 3300025327 | Soil | GFRSPDWVGFQWDAADTSPKRYEGLPGKWRGVPYDFVAGGAGLTIPGLPEELVGCIDGT |
| Ga0207650_102015721 | 3300025925 | Switchgrass Rhizosphere | RVYPGLPGSWAGVPYDFVSGGAGLQIPGLPDEVVGCLSAS |
| Ga0207669_109391911 | 3300025937 | Miscanthus Rhizosphere | MPKLYPGLPGAWSGVRYDFVRGGAGLSIPGLPDEVTGCLDGT |
| Ga0207711_114898392 | 3300025941 | Switchgrass Rhizosphere | YPGLPGAWSGVRYDFVRGGAGLSIPGLPDEVTGCLDGT |
| Ga0210104_10383042 | 3300025956 | Natural And Restored Wetlands | VSPDWVGFQVDGSDPQPKPYEGLPGRWRGIPYDFVAGGAGLTFAGLPADVVGCLDGT |
| Ga0208652_10172121 | 3300026033 | Natural And Restored Wetlands | PGLPGEWRGTRYDFVKGGAGLTIPGLPDAVRGCLDGT |
| Ga0208654_10099971 | 3300026062 | Natural And Restored Wetlands | QWDSADTEARAYPGLPGRWAGIPYDFVRGGAGLDIPGLPDEVRGCLGGT |
| Ga0207678_112908041 | 3300026067 | Corn Rhizosphere | MKSYPGLPGQWSGTPYDFVRGGAGLKIPGLPDEVLGCLAGT |
| Ga0207676_118311641 | 3300026095 | Switchgrass Rhizosphere | TNGYRSPDWVGFQFDSGDPEARVYAGLPGSWAGVPYDFVSGGAGLQFPGLPDEVVGCLSA |
| Ga0256821_10345821 | 3300026452 | Sediment | YPGLPGRWAGQPYDFVLGGAGLKIPGLPDEVIGCLDGT |
| Ga0209842_10614501 | 3300027379 | Groundwater Sand | QFDSAILEERSYPGLPGRWAGVPYDFVGGGAGLEIPGLPDEVVGCLSAT |
| Ga0207478_1028922 | 3300027450 | Soil | DPEARVYPGLPGSWAGVPYDFVSGGAGLQFPGLPDEVVGCLSAS |
| (restricted) Ga0233416_102328502 | 3300027799 | Sediment | WVGFQYDSADTEARAYPGLPGTWSGIPYDFVEGGGGLEITGLPDAVVGCLDGT |
| (restricted) Ga0233416_103378391 | 3300027799 | Sediment | WRSPDWVGFQFDSADETPRTYPGLPGRWDGIPYDFVEGGGGLTIPGLPEAVVGCLTGT |
| Ga0209814_100862821 | 3300027873 | Populus Rhizosphere | VGFQFDSADSQARVYPGLPGGWAGVPYDFVSGDAGLQIPGLPAEVVGCLSGT |
| Ga0209481_100555171 | 3300027880 | Populus Rhizosphere | SADPQARVYPGLPGGWAGVPYDFVSGDAGLQIPGLPAEVVGCLSGT |
| Ga0209382_105775411 | 3300027909 | Populus Rhizosphere | FAGLPGAWAGVPYDFVGGGAGLQIPGLPEEVVGCLSAT |
| Ga0256864_12447531 | 3300027964 | Soil | SSDLERRTYPGLPGTWSGEPYDFVTGAGGDFAFPGLPDTVSGCLDGT |
| (restricted) Ga0233418_101361801 | 3300027995 | Sediment | TEARAYPGLPGTWSGIPYDFVEGGGGLEITGLPDAVVGCLDGT |
| Ga0247823_109118051 | 3300028590 | Soil | AYPGLPGRWRGTRYDFVNGGVGLTIPGLPDAVRGCLDRT |
| Ga0307311_100891821 | 3300028716 | Soil | TPRSYPGLPGTWEGVPYDFVKGGAGLQIPGLPAEVIGCLAGT |
| Ga0307319_102380821 | 3300028722 | Soil | QFDSGDPEARVYPGLPGSWAGVPYDFVSGGAGLQIPGLPEEVVGCLSAT |
| Ga0307318_102058662 | 3300028744 | Soil | DSGDPEARVYPGLPGSWAGVPYDFVSGGAGLQIPGLPEQVVGCLSAT |
| Ga0307297_103308912 | 3300028754 | Soil | TEGFSSPDWSGFQYDSAKRLRKPYPGLPGAWSGIRYDFVRGGAGLEIPGLPDEVTGCLDG |
| Ga0307320_100372323 | 3300028771 | Soil | SGFQWNEADPKPRPYPGLPGEWSGIRYDFVKGGAGLDIPGLPDEVTGCLDGT |
| Ga0307320_101016131 | 3300028771 | Soil | YESADPAPRSYEGLPGTWSGTAYDFVEGGAGLEFPGLPEEVAGCLDAS |
| Ga0307320_103321002 | 3300028771 | Soil | GLPGLWAGVPYDFVAGGAGLQIPGLPDEVVGCLSAT |
| Ga0307290_101881711 | 3300028791 | Soil | SPDWSGFQWNEADRGPHAYAGLPGAWRGTRYDFVNGGAGLDIPGLPAEVQGCLDTA |
| Ga0307281_103568071 | 3300028803 | Soil | SPNWVGFQFDSAHTAMKSYPGLPGRWSGTPYDFVRGGAGLKIPGLPDEVLGCLAGT |
| Ga0307305_100395711 | 3300028807 | Soil | SYPGLPGTWEGVPYDFVKGGAGLQIPGLPAEVIGCLAGT |
| Ga0307305_105450131 | 3300028807 | Soil | GLPGAWTGVEYDFVKGGEGLDLPGLPAAVVGCLQATS |
| Ga0307292_103546442 | 3300028811 | Soil | GFQWNEADPKPRPYPGLPGEWSGIRYDFVKGGAGLDIPGLPDEVTGCLDGT |
| Ga0307302_105468301 | 3300028814 | Soil | SGFQWNEADPEPRPYAGLPGEWSGIRYDFVKGGAELDIPGLPAEVTGCLDGT |
| Ga0247827_101297821 | 3300028889 | Soil | WSGFQWNSTDTTPHAYPGLPGRWRGTRYDFVNGGVGLTIPGLPDAVRGCLDRT |
| Ga0299907_106046321 | 3300030006 | Soil | WIAFQYESADPELRYYEGLPGTWSGTAYDFVQGGAGLRFPGLPEEVVGCLDAS |
| Ga0302046_100639954 | 3300030620 | Soil | FDGGDPEARVYPRLPGTWAGVPYDFVRGGAGLQIPGLPDEVVGCLSAT |
| Ga0302046_101252441 | 3300030620 | Soil | LRYYEGLPGTWSGTAYDFVQGGADLRFPGLPEDVVGCLDAS |
| Ga0307498_102472992 | 3300031170 | Soil | DPQARAYPGLPGLWAGVPYDFVAGGAGLQIPGLPDEVVGCLSAT |
| Ga0299914_111258552 | 3300031228 | Soil | ESGAEPERYAGLPGEWSGIPYDFVEGGEGLTIPGLPDEVRGCLEGT |
| Ga0307505_105893632 | 3300031455 | Soil | GLPGAWSGVRYDFVRGGAGLSIPGLPDEVTGCLDGT |
| Ga0307408_1004361263 | 3300031548 | Rhizosphere | GFEWTEADPALRAYPGLPGEWSGIRYDFVRGGAGLTVRGLPAAVVGCMHGS |
| Ga0307468_1020365181 | 3300031740 | Hardwood Forest Soil | ADPAPRAYPGLPGTWSGIPYDFVKGGEGIRIPGLPADVTGCLDGT |
| Ga0310904_102550491 | 3300031854 | Soil | VGFQFDSAHTAMKSYPGLPGQWSGTPYDFVRGGAGLKIPGLPDEVLGCLAGT |
| Ga0315280_104868891 | 3300031862 | Sediment | ARMTYPGLPGGWSGIPYDFVQGGAGLKIPGLPDEVRGCLEGT |
| Ga0310900_115367701 | 3300031908 | Soil | GFQWNEAEPQAHAYAGLPGRWRGDRYDFVKGGLGLHIPGLPAKVRGCLDTA |
| Ga0214473_106388233 | 3300031949 | Soil | GFQHDSADAERRTYEGLPGTWAGVPYDFVEGGAGIEISGLPDVVVGCLSAT |
| Ga0326597_108772053 | 3300031965 | Soil | DWIGFQYDSADPQRRTYEGLPGTWGGVPYDFVEGGAGIEIAGLPDAVVGCLSAT |
| Ga0326597_114022862 | 3300031965 | Soil | ARVYPRLPGTWAGVPYDFVRGGAGLQIPGLPDEVVGCLSAT |
| Ga0310903_101962682 | 3300032000 | Soil | DTQARAYPGLPGLWAGVPYDFVAGGAGLQIPGLPDEVVGCLSAT |
| Ga0310889_102222251 | 3300032179 | Soil | PGLPGLWAGVPYDFVAGGAGLQIPGLPDEVVGCLSAT |
| Ga0335085_116262201 | 3300032770 | Soil | PKAYPGLPGRWSGVPYDFVKGGAGLKFPGLPAEVMGCLEGT |
| Ga0214471_101368713 | 3300033417 | Soil | TNGFRSPDWVGFQFDSGDPLVRSYPGLPGAWAGVPYDFVDGGAGLEIPGLPDEVVGCLSA |
| Ga0316626_120623471 | 3300033485 | Soil | FQYDSADTDTRSYPGLPGQWSGVPYDFVRGGGGPETPGPGIPGLPDEVVGCLDGT |
| Ga0316616_1007462962 | 3300033521 | Soil | DSADTEAKAYPGLPGLWSGIPYDFVKGGGGLTIPGLPDAVLGCLAGT |
| Ga0316616_1039979621 | 3300033521 | Soil | DWVAFQYDSADTDTRSYPGLPGQWSGVPYDFVRGGGGPETPGPGIPGLPDEVVGCLDGT |
| Ga0247830_117206542 | 3300033551 | Soil | QYDPTAPQRRYPDLPGAWRGVPYDFVAGGEGLTIPGLPDEVVGCLDGT |
| Ga0364924_005374_2143_2262 | 3300033811 | Sediment | FYEGLPGLWAGIPYDFVQGGAGLEIPGLPDEVAGCLDAT |
| Ga0364930_0279308_404_562 | 3300033814 | Sediment | IGFQWDSADTTPKAYPGLPGQWEGIPYDFVNGGGGLTIPGLPTEVAGCLNGT |
| Ga0364935_0320936_3_137 | 3300034151 | Sediment | NPLARSYPGLPGRWAGVPYDFVGGGAGLEIPGLPDEVVGCLSAT |
| Ga0364943_0429390_384_491 | 3300034354 | Sediment | LPGRWAGVPYDFVAGGAGLEIPGLPDEVVGCLSAT |
| ⦗Top⦘ |