NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F052268

Metagenome Family F052268

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F052268
Family Type Metagenome
Number of Sequences 143
Average Sequence Length 48 residues
Representative Sequence SGDPEARAYPGLPGLWAGVPYDFVAGGAGLQIPGLPDEVVGCLSAT
Number of Associated Samples 128
Number of Associated Scaffolds 143

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.91 %
% of genes near scaffold ends (potentially truncated) 75.52 %
% of genes from short scaffolds (< 2000 bps) 69.23 %
Associated GOLD sequencing projects 123
AlphaFold2 3D model prediction Yes
3D model pTM-score0.39

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (51.748 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(20.280 % of family members)
Environment Ontology (ENVO) Unclassified
(26.573 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(30.070 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: No Secondary Structure distribution: α-helix: 10.81%    β-sheet: 10.81%    Coil/Unstructured: 78.38%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.39
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 143 Family Scaffolds
PF00480ROK 30.07
PF00441Acyl-CoA_dh_1 18.18
PF06271RDD 7.69
PF02771Acyl-CoA_dh_N 2.80
PF02770Acyl-CoA_dh_M 2.10
PF13416SBP_bac_8 1.40
PF01909NTP_transf_2 1.40
PF13649Methyltransf_25 0.70
PF01740STAS 0.70
PF01425Amidase 0.70
PF03807F420_oxidored 0.70
PF10518TAT_signal 0.70
PF00211Guanylate_cyc 0.70
PF04185Phosphoesterase 0.70
PF01979Amidohydro_1 0.70
PF00133tRNA-synt_1 0.70
PF08386Abhydrolase_4 0.70
PF13478XdhC_C 0.70

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 143 Family Scaffolds
COG1940Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domainTranscription [K] 60.14
COG1960Acyl-CoA dehydrogenase related to the alkylation response protein AidBLipid transport and metabolism [I] 23.08
COG1714Uncharacterized membrane protein YckC, RDD familyFunction unknown [S] 7.69
COG0060Isoleucyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.70
COG0143Methionyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.70
COG0154Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidaseTranslation, ribosomal structure and biogenesis [J] 0.70
COG0495Leucyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.70
COG0525Valyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.70
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 0.70
COG3511Phospholipase CCell wall/membrane/envelope biogenesis [M] 0.70


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms51.75 %
UnclassifiedrootN/A48.25 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2199352031|2206182271Not Available521Open in IMG/M
3300001431|F14TB_100194496Not Available1204Open in IMG/M
3300003993|Ga0055468_10001649All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2965Open in IMG/M
3300004643|Ga0062591_100929016Not Available819Open in IMG/M
3300005093|Ga0062594_101856723Not Available637Open in IMG/M
3300005356|Ga0070674_100750436All Organisms → cellular organisms → Bacteria838Open in IMG/M
3300005438|Ga0070701_10779647All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium650Open in IMG/M
3300005558|Ga0066698_10355609All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1011Open in IMG/M
3300005843|Ga0068860_102682665All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium517Open in IMG/M
3300005937|Ga0081455_10697649Not Available647Open in IMG/M
3300006049|Ga0075417_10008387All Organisms → cellular organisms → Bacteria3714Open in IMG/M
3300006844|Ga0075428_100150881All Organisms → cellular organisms → Bacteria2525Open in IMG/M
3300006844|Ga0075428_102397691All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia542Open in IMG/M
3300006845|Ga0075421_100574457Not Available1329Open in IMG/M
3300006847|Ga0075431_102186274All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium508Open in IMG/M
3300007790|Ga0105679_10116262All Organisms → cellular organisms → Bacteria1383Open in IMG/M
3300009081|Ga0105098_10090314Not Available1309Open in IMG/M
3300009147|Ga0114129_10396755All Organisms → cellular organisms → Bacteria1819Open in IMG/M
3300009147|Ga0114129_10406507All Organisms → cellular organisms → Bacteria1793Open in IMG/M
3300009157|Ga0105092_10144349Not Available1320Open in IMG/M
3300009166|Ga0105100_10974162All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium531Open in IMG/M
3300009167|Ga0113563_12681825Not Available603Open in IMG/M
3300009167|Ga0113563_12709269Not Available600Open in IMG/M
3300009169|Ga0105097_10849184All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia522Open in IMG/M
3300009821|Ga0105064_1008009All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1836Open in IMG/M
3300010038|Ga0126315_10167464Not Available1309Open in IMG/M
3300010042|Ga0126314_10485841All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium895Open in IMG/M
3300010166|Ga0126306_11173786Not Available630Open in IMG/M
3300010304|Ga0134088_10707293Not Available506Open in IMG/M
3300011119|Ga0105246_10514305Not Available1019Open in IMG/M
3300011266|Ga0151622_1077689All Organisms → cellular organisms → Bacteria905Open in IMG/M
3300011267|Ga0151621_1213650All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium621Open in IMG/M
3300012353|Ga0137367_10868433All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium623Open in IMG/M
3300012353|Ga0137367_10871969All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium621Open in IMG/M
3300012354|Ga0137366_10862009All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium640Open in IMG/M
3300012358|Ga0137368_10479303All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium805Open in IMG/M
3300012358|Ga0137368_10693039Not Available641Open in IMG/M
3300012532|Ga0137373_10023367All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia6138Open in IMG/M
3300014326|Ga0157380_11695621All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium689Open in IMG/M
3300014829|Ga0120104_1115307All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300015251|Ga0180070_1027586Not Available709Open in IMG/M
3300018000|Ga0184604_10344095All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300018032|Ga0187788_10141589All Organisms → cellular organisms → Bacteria900Open in IMG/M
3300018056|Ga0184623_10151359Not Available1072Open in IMG/M
3300018077|Ga0184633_10164017All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1152Open in IMG/M
3300018078|Ga0184612_10130926All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1313Open in IMG/M
3300018079|Ga0184627_10240218All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium955Open in IMG/M
3300018082|Ga0184639_10037971All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2471Open in IMG/M
3300018429|Ga0190272_10287756All Organisms → cellular organisms → Bacteria1263Open in IMG/M
3300018465|Ga0190269_10569811All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia756Open in IMG/M
3300018465|Ga0190269_12000349Not Available504Open in IMG/M
3300018466|Ga0190268_11786107All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium553Open in IMG/M
3300018466|Ga0190268_11988969All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium534Open in IMG/M
3300018476|Ga0190274_11183844All Organisms → cellular organisms → Bacteria847Open in IMG/M
3300018920|Ga0190273_11943660All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium542Open in IMG/M
3300021073|Ga0210378_10298100All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium606Open in IMG/M
3300021080|Ga0210382_10371801All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium632Open in IMG/M
3300025174|Ga0209324_10424621All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes825Open in IMG/M
3300025313|Ga0209431_10090132All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2407Open in IMG/M
3300025322|Ga0209641_10110519All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2099Open in IMG/M
3300025925|Ga0207650_10201572All Organisms → cellular organisms → Bacteria → Proteobacteria1594Open in IMG/M
3300025937|Ga0207669_10939191All Organisms → cellular organisms → Bacteria724Open in IMG/M
3300025941|Ga0207711_11489839Not Available620Open in IMG/M
3300026033|Ga0208652_1017212Not Available856Open in IMG/M
3300026062|Ga0208654_1009997All Organisms → cellular organisms → Bacteria1196Open in IMG/M
3300026067|Ga0207678_11290804All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium646Open in IMG/M
3300026452|Ga0256821_1034582Not Available571Open in IMG/M
3300027379|Ga0209842_1061450Not Available669Open in IMG/M
3300027450|Ga0207478_102892All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium548Open in IMG/M
(restricted) 3300027799|Ga0233416_10232850Not Available633Open in IMG/M
3300027880|Ga0209481_10055517All Organisms → cellular organisms → Bacteria → Proteobacteria1844Open in IMG/M
3300027909|Ga0209382_10577541Not Available1227Open in IMG/M
3300027964|Ga0256864_1244753All Organisms → cellular organisms → Bacteria514Open in IMG/M
(restricted) 3300027995|Ga0233418_10136180Not Available770Open in IMG/M
3300028590|Ga0247823_10911805All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium659Open in IMG/M
3300028716|Ga0307311_10089182Not Available853Open in IMG/M
3300028722|Ga0307319_10238082Not Available598Open in IMG/M
3300028744|Ga0307318_10205866Not Available681Open in IMG/M
3300028771|Ga0307320_10037232All Organisms → cellular organisms → Bacteria1781Open in IMG/M
3300028771|Ga0307320_10101613All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1093Open in IMG/M
3300028771|Ga0307320_10332100Not Available606Open in IMG/M
3300028791|Ga0307290_10188171All Organisms → cellular organisms → Bacteria757Open in IMG/M
3300028807|Ga0307305_10039571All Organisms → cellular organisms → Bacteria → Proteobacteria2165Open in IMG/M
3300028811|Ga0307292_10354644All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300028814|Ga0307302_10546830All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium575Open in IMG/M
3300028889|Ga0247827_10129782All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1310Open in IMG/M
3300030006|Ga0299907_10604632All Organisms → cellular organisms → Bacteria852Open in IMG/M
3300030620|Ga0302046_10063995All Organisms → cellular organisms → Bacteria2985Open in IMG/M
3300030620|Ga0302046_10125244All Organisms → cellular organisms → Bacteria2102Open in IMG/M
3300031170|Ga0307498_10247299Not Available645Open in IMG/M
3300031228|Ga0299914_11125855All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium633Open in IMG/M
3300031455|Ga0307505_10589363Not Available540Open in IMG/M
3300031548|Ga0307408_100436126All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1133Open in IMG/M
3300031740|Ga0307468_102036518All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300031854|Ga0310904_10255049All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1089Open in IMG/M
3300031862|Ga0315280_10486889All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium540Open in IMG/M
3300031908|Ga0310900_11536770Not Available562Open in IMG/M
3300031949|Ga0214473_10638823All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1169Open in IMG/M
3300031965|Ga0326597_11402286Not Available677Open in IMG/M
3300032000|Ga0310903_10196268Not Available942Open in IMG/M
3300032179|Ga0310889_10222225Not Available883Open in IMG/M
3300032770|Ga0335085_11626220All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria668Open in IMG/M
3300033485|Ga0316626_12062347All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium517Open in IMG/M
3300033521|Ga0316616_100746296Not Available1181Open in IMG/M
3300033521|Ga0316616_103997962All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium555Open in IMG/M
3300033551|Ga0247830_11720654All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium502Open in IMG/M
3300033811|Ga0364924_005374All Organisms → cellular organisms → Bacteria → Terrabacteria group2262Open in IMG/M
3300033814|Ga0364930_0279308All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium563Open in IMG/M
3300034151|Ga0364935_0320936All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium513Open in IMG/M
3300034354|Ga0364943_0429390All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium513Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil20.28%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere9.09%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil4.90%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment4.20%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.20%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment2.80%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment2.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.80%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil2.80%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.80%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand2.80%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment2.80%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment2.10%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands2.10%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.10%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil2.10%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil2.10%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.10%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands1.40%
SedimentEnvironmental → Aquatic → Freshwater → Groundwater → Acid Mine Drainage → Sediment1.40%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.40%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.40%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.40%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.40%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.40%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.40%
SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment0.70%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.70%
TerrestrialEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial0.70%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.70%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.70%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.70%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.70%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.70%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.70%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.70%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.70%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.70%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil0.70%
Speleothem And Rock Wall SurfacesEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Speleothem And Rock Wall Surfaces0.70%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.70%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.70%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.70%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.70%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.70%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.70%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908043Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active Layer A2EnvironmentalOpen in IMG/M
2199352031Cave microbial community (Speleothem B)EnvironmentalOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300003993Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2EnvironmentalOpen in IMG/M
3300004047Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D1EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005168Soil and rhizosphere microbial communities from Laval, Canada - mgLPCEnvironmentalOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005893Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_202EnvironmentalOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300007790Microbial communities of desert soil contaminated with blood from dead anthrax infected zebra in Etosha National Park, Namibia. Combined Assembly of 14 sequencing projectsEnvironmentalOpen in IMG/M
3300009081Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009166Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015EnvironmentalOpen in IMG/M
3300009167Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)EnvironmentalOpen in IMG/M
3300009169Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015EnvironmentalOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009801Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30EnvironmentalOpen in IMG/M
3300009821Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30EnvironmentalOpen in IMG/M
3300009836Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20EnvironmentalOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011266Acid mine drainage microbial communities from Malanjkhand copper mine, India - M16 k-mer 55EnvironmentalOpen in IMG/M
3300011267Acid mine drainage microbial communities from Malanjkhand copper mine, India - M16 k-mer-51EnvironmentalOpen in IMG/M
3300011439Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT820_2EnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012358Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014829Permafrost microbial communities from Nunavut, Canada - A10_35cm_6MEnvironmentalOpen in IMG/M
3300014965Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T2EnvironmentalOpen in IMG/M
3300015251Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT293_16_10DEnvironmentalOpen in IMG/M
3300018000Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coexEnvironmentalOpen in IMG/M
3300018032Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MGEnvironmentalOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018077Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1EnvironmentalOpen in IMG/M
3300018078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coexEnvironmentalOpen in IMG/M
3300018079Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1EnvironmentalOpen in IMG/M
3300018082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2EnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018920Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 ISEnvironmentalOpen in IMG/M
3300021073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redoEnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300021082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redoEnvironmentalOpen in IMG/M
3300021972Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2m2EnvironmentalOpen in IMG/M
3300025155Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 4EnvironmentalOpen in IMG/M
3300025174Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 3EnvironmentalOpen in IMG/M
3300025313Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes)EnvironmentalOpen in IMG/M
3300025318Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1EnvironmentalOpen in IMG/M
3300025322Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025327Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025956Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300026033Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLA_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026062Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026452Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 7-17 PU4EnvironmentalOpen in IMG/M
3300027379Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 (SPAdes)EnvironmentalOpen in IMG/M
3300027450Soil microbial communities from Kellog Biological Station, Michigan, USA - Nitrogen cycling UWRJ-G07K3-12 (SPAdes)EnvironmentalOpen in IMG/M
3300027799 (restricted)Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0_MGEnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300027964Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 HiSeqEnvironmentalOpen in IMG/M
3300027995 (restricted)Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_1_MGEnvironmentalOpen in IMG/M
3300028590Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day30EnvironmentalOpen in IMG/M
3300028716Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198EnvironmentalOpen in IMG/M
3300028722Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368EnvironmentalOpen in IMG/M
3300028744Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367EnvironmentalOpen in IMG/M
3300028754Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157EnvironmentalOpen in IMG/M
3300028771Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369EnvironmentalOpen in IMG/M
3300028791Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144EnvironmentalOpen in IMG/M
3300028803Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028889Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2EnvironmentalOpen in IMG/M
3300030006Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67EnvironmentalOpen in IMG/M
3300030620Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111EnvironmentalOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031228Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57EnvironmentalOpen in IMG/M
3300031455Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_SEnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031862Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_40EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031949Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197EnvironmentalOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300032000Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3EnvironmentalOpen in IMG/M
3300032179Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300033417Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155EnvironmentalOpen in IMG/M
3300033485Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_AEnvironmentalOpen in IMG/M
3300033521Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_BEnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300033811Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17EnvironmentalOpen in IMG/M
3300033814Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17EnvironmentalOpen in IMG/M
3300034151Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17EnvironmentalOpen in IMG/M
3300034354Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
A2_c1_009502002124908043SoilRSADWVWFQFNSGDIVRKRYPGLPGRWSGIAYEFVRGGAGLKIPGLPDEVSGCLAGT
22078230272199352031Speleothem And Rock Wall SurfacesKGYPGLPGTWRGMPYDFVRGGAGLAIPGLPAEVGGCLEGT
F14TB_10019449623300001431SoilSGDPEARAYPGLPGLWAGVPYDFVAGGAGLQIPGLPDEVVGCLSAT*
Ga0055468_1000164913300003993Natural And Restored WetlandsGFQWDSADTEARAYPGLPGRWAGIPYDFVRGGAGLDIPGLPDEVRGCLGGT*
Ga0055499_1006885923300004047Natural And Restored WetlandsYRSPDWIGFQYDSADTERRLYEGLPGSWSGIAYDFVKGGAGLEIVGLPPDVVGCLSGT*
Ga0063356_10536437013300004463Arabidopsis Thaliana RhizosphereQPRLVSGLPGTWTGVDYDFVKGGEGLDLPGLPAAVVGCLRSTS*
Ga0062591_10092901613300004643SoilFQFDSGDPEARVYPGLPGSWAGVPYDFVSGGAGLQIPGLPDEVVGCLSAS*
Ga0062594_10185672313300005093SoilMPKLYPGLPGAWSGVRYDFVRGGAGLSIPGLPDEVTGCLDGT*
Ga0066809_1023490813300005168SoilPDWVGFQFDSGDPDARAYPGLPGLWSGVPYDFATGGAGLQIPGLPDEVVGCLSAT*
Ga0070689_10053849413300005340Switchgrass RhizospherePDWVGFQFDSATIARKSYPGLPGRWSGIPYDFVRGGAGLKIPGLPDEVLGCLAGT*
Ga0070668_10172480223300005347Switchgrass RhizosphereYVPGLPGRWSGIEYDFVKGGEGLDLPGLPSTLAGCLNGT*
Ga0070674_10075043613300005356Miscanthus RhizospherePKLYPGLPGAWSGVRYDFVRGGAGLSIPGLPDEVTGCLDGT*
Ga0070701_1077964713300005438Corn, Switchgrass And Miscanthus RhizosphereTEGFSSPDWSGFQYDSAKRMPKLYPGLPGAWSGVRYDFVRGGAGLSIPGLPDEVTGCLDGT*
Ga0070700_10060551333300005441Corn, Switchgrass And Miscanthus RhizosphereSPDWVGFQFDSAHAAMKSYPGLPGQWSGTPYDFVRGGAGLKIPGLPDEVLGCLAGT*
Ga0066698_1035560913300005558SoilKAYPGLPGQWEGVPYDFVKGGGGLTIPGLPPDVAGCLNGT*
Ga0068859_10244512113300005617Switchgrass RhizosphereGFQFDSSHAAMKSYPGLPGQWSGTPYDFVRGGAGLKIPGLPDEVLGCLAGT*
Ga0066905_10174260723300005713Tropical Forest SoilFRSPDWTGFQFDAGDTQPRAYPGLPGAWSGVPYDFVDGGAGLQIPGLPDEIVGCLSGS*
Ga0068860_10268266523300005843Switchgrass RhizosphereADPQARAYPGLPGLWAGVPYDFVAGGAGLQIPGLPDEVVGCLSAT*
Ga0075278_100873333300005893Rice Paddy SoilAGFRSPDWVGFQYDSGDTRRRRYPGLPGRWSGIAYDFVRGGAGLKIPGLPDEVIGCLAGT
Ga0081455_1069764923300005937Tabebuia Heterophylla RhizosphereKAYPGLPGTWSGVPYDFVHGGEGLRIPGLPNEVVGCISGT*
Ga0075417_1000838743300006049Populus RhizosphereYPGLPGSWAGVPYDFVSGGAGLQFPGLPDEVVGCLSAS*
Ga0075428_10015088143300006844Populus RhizospherePKAYPRLPGTWSGVSYDFVDGGAGLQIPGLPDEVVGCLSGT*
Ga0075428_10124160623300006844Populus RhizosphereSPDWVGFQLDTGDPEERSYAGLPGAWAGVPYDFVGGGAGLEIPGLPEEVMGCLSAT*
Ga0075428_10239769113300006844Populus RhizospherePGAWAGVPYDFVGGGAGLQIPGLPEEVVGCLSAT*
Ga0075421_10057445733300006845Populus RhizosphereAGLPGAWAGVPYDFVGGGAGLQIPGLPEEVVGCLSAT*
Ga0075430_10115037213300006846Populus RhizosphereRSPDWTGFQFDSGHTQSTAYPGLPGTWSGVPYDFVDGGAGLQIPGLPDEVVGCLSGT*
Ga0075431_10218627423300006847Populus RhizosphereGDTQPKAYPRLPGTWSGVSYDFVDGGAGLQIPGLPDEVVGCLSGT*
Ga0105679_1011626213300007790SoilGFQWEDGSEPQRYPGLPGTWAGVPYDFVAGGEGLMIPGLPEDVGGCLAGT*
Ga0105098_1009031433300009081Freshwater SedimentQLDTGDPEERSYAGLPGAWAGVPYDFVGGGAGLQIPGLPDEVVGCLSAT*
Ga0114129_1039675533300009147Populus RhizosphereEGLPGEWSGIPYDFVKGGAGLEIPGLPDGVVGCLSAT*
Ga0114129_1040650733300009147Populus RhizosphereQWNEADPQPRAYPGLPGEWAGIRYDFVKGGAGIDIPGLPAAVTGCLDGA*
Ga0111538_1122540223300009156Populus RhizosphereRSPDWVGFQFDSGDTQARAYPGLPGLWAGVPYDFVAGGAGLQIPGLPDEVVGCLSAT*
Ga0105092_1014434933300009157Freshwater SedimentPGVWAGVPYDFVGGGAGLEIPGLPDEVVGCLSAT*
Ga0105100_1097416213300009166Freshwater SedimentEPKAYPGLPGVWAGTPYDFVEGGGELTIPGLPDAVVGCLVAT*
Ga0113563_1268182523300009167Freshwater WetlandsWIGFQYDSADTQAKAYPGLPGLWSGIPYDFVEGGGGLTIPGLPDAVLGCLADT*
Ga0113563_1270926923300009167Freshwater WetlandsKAYPGLPGLWSGIPYDFVEGGGGIEIAGLPDAVLGCLADT*
Ga0105097_1084918413300009169Freshwater SedimentTERAAYEGLPGRWRGRPYDFVKGGGGLTIPGLPDDVHGCLEGT*
Ga0105249_1222365713300009553Switchgrass RhizosphereRSPDWVGFQFDSADPQARAYPGLPGLWAGVPYDFVTGGAGLQIPGLPDEVVGCLSAT*
Ga0105056_102113113300009801Groundwater SandPDWVGFQFDSGDPEARVYPGLPGSWAGVPYDFVSGGAGLQIPGLPEEVVGCLSAT*
Ga0105064_100800933300009821Groundwater SandAPYRSHGWRSPNWIGFQWNSADTTPKAYPGLPGAWEGIPYDFVKGGGGLTIPGLPRDVAGCLNGT*
Ga0105068_100144313300009836Groundwater SandPDWVGFQFDSGDPEARVYPGLPGTWDGVPYDFVSGGAGLEIPGLPDEVAGCLSAT*
Ga0126315_1016746433300010038Serpentine SoilFQFASGDPEARVYPRLPGTWAGVPYDFVRGGAGLQIPGLPDEVVGCLSAT*
Ga0126312_1008735513300010041Serpentine SoilDWVGFQFDSGDPEARVYPGLPGTWDGVPYDFASGGAGLQIPGLPDQVVGCLSAT*
Ga0126314_1048584133300010042Serpentine SoilSLPGGWSGTPYDFVNGGDGIEIPGLPDEVVGCLAGT*
Ga0126306_1117378633300010166Serpentine SoilPDWSGFQWDPGSDPVEYPGLPGAWVGTRYDFVDGGAGLDIPGLPEEVRGCLDTA*
Ga0134088_1070729313300010304Grasslands SoilDSEDTTPKTYPGLPGTWSGAEYDFVKGGAGLDLPGLPDEVVGCLRGT*
Ga0105246_1051430523300011119Miscanthus RhizosphereDSGDPEARAYPGLPGSWAGVPYDFVSGGAGLQIPGLPDEVVGCLSAS*
Ga0151622_107768913300011266SedimentDWIGFQYNSANETRKTYPGLPGRWSGRPYDFVAGGAGLKFPGLPAEVTGCLDGT*
Ga0151621_121365013300011267SedimentWIGFQYNSANETRKTYPGLPGRWSGRPYDFVAGGAGLKFPGLPAEVTGCLDGT*
Ga0137432_108557813300011439SoilGFQFDSGDPEARAYPGLPGLWAGVPYDFVAGGAGLQIPGLPDEVVGCLSAT*
Ga0137367_1086843323300012353Vadose Zone SoilWIGFQWNSADTTPKAYPGLPGVWEGIPYDFVKGGGGLTFPGLPRDVAGCLNGT*
Ga0137367_1087196913300012353Vadose Zone SoilAYPGLPGAWEGIPYDFVLGGGGLTIPGLPRDVAGCLNGT*
Ga0137366_1086200913300012354Vadose Zone SoilPKAYPGLPGRWSGTPYDFVRGGAGLKFPGLPAEVTGCLDGT*
Ga0137368_1047930313300012358Vadose Zone SoilNSADTTPKAYPGLPGAWEGIPYDFVVGGGGLTIPGLPRDVAGCLNGT*
Ga0137368_1069303923300012358Vadose Zone SoilPGLPGSWGGVPYDFVSGGAGLQIPGLPDEVVGCLSAS*
Ga0137373_1002336773300012532Vadose Zone SoilQWNSADTTPKAYPGLPGAWEGTPYDFVKGGGGLTIPGLPRDVAGCLNGT*
Ga0157380_1169562113300014326Switchgrass RhizosphereRTGFQLSADPTPKAYPGLQGEEAGLPYDFVKGGEGLTIPGLPDQVTGCLDGT*
Ga0120104_111530713300014829PermafrostDAGDLTRRTYPGLPGTWEGVRYDFVNGGAGLTVPGLPNTVTGCLAGT*
Ga0120193_1009464113300014965TerrestrialVLAFDQQNNLYMTWIGFQFDSSDTDLRPYEGLPGLWSGIPYDFVDGGEGLSIPGLPDEVVGCLKST*
Ga0180070_102758623300015251SoilVDDSADLERRLYGGLPGTWAGVPYDFVEGGAGIEISGLPPDVVGCLSGT*
Ga0184604_1034409523300018000Groundwater SedimentPRPYAGLPGEWSGIRYDFVKGGAGLHLPGLPAEVTGCLDGA
Ga0187788_1014158913300018032Tropical PeatlandFQFDSADLTAKAYPGLPGTWSGVRYDFVKGGAGLKFPGLPAEVTGCLEGT
Ga0184623_1015135923300018056Groundwater SedimentGLPGSWAGVPYDFVSGGAGLQIPGLPEEVVGCLSAT
Ga0184633_1016401733300018077Groundwater SedimentWRSPNWIGFQWDSADTTPKAYPGLPGQWEGIPYDFVKGGGGLTIPGLPRDVAGCLGGT
Ga0184612_1013092633300018078Groundwater SedimentPNWIGFQWDSADTTPKAYPGLPGQWEGIPYDFVKGGGGLTIPGLPRDVAGCLGGT
Ga0184627_1024021813300018079Groundwater SedimentQWDSADTTPKAYPGLPGQWEGIPYDFVKGGGGLTIPGLPRDVAGCLNGT
Ga0184639_1003797133300018082Groundwater SedimentADTTPKAYPGLPGQWEGIPYDFVKGGGGLTIPGLPRDVAGCLNGT
Ga0190272_1028775633300018429SoilAPYDTAGYESPDWSGFQWNEADPEPRSYGGLPGEWAGIRYDFVKGGAGLDIPGLPAEVRGCLDTT
Ga0190269_1056981113300018465SoilPGLPGTWTGVPYDFVEGGGGLTIPGLPDEVRGCLEGT
Ga0190269_1200034913300018465SoilSWTGFQWDSADTEARAYPGLPGRWQGIPYDFVRGGAGLEIPGLPDEVVGCLDGT
Ga0190268_1178610713300018466SoilGSEAEPYPGLPGRWAGTPYDFVEGGEGLTIPGLPADVAGCLDGT
Ga0190268_1198896913300018466SoilQWADTEPSPYPGLPGAWSGTRYDFVNGGEGLDIPGLPTEVTGCLDTA
Ga0190274_1118384423300018476SoilDTADPEARVYPGLPGVWSGIPYDFVKGGEDLTIPGIPDEVVGCVSDS
Ga0190273_1194366013300018920SoilSGFQWEDTEPSPYPGLPGEWSGTRYDFVRGGAGLDIAGLPAEVRGCLDTA
Ga0210378_1029810023300021073Groundwater SedimentFQWDSADTTPKAYPGLPGQWEGIPYDFVKGGGGLTIPGLPRDVAGCLGGT
Ga0210382_1037180133300021080Groundwater SedimentFQWNEADPAPRAYAGLPGEWSGIRYDFVKGGAGLDIPGLPAEVTGCLDGA
Ga0210380_1015544013300021082Groundwater SedimentNWVGFQFDSAHTAMKSYPGLPGRWSGTPYDFVRGGAGLKIPGLPDEVLGCLAGT
Ga0193737_104285623300021972SoilSPDWVGFQFDSGDPEARVYPGLPGSWAGVPYDFVSGGAGLQIPGLPEEVVGCLSAT
Ga0209320_1013581833300025155SoilFRSPDWIGFQYDSADPERRTYEGLPGTWEGVPYDFVEGGAGIQIAGLPDDVVGCLSAT
Ga0209324_1042462113300025174SoilADTEDRAYPGLPGLWSGTPYDFVEGGGGLEIAGLPEQVLGCLAGT
Ga0209431_1009013243300025313SoilAYEGLPGTWTGVPYDFVEGGAGIEIPGLPDDVVGCLSAT
Ga0209519_1061706323300025318SoilDSTGYGSPDWIGFQYDSADPERRTYEGLPGTWEGVPYDFVEGGAGIQIAGLPDDVVGCLSAT
Ga0209641_1011051913300025322SoilERRTYEGLPGTWEGVPYDFVKGGAGIEIAGLPDDVVGCLSAT
Ga0209751_1096669013300025327SoilGFRSPDWVGFQWDAADTSPKRYEGLPGKWRGVPYDFVAGGAGLTIPGLPEELVGCIDGT
Ga0207650_1020157213300025925Switchgrass RhizosphereRVYPGLPGSWAGVPYDFVSGGAGLQIPGLPDEVVGCLSAS
Ga0207669_1093919113300025937Miscanthus RhizosphereMPKLYPGLPGAWSGVRYDFVRGGAGLSIPGLPDEVTGCLDGT
Ga0207711_1148983923300025941Switchgrass RhizosphereYPGLPGAWSGVRYDFVRGGAGLSIPGLPDEVTGCLDGT
Ga0210104_103830423300025956Natural And Restored WetlandsVSPDWVGFQVDGSDPQPKPYEGLPGRWRGIPYDFVAGGAGLTFAGLPADVVGCLDGT
Ga0208652_101721213300026033Natural And Restored WetlandsPGLPGEWRGTRYDFVKGGAGLTIPGLPDAVRGCLDGT
Ga0208654_100999713300026062Natural And Restored WetlandsQWDSADTEARAYPGLPGRWAGIPYDFVRGGAGLDIPGLPDEVRGCLGGT
Ga0207678_1129080413300026067Corn RhizosphereMKSYPGLPGQWSGTPYDFVRGGAGLKIPGLPDEVLGCLAGT
Ga0207676_1183116413300026095Switchgrass RhizosphereTNGYRSPDWVGFQFDSGDPEARVYAGLPGSWAGVPYDFVSGGAGLQFPGLPDEVVGCLSA
Ga0256821_103458213300026452SedimentYPGLPGRWAGQPYDFVLGGAGLKIPGLPDEVIGCLDGT
Ga0209842_106145013300027379Groundwater SandQFDSAILEERSYPGLPGRWAGVPYDFVGGGAGLEIPGLPDEVVGCLSAT
Ga0207478_10289223300027450SoilDPEARVYPGLPGSWAGVPYDFVSGGAGLQFPGLPDEVVGCLSAS
(restricted) Ga0233416_1023285023300027799SedimentWVGFQYDSADTEARAYPGLPGTWSGIPYDFVEGGGGLEITGLPDAVVGCLDGT
(restricted) Ga0233416_1033783913300027799SedimentWRSPDWVGFQFDSADETPRTYPGLPGRWDGIPYDFVEGGGGLTIPGLPEAVVGCLTGT
Ga0209814_1008628213300027873Populus RhizosphereVGFQFDSADSQARVYPGLPGGWAGVPYDFVSGDAGLQIPGLPAEVVGCLSGT
Ga0209481_1005551713300027880Populus RhizosphereSADPQARVYPGLPGGWAGVPYDFVSGDAGLQIPGLPAEVVGCLSGT
Ga0209382_1057754113300027909Populus RhizosphereFAGLPGAWAGVPYDFVGGGAGLQIPGLPEEVVGCLSAT
Ga0256864_124475313300027964SoilSSDLERRTYPGLPGTWSGEPYDFVTGAGGDFAFPGLPDTVSGCLDGT
(restricted) Ga0233418_1013618013300027995SedimentTEARAYPGLPGTWSGIPYDFVEGGGGLEITGLPDAVVGCLDGT
Ga0247823_1091180513300028590SoilAYPGLPGRWRGTRYDFVNGGVGLTIPGLPDAVRGCLDRT
Ga0307311_1008918213300028716SoilTPRSYPGLPGTWEGVPYDFVKGGAGLQIPGLPAEVIGCLAGT
Ga0307319_1023808213300028722SoilQFDSGDPEARVYPGLPGSWAGVPYDFVSGGAGLQIPGLPEEVVGCLSAT
Ga0307318_1020586623300028744SoilDSGDPEARVYPGLPGSWAGVPYDFVSGGAGLQIPGLPEQVVGCLSAT
Ga0307297_1033089123300028754SoilTEGFSSPDWSGFQYDSAKRLRKPYPGLPGAWSGIRYDFVRGGAGLEIPGLPDEVTGCLDG
Ga0307320_1003723233300028771SoilSGFQWNEADPKPRPYPGLPGEWSGIRYDFVKGGAGLDIPGLPDEVTGCLDGT
Ga0307320_1010161313300028771SoilYESADPAPRSYEGLPGTWSGTAYDFVEGGAGLEFPGLPEEVAGCLDAS
Ga0307320_1033210023300028771SoilGLPGLWAGVPYDFVAGGAGLQIPGLPDEVVGCLSAT
Ga0307290_1018817113300028791SoilSPDWSGFQWNEADRGPHAYAGLPGAWRGTRYDFVNGGAGLDIPGLPAEVQGCLDTA
Ga0307281_1035680713300028803SoilSPNWVGFQFDSAHTAMKSYPGLPGRWSGTPYDFVRGGAGLKIPGLPDEVLGCLAGT
Ga0307305_1003957113300028807SoilSYPGLPGTWEGVPYDFVKGGAGLQIPGLPAEVIGCLAGT
Ga0307305_1054501313300028807SoilGLPGAWTGVEYDFVKGGEGLDLPGLPAAVVGCLQATS
Ga0307292_1035464423300028811SoilGFQWNEADPKPRPYPGLPGEWSGIRYDFVKGGAGLDIPGLPDEVTGCLDGT
Ga0307302_1054683013300028814SoilSGFQWNEADPEPRPYAGLPGEWSGIRYDFVKGGAELDIPGLPAEVTGCLDGT
Ga0247827_1012978213300028889SoilWSGFQWNSTDTTPHAYPGLPGRWRGTRYDFVNGGVGLTIPGLPDAVRGCLDRT
Ga0299907_1060463213300030006SoilWIAFQYESADPELRYYEGLPGTWSGTAYDFVQGGAGLRFPGLPEEVVGCLDAS
Ga0302046_1006399543300030620SoilFDGGDPEARVYPRLPGTWAGVPYDFVRGGAGLQIPGLPDEVVGCLSAT
Ga0302046_1012524413300030620SoilLRYYEGLPGTWSGTAYDFVQGGADLRFPGLPEDVVGCLDAS
Ga0307498_1024729923300031170SoilDPQARAYPGLPGLWAGVPYDFVAGGAGLQIPGLPDEVVGCLSAT
Ga0299914_1112585523300031228SoilESGAEPERYAGLPGEWSGIPYDFVEGGEGLTIPGLPDEVRGCLEGT
Ga0307505_1058936323300031455SoilGLPGAWSGVRYDFVRGGAGLSIPGLPDEVTGCLDGT
Ga0307408_10043612633300031548RhizosphereGFEWTEADPALRAYPGLPGEWSGIRYDFVRGGAGLTVRGLPAAVVGCMHGS
Ga0307468_10203651813300031740Hardwood Forest SoilADPAPRAYPGLPGTWSGIPYDFVKGGEGIRIPGLPADVTGCLDGT
Ga0310904_1025504913300031854SoilVGFQFDSAHTAMKSYPGLPGQWSGTPYDFVRGGAGLKIPGLPDEVLGCLAGT
Ga0315280_1048688913300031862SedimentARMTYPGLPGGWSGIPYDFVQGGAGLKIPGLPDEVRGCLEGT
Ga0310900_1153677013300031908SoilGFQWNEAEPQAHAYAGLPGRWRGDRYDFVKGGLGLHIPGLPAKVRGCLDTA
Ga0214473_1063882333300031949SoilGFQHDSADAERRTYEGLPGTWAGVPYDFVEGGAGIEISGLPDVVVGCLSAT
Ga0326597_1087720533300031965SoilDWIGFQYDSADPQRRTYEGLPGTWGGVPYDFVEGGAGIEIAGLPDAVVGCLSAT
Ga0326597_1140228623300031965SoilARVYPRLPGTWAGVPYDFVRGGAGLQIPGLPDEVVGCLSAT
Ga0310903_1019626823300032000SoilDTQARAYPGLPGLWAGVPYDFVAGGAGLQIPGLPDEVVGCLSAT
Ga0310889_1022222513300032179SoilPGLPGLWAGVPYDFVAGGAGLQIPGLPDEVVGCLSAT
Ga0335085_1162622013300032770SoilPKAYPGLPGRWSGVPYDFVKGGAGLKFPGLPAEVMGCLEGT
Ga0214471_1013687133300033417SoilTNGFRSPDWVGFQFDSGDPLVRSYPGLPGAWAGVPYDFVDGGAGLEIPGLPDEVVGCLSA
Ga0316626_1206234713300033485SoilFQYDSADTDTRSYPGLPGQWSGVPYDFVRGGGGPETPGPGIPGLPDEVVGCLDGT
Ga0316616_10074629623300033521SoilDSADTEAKAYPGLPGLWSGIPYDFVKGGGGLTIPGLPDAVLGCLAGT
Ga0316616_10399796213300033521SoilDWVAFQYDSADTDTRSYPGLPGQWSGVPYDFVRGGGGPETPGPGIPGLPDEVVGCLDGT
Ga0247830_1172065423300033551SoilQYDPTAPQRRYPDLPGAWRGVPYDFVAGGEGLTIPGLPDEVVGCLDGT
Ga0364924_005374_2143_22623300033811SedimentFYEGLPGLWAGIPYDFVQGGAGLEIPGLPDEVAGCLDAT
Ga0364930_0279308_404_5623300033814SedimentIGFQWDSADTTPKAYPGLPGQWEGIPYDFVNGGGGLTIPGLPTEVAGCLNGT
Ga0364935_0320936_3_1373300034151SedimentNPLARSYPGLPGRWAGVPYDFVGGGAGLEIPGLPDEVVGCLSAT
Ga0364943_0429390_384_4913300034354SedimentLPGRWAGVPYDFVAGGAGLEIPGLPDEVVGCLSAT


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.