| Basic Information | |
|---|---|
| Family ID | F051312 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 144 |
| Average Sequence Length | 49 residues |
| Representative Sequence | MNATRTLLAAMVLGTAIGAVQANAQCSGNAGTCNTTNTASVTVGALVK |
| Number of Associated Samples | 119 |
| Number of Associated Scaffolds | 144 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 95.83 % |
| % of genes near scaffold ends (potentially truncated) | 98.61 % |
| % of genes from short scaffolds (< 2000 bps) | 91.67 % |
| Associated GOLD sequencing projects | 115 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.26 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (56.944 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (20.139 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.639 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (38.194 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 34.21% β-sheet: 0.00% Coil/Unstructured: 65.79% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.26 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 144 Family Scaffolds |
|---|---|---|
| PF13193 | AMP-binding_C | 25.00 |
| PF00593 | TonB_dep_Rec | 2.78 |
| PF00535 | Glycos_transf_2 | 1.39 |
| PF12697 | Abhydrolase_6 | 1.39 |
| PF13633 | Obsolete Pfam Family | 1.39 |
| PF00005 | ABC_tran | 1.39 |
| PF00174 | Oxidored_molyb | 1.39 |
| PF00486 | Trans_reg_C | 0.69 |
| PF13432 | TPR_16 | 0.69 |
| PF16177 | ACAS_N | 0.69 |
| PF04932 | Wzy_C | 0.69 |
| PF01578 | Cytochrom_C_asm | 0.69 |
| COG ID | Name | Functional Category | % Frequency in 144 Family Scaffolds |
|---|---|---|---|
| COG2041 | Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductases | Energy production and conversion [C] | 1.39 |
| COG3915 | Uncharacterized conserved protein | Function unknown [S] | 1.39 |
| COG3307 | O-antigen ligase | Cell wall/membrane/envelope biogenesis [M] | 0.69 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 56.94 % |
| Unclassified | root | N/A | 43.06 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908043|A2_c1_ConsensusfromContig56115 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
| 2228664021|ICCgaii200_c0213441 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 501 | Open in IMG/M |
| 3300001139|JGI10220J13317_10839018 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 625 | Open in IMG/M |
| 3300001324|A2635W6_115145 | Not Available | 735 | Open in IMG/M |
| 3300001526|A105W1_1008368 | Not Available | 718 | Open in IMG/M |
| 3300001664|P5cmW16_1063411 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 611 | Open in IMG/M |
| 3300001664|P5cmW16_1082567 | Not Available | 502 | Open in IMG/M |
| 3300003391|JGI26135J50243_101681 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 645 | Open in IMG/M |
| 3300004156|Ga0062589_101037691 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300004157|Ga0062590_101646555 | Not Available | 651 | Open in IMG/M |
| 3300004157|Ga0062590_102054430 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Gordoniaceae → Gordonia → Gordonia rhizosphera | 594 | Open in IMG/M |
| 3300004479|Ga0062595_100532309 | Not Available | 893 | Open in IMG/M |
| 3300005093|Ga0062594_100098224 | Not Available | 1737 | Open in IMG/M |
| 3300005171|Ga0066677_10755127 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 541 | Open in IMG/M |
| 3300005171|Ga0066677_10782351 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 529 | Open in IMG/M |
| 3300005175|Ga0066673_10854573 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_2_60_3 | 519 | Open in IMG/M |
| 3300005184|Ga0066671_10047751 | All Organisms → cellular organisms → Bacteria | 2143 | Open in IMG/M |
| 3300005289|Ga0065704_10854782 | Not Available | 508 | Open in IMG/M |
| 3300005328|Ga0070676_10499011 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300005333|Ga0070677_10021635 | Not Available | 2362 | Open in IMG/M |
| 3300005339|Ga0070660_100433881 | Not Available | 1089 | Open in IMG/M |
| 3300005356|Ga0070674_100804931 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 812 | Open in IMG/M |
| 3300005364|Ga0070673_101008810 | Not Available | 775 | Open in IMG/M |
| 3300005364|Ga0070673_101732037 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_2_60_3 | 592 | Open in IMG/M |
| 3300005406|Ga0070703_10069528 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1173 | Open in IMG/M |
| 3300005435|Ga0070714_100880633 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
| 3300005440|Ga0070705_100742419 | Not Available | 775 | Open in IMG/M |
| 3300005444|Ga0070694_101532678 | Not Available | 565 | Open in IMG/M |
| 3300005451|Ga0066681_10858677 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 546 | Open in IMG/M |
| 3300005451|Ga0066681_10978788 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 505 | Open in IMG/M |
| 3300005467|Ga0070706_101714613 | Not Available | 572 | Open in IMG/M |
| 3300005518|Ga0070699_100277295 | Not Available | 1501 | Open in IMG/M |
| 3300005544|Ga0070686_101693178 | Not Available | 537 | Open in IMG/M |
| 3300005545|Ga0070695_100346907 | Not Available | 1111 | Open in IMG/M |
| 3300005545|Ga0070695_101697199 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 529 | Open in IMG/M |
| 3300005546|Ga0070696_101679219 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 547 | Open in IMG/M |
| 3300005547|Ga0070693_100121469 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_2_60_3 | 1621 | Open in IMG/M |
| 3300005578|Ga0068854_100966204 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium RIFCSPLOWO2_12_FULL_71_22 | 752 | Open in IMG/M |
| 3300005614|Ga0068856_101275498 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300005615|Ga0070702_101411672 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 570 | Open in IMG/M |
| 3300005844|Ga0068862_101299345 | Not Available | 729 | Open in IMG/M |
| 3300005873|Ga0075287_1038849 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 635 | Open in IMG/M |
| 3300005873|Ga0075287_1041209 | Not Available | 620 | Open in IMG/M |
| 3300006046|Ga0066652_101729373 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 569 | Open in IMG/M |
| 3300006175|Ga0070712_101830274 | Not Available | 532 | Open in IMG/M |
| 3300006854|Ga0075425_100035367 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 5564 | Open in IMG/M |
| 3300006854|Ga0075425_100603650 | Not Available | 1262 | Open in IMG/M |
| 3300006876|Ga0079217_10041503 | Not Available | 1793 | Open in IMG/M |
| 3300007076|Ga0075435_101660657 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 561 | Open in IMG/M |
| 3300007255|Ga0099791_10020847 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 2815 | Open in IMG/M |
| 3300009012|Ga0066710_100063052 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 4695 | Open in IMG/M |
| 3300009012|Ga0066710_100707127 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1537 | Open in IMG/M |
| 3300009098|Ga0105245_12808514 | Not Available | 540 | Open in IMG/M |
| 3300010039|Ga0126309_10609560 | Not Available | 688 | Open in IMG/M |
| 3300010219|Ga0136220_1010703 | Not Available | 1052 | Open in IMG/M |
| 3300011269|Ga0137392_10592019 | Not Available | 920 | Open in IMG/M |
| 3300011271|Ga0137393_11709519 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 518 | Open in IMG/M |
| 3300011991|Ga0120153_1020524 | Not Available | 1498 | Open in IMG/M |
| 3300012001|Ga0120167_1115690 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_2_60_3 | 540 | Open in IMG/M |
| 3300012199|Ga0137383_10033695 | All Organisms → cellular organisms → Bacteria | 3611 | Open in IMG/M |
| 3300012203|Ga0137399_11561294 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 548 | Open in IMG/M |
| 3300012207|Ga0137381_10762942 | Not Available | 839 | Open in IMG/M |
| 3300012208|Ga0137376_11333464 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 608 | Open in IMG/M |
| 3300012285|Ga0137370_10371458 | Not Available | 863 | Open in IMG/M |
| 3300012285|Ga0137370_10767460 | Not Available | 598 | Open in IMG/M |
| 3300012361|Ga0137360_10316473 | Not Available | 1299 | Open in IMG/M |
| 3300012924|Ga0137413_10548182 | Not Available | 858 | Open in IMG/M |
| 3300012927|Ga0137416_10283145 | Not Available | 1367 | Open in IMG/M |
| 3300012951|Ga0164300_10832795 | Not Available | 576 | Open in IMG/M |
| 3300012951|Ga0164300_11116796 | Not Available | 516 | Open in IMG/M |
| 3300012958|Ga0164299_10818400 | Not Available | 666 | Open in IMG/M |
| 3300012972|Ga0134077_10305580 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 669 | Open in IMG/M |
| 3300013766|Ga0120181_1101796 | Not Available | 629 | Open in IMG/M |
| 3300014157|Ga0134078_10172699 | Not Available | 864 | Open in IMG/M |
| 3300014157|Ga0134078_10607946 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_2_60_3 | 524 | Open in IMG/M |
| 3300018027|Ga0184605_10147909 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1056 | Open in IMG/M |
| 3300018051|Ga0184620_10205150 | Not Available | 656 | Open in IMG/M |
| 3300018061|Ga0184619_10008229 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 4016 | Open in IMG/M |
| 3300018061|Ga0184619_10355028 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 668 | Open in IMG/M |
| 3300018066|Ga0184617_1075313 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 905 | Open in IMG/M |
| 3300018071|Ga0184618_10136489 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 993 | Open in IMG/M |
| 3300018071|Ga0184618_10174445 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 889 | Open in IMG/M |
| 3300018071|Ga0184618_10452434 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 540 | Open in IMG/M |
| 3300018084|Ga0184629_10490419 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 641 | Open in IMG/M |
| 3300018429|Ga0190272_10990608 | Not Available | 801 | Open in IMG/M |
| 3300018482|Ga0066669_10350284 | All Organisms → cellular organisms → Bacteria | 1226 | Open in IMG/M |
| 3300019865|Ga0193748_1024559 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 567 | Open in IMG/M |
| 3300019877|Ga0193722_1041391 | Not Available | 1180 | Open in IMG/M |
| 3300019877|Ga0193722_1083747 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 780 | Open in IMG/M |
| 3300019878|Ga0193715_1089200 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 632 | Open in IMG/M |
| 3300020000|Ga0193692_1070734 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 771 | Open in IMG/M |
| 3300020015|Ga0193734_1002991 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 3035 | Open in IMG/M |
| 3300020018|Ga0193721_1094865 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 767 | Open in IMG/M |
| 3300020022|Ga0193733_1054556 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1127 | Open in IMG/M |
| 3300020059|Ga0193745_1008610 | Not Available | 2194 | Open in IMG/M |
| 3300020059|Ga0193745_1038559 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1048 | Open in IMG/M |
| 3300020070|Ga0206356_11217919 | Not Available | 566 | Open in IMG/M |
| 3300021080|Ga0210382_10479341 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 551 | Open in IMG/M |
| 3300021415|Ga0193694_1016582 | Not Available | 1008 | Open in IMG/M |
| 3300021953|Ga0213880_10229196 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 529 | Open in IMG/M |
| 3300021968|Ga0193698_1013319 | Not Available | 1051 | Open in IMG/M |
| 3300022534|Ga0224452_1112197 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300022756|Ga0222622_10068841 | Not Available | 2074 | Open in IMG/M |
| 3300022756|Ga0222622_10128452 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1604 | Open in IMG/M |
| 3300024283|Ga0247670_1078996 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_2_60_3 | 601 | Open in IMG/M |
| 3300024331|Ga0247668_1102379 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_2_60_3 | 580 | Open in IMG/M |
| 3300025505|Ga0207929_1003592 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 3264 | Open in IMG/M |
| 3300025911|Ga0207654_11158153 | Not Available | 563 | Open in IMG/M |
| 3300025912|Ga0207707_11560409 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 521 | Open in IMG/M |
| 3300025917|Ga0207660_10863378 | Not Available | 738 | Open in IMG/M |
| 3300025919|Ga0207657_10379458 | Not Available | 1113 | Open in IMG/M |
| 3300025933|Ga0207706_11611331 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 526 | Open in IMG/M |
| 3300025934|Ga0207686_11403770 | Not Available | 575 | Open in IMG/M |
| 3300025938|Ga0207704_11346266 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 611 | Open in IMG/M |
| 3300025938|Ga0207704_11363054 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 607 | Open in IMG/M |
| 3300025960|Ga0207651_11295440 | Not Available | 655 | Open in IMG/M |
| 3300025981|Ga0207640_11645679 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 579 | Open in IMG/M |
| 3300025986|Ga0207658_11810760 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 557 | Open in IMG/M |
| 3300026041|Ga0207639_11053660 | Not Available | 762 | Open in IMG/M |
| 3300026223|Ga0209840_1032977 | Not Available | 1181 | Open in IMG/M |
| 3300026310|Ga0209239_1359223 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 510 | Open in IMG/M |
| 3300026323|Ga0209472_1294247 | Not Available | 519 | Open in IMG/M |
| 3300026538|Ga0209056_10723769 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_2_60_3 | 504 | Open in IMG/M |
| 3300027603|Ga0209331_1160159 | Not Available | 530 | Open in IMG/M |
| 3300027665|Ga0209983_1133780 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 567 | Open in IMG/M |
| 3300028711|Ga0307293_10161670 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 713 | Open in IMG/M |
| 3300028711|Ga0307293_10165045 | Not Available | 705 | Open in IMG/M |
| 3300028715|Ga0307313_10082532 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 967 | Open in IMG/M |
| 3300028784|Ga0307282_10116022 | Not Available | 1252 | Open in IMG/M |
| 3300028793|Ga0307299_10042254 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1672 | Open in IMG/M |
| 3300028799|Ga0307284_10232708 | Not Available | 730 | Open in IMG/M |
| 3300028807|Ga0307305_10070620 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1611 | Open in IMG/M |
| 3300028824|Ga0307310_10547891 | Not Available | 586 | Open in IMG/M |
| 3300028828|Ga0307312_10004055 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 7851 | Open in IMG/M |
| 3300028828|Ga0307312_10091298 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1876 | Open in IMG/M |
| 3300028828|Ga0307312_10122685 | Not Available | 1629 | Open in IMG/M |
| 3300028828|Ga0307312_10810203 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 620 | Open in IMG/M |
| 3300031716|Ga0310813_10277040 | All Organisms → cellular organisms → Bacteria | 1407 | Open in IMG/M |
| 3300031720|Ga0307469_10267809 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1387 | Open in IMG/M |
| 3300031720|Ga0307469_11425218 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 661 | Open in IMG/M |
| 3300031740|Ga0307468_102162170 | Not Available | 537 | Open in IMG/M |
| 3300031740|Ga0307468_102486796 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 507 | Open in IMG/M |
| 3300032180|Ga0307471_100546743 | Not Available | 1312 | Open in IMG/M |
| 3300034384|Ga0372946_0107643 | Not Available | 1310 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 20.14% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.33% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.64% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 6.25% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.56% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 4.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.47% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.47% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.78% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.78% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.08% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.08% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.08% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.08% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.08% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.08% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.08% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.39% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.39% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.39% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.39% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.39% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.69% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.69% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.69% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.69% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.69% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.69% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.69% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.69% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.69% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.69% |
| Soil | Engineered → Lab Enrichment → Unclassified → Unclassified → Unclassified → Soil | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908043 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active Layer A2 | Environmental | Open in IMG/M |
| 2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300001139 | Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soil | Environmental | Open in IMG/M |
| 3300001324 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A26-35cm)- 6 month illumina | Environmental | Open in IMG/M |
| 3300001526 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-5cm-1A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001664 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - 5cm_reassembled | Environmental | Open in IMG/M |
| 3300003391 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM | Host-Associated | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005873 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_301 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010219 | Soil microbial communities from Bangor area, North Wales, UK, before enrichment, after WGA | Engineered | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300011991 | Permafrost microbial communities from Nunavut, Canada - A34_65cm_12M | Environmental | Open in IMG/M |
| 3300012001 | Permafrost microbial communities from Nunavut, Canada - A24_80cm_12M | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300013766 | Permafrost microbial communities from Nunavut, Canada - A26_65cm_6M | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019865 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s1 | Environmental | Open in IMG/M |
| 3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
| 3300019878 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2 | Environmental | Open in IMG/M |
| 3300020000 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a1 | Environmental | Open in IMG/M |
| 3300020015 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m1 | Environmental | Open in IMG/M |
| 3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300020059 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a2 | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021415 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s1 | Environmental | Open in IMG/M |
| 3300021953 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R07 | Environmental | Open in IMG/M |
| 3300021968 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c1 | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300024283 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK11 | Environmental | Open in IMG/M |
| 3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
| 3300025505 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026223 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300034384 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_KNG_2.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| A2_c1_00025280 | 2124908043 | Soil | MFATRYLLAATVLGSALCVSQANAQCSGNAGGCLTV |
| ICCgaii200_02134411 | 2228664021 | Soil | MKATRNLLAAMVLGTIIIASQANAQCSGNAGSCNTTNTASVTVGALVKLGM |
| JGI10220J13317_108390182 | 3300001139 | Soil | MKATRNLLAAMVLGTIITASQANAQCSGNAGSCNTTNTASVTVGALVKLGMSAATTSLTS |
| A2635W6_1151451 | 3300001324 | Permafrost | MKATRLLLAAMVLGTAIGASQANAQCSSSSGSCFTTN |
| A105W1_10083681 | 3300001526 | Permafrost | MKATRSLLAAMVLGTAIGASQANAQCSSNSGSCNTTN |
| P5cmW16_10634111 | 3300001664 | Permafrost | MKATRFLLAAMVLGSAISARQANAQLQCSGNAGGCLVVNTASATVNALVKLTMSATTTP* |
| P5cmW16_10825672 | 3300001664 | Permafrost | MKATRSLLAAMVLGTVVGASQANAQCSSVGATGTCSTTNT |
| JGI26135J50243_1016811 | 3300003391 | Arabidopsis Thaliana Rhizosphere | MKATRNLLAAMVLGTIITASQANAQCSGNAGSCNTTNTASVTVGALVKLGMSAATTSLTSPTAD |
| Ga0062589_1010376912 | 3300004156 | Soil | MKATNSLLAAIALVSAIGATQANAQCSGNAGSCNTTNTASVTVGTLVKLGM |
| Ga0062590_1016465552 | 3300004157 | Soil | MAAMVLGTAIVTSQANAQCSGNAGTCNTTNTASVTVGALVK |
| Ga0062590_1020544301 | 3300004157 | Soil | MKATRILLAAMVLGIAIGASQANAQSCSSSAGSCVTTNTASATVGTMVKLDLGSATTA |
| Ga0062595_1005323091 | 3300004479 | Soil | MKATRLLAAMVLGTAIGASQANAQCSGNTGSCNTTNTASVTVGAL |
| Ga0062594_1000982241 | 3300005093 | Soil | MKATRTLLAAMVLGTAIGASQASAQCSGNAGSCNTTNTASVTVGALVKLGMSSA |
| Ga0066677_107551271 | 3300005171 | Soil | MNATRFILAAMVLGSAISVNQAGAQCSGNAGSCNTTNTAS |
| Ga0066677_107823511 | 3300005171 | Soil | MNATRSLLAAMVLGTAIGASQANAQCSGNSGSCNTTNTASVTVGALVKL |
| Ga0066673_108545732 | 3300005175 | Soil | MNATRTLLAAMVLVSAIGVNQAGAQCSGNAGGCLTVNTAS |
| Ga0066671_100477511 | 3300005184 | Soil | MNATRFLLAAMVLGSAISVNQASAQCSGNAGSCNTTNTASV |
| Ga0065704_108547821 | 3300005289 | Switchgrass Rhizosphere | MNATRFLLAAMVLGTAIGVEANAQCSGNAGSCNTTNTASVSVNALVKL |
| Ga0070676_104990113 | 3300005328 | Miscanthus Rhizosphere | MVLGTAISANQAGAQCSGNAGGCLTINTASATVNALVKLGMS |
| Ga0070677_100216353 | 3300005333 | Miscanthus Rhizosphere | MNATRFILAAMVIGSAICVNQASAQCSGNGSCNLTNTVSASVN |
| Ga0070660_1004338811 | 3300005339 | Corn Rhizosphere | MKATNSLLAAIALVSAIGATQANAQCSGNAGSCNTTNTASVTVGTLVKLGMSS |
| Ga0070674_1008049312 | 3300005356 | Miscanthus Rhizosphere | MKATRTLLAAMVLGTAIGASQASAQCSGNAGSCNTTNTASVTVGALVKLGMSSATTTLTNPTADDVD |
| Ga0070673_1010088102 | 3300005364 | Switchgrass Rhizosphere | MKATRFLAAMVLATAIGATEASAQCSGNAGSCNTTNTASVTV |
| Ga0070673_1017320371 | 3300005364 | Switchgrass Rhizosphere | MSATRYLLAAMVLGSAISATQANAQCSGNAGGCLTVNTASATVNALVKLGMSGTTTTLTSPTAD |
| Ga0070703_100695284 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MSATRYLLAAMVLGSAISATQANAQCSGNAGGCLTVNTASATVNALVKL |
| Ga0070714_1008806331 | 3300005435 | Agricultural Soil | MNATRNLLAAMVLGTAICASQANAQCSGNTGTCNTTNTASVTVGAL |
| Ga0070705_1007424192 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MKATRSLLAAMVLATAIGASQAAAQCSGNGGSCNTTNTASVTVGALV |
| Ga0070694_1015326781 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MKATRFLLAAMVLGSAISVSQASAQCSGNAGGCLTVNTASATVNALVKLGMSATTT |
| Ga0066681_108586771 | 3300005451 | Soil | MNATRTLLAAMVLVSAIGVSQADAQCSGNAGGCLTVNTASATVNALVKL |
| Ga0066681_109787881 | 3300005451 | Soil | MKATRSLLAAMVLATAIGATEANAQCSGNAGSCNTTNTASVTVGALVKLGMSS |
| Ga0070706_1017146131 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MKATRYLLAAMALGTAIGASEANAQCSGNAGSCNTTNTASVTVGALVKLGMSSATT |
| Ga0070699_1002772951 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MKATRFLLAAMVLGSAISVSQASAQCSGNAGGCLTVNTASATVNALVKLGMSA |
| Ga0070686_1016931782 | 3300005544 | Switchgrass Rhizosphere | MNATRFVLAAMVLGTAISANQAGAQCSGNAGGCLTINTASATVNA |
| Ga0070695_1003469071 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MKATRLLAAMVLGTAIGASQANAQCSGNTGSCNTTNTASVTVGALVKLGMSAATTSLTNPTADD |
| Ga0070695_1016971991 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MNATRFFLAAMVIGSAISVTQAGAQCSGNAGSCNTTNTASVSVNALVKL |
| Ga0070696_1016792191 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MKATRSLLAAMVLATAIGASQAAAQCSGNGGSCNTTNTASVTVGALVKLGMS |
| Ga0070693_1001214694 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MNANRFLLAALVLGSLAGANQANAQCSGNAGGCLTINTASATVNALVKLGMSATTTTISSPT |
| Ga0068854_1009662042 | 3300005578 | Corn Rhizosphere | MKATRTILAAMVLGTVIGASQANAQCTGNAGTCNTTNTASVTVGA |
| Ga0068856_1012754981 | 3300005614 | Corn Rhizosphere | MRATRTLLAAMVLGTAISASQANAQCSGNAGTCNTTNTASVTVGALVKLGMSSAATALTNPTADDV |
| Ga0070702_1014116722 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MNATRFILAAMVLGSAISVNQASAQCSGNAGSCNTTNTVTASVNALVK |
| Ga0068862_1012993452 | 3300005844 | Switchgrass Rhizosphere | MNATRFILAAMVIGSTISVNQAGAQCSGNAGSCNSTNTASVT |
| Ga0075287_10388491 | 3300005873 | Rice Paddy Soil | MRSTRSLLTAMVLGTVIGASQVNAQCSGNGGSCNTTNTASVTVGALVKLGMSSA |
| Ga0075287_10412091 | 3300005873 | Rice Paddy Soil | MNATRFLLAAMVLGSAIGVNQADAQCSSNAGSCNTTNTA |
| Ga0066652_1017293733 | 3300006046 | Soil | MKATRFLLAAMVLATAIGASQANAQCSGNAGSCNT |
| Ga0070712_1018302742 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MNATRIVMAALVLGTAIGANKADAQCSGNTGSCNTTNTA |
| Ga0075425_1000353678 | 3300006854 | Populus Rhizosphere | MNATRLILAAMVLGSAIGVNQADAQCSGNAGSCNTTNT |
| Ga0075425_1006036502 | 3300006854 | Populus Rhizosphere | MKATRFLAAMVLATAIGATQANAQCSGNAGSCNTTNTASVTVGALVKLVMSSATTTLT |
| Ga0079217_100415031 | 3300006876 | Agricultural Soil | MNSTRFVLAAMVLGTALGSSQASAQGCIGSGSCNATNTASVSVGALVKLDM |
| Ga0075435_1016606572 | 3300007076 | Populus Rhizosphere | MNATRFVLAAMVLGTAIGANQANAQCSGNAGSCNSTNTVSATVNALVKLGMSA |
| Ga0099791_100208471 | 3300007255 | Vadose Zone Soil | MKATRFLLAAMVLGSAISVSQANAQCSGNAGGCLTVNTASATVNALVKLG |
| Ga0066710_1000630521 | 3300009012 | Grasslands Soil | MNATRSFLAAMVLVFAISANQASAQCSGNAGGCLTVNTASAT |
| Ga0066710_1007071271 | 3300009012 | Grasslands Soil | MNATRSFLAAMVLVFAISANQASAQCSGNAGGCLTVNTASATVNALVKLGM |
| Ga0105245_128085141 | 3300009098 | Miscanthus Rhizosphere | MKATRTILAAMVLGTVIGASQANAQCTGNAGTCNTTNT |
| Ga0126309_106095602 | 3300010039 | Serpentine Soil | MKATRTLLAAMVLGTAITAAQANAQCSGNAGSCNTTNTASVTVGALVKLGMSAATT |
| Ga0136220_10107031 | 3300010219 | Soil | MTATRSILAAMVLGAAISVNQAGAQCSGNAGSCNLTNTASVSVNALVKLAMSSATTTLTSPTA |
| Ga0137392_105920191 | 3300011269 | Vadose Zone Soil | MVLGTAIGASQANAQCSGNAGTCNTTNTASVTVGALVKLG |
| Ga0137393_117095191 | 3300011271 | Vadose Zone Soil | MVLGTAIGASQANAQCSGNAGTCNTTNTASVTVGALVKLGM |
| Ga0120153_10205241 | 3300011991 | Permafrost | MRATRTLLAAMVLGTAIGASQANAQCSGSAGSCNTTNTASVTVGALVKLGMGTAVTAL |
| Ga0120167_11156901 | 3300012001 | Permafrost | MSATRYLLAAMVLGSAISATQANAQCSGNAGGCLTVNTASATVNALVKLGMSGTTSTLSSPT |
| Ga0137383_100336951 | 3300012199 | Vadose Zone Soil | MKATRFLLGAMVLGSAISVSQASAQCSGNAGGCLTVNTASATVNALVKLGM |
| Ga0137399_115612941 | 3300012203 | Vadose Zone Soil | MRATRSLLAAMVLGTAIGASQANAQCSGNAGTCNTTNVASVTVGALVKLGMSSATTSLT |
| Ga0137381_107629422 | 3300012207 | Vadose Zone Soil | MKATRYLLAAMVLGTAIGASQANAQCSGSAGSCNTTNTASVTVGALVKLG |
| Ga0137376_113334641 | 3300012208 | Vadose Zone Soil | MRATRTLLAAMVLGTAIGASQANAQCSGNAGTCNTTNTASVTVGALVKLGMSSA |
| Ga0137370_103714582 | 3300012285 | Vadose Zone Soil | MKATRVILAAMVLGTAVGASQANAQSCSGNAGTCNLTNTAQVIVPALVKLGM |
| Ga0137370_107674602 | 3300012285 | Vadose Zone Soil | MKATRSLLAAMGLGTAIGATQANAQCSGNAGTCNTTNT |
| Ga0137360_103164734 | 3300012361 | Vadose Zone Soil | MKATRFLLAAMVLGSAISVSQASAQCSGNAGGCLTVNTA |
| Ga0137413_105481822 | 3300012924 | Vadose Zone Soil | MSATRYLLAAMVLGSAISATQANAQCSGNAGGCLTVNTASATVN |
| Ga0137416_102831451 | 3300012927 | Vadose Zone Soil | MRATRSLLAAMVLGTAIGASQANAQCSGNAGTCNTTNVASVTVGAL |
| Ga0164300_108327951 | 3300012951 | Soil | MKATRIILAAMVLGTAIGASQANAQSCQSSAGSCVTTNTASVTV |
| Ga0164300_111167961 | 3300012951 | Soil | MNATRCILAAMVLGSAISVNQAGAQCSGNAGSCNTTNT |
| Ga0164299_108184001 | 3300012958 | Soil | MKATRTLLAAMVLGTAITASQASAQCSGTGSCNTTNTAS |
| Ga0134077_103055802 | 3300012972 | Grasslands Soil | MNATRSFLAAMVLGSAISVSQANAQCSGNAGGCLTVNTASATVNALVKLGMSAAA |
| Ga0120181_11017961 | 3300013766 | Permafrost | MSKATRSLLAAMVLGTAISASHANAQSSCGGIGSCNMTNTASVAVG |
| Ga0134078_101726992 | 3300014157 | Grasslands Soil | MKATRFLLAAMVLATAVGVTQAGAQCSGNAGSCNTTNTASVTVGNLVKLGMT |
| Ga0134078_106079461 | 3300014157 | Grasslands Soil | MNATRTLLAAMVLVSAIGVNQAGAQCSGNAGGCLTVNTASATVNALVKLGM |
| Ga0184605_101479091 | 3300018027 | Groundwater Sediment | MNATRFLLAAMVLGTAIGVEQANAQCSGNAGSCNTTNTASVS |
| Ga0184620_102051501 | 3300018051 | Groundwater Sediment | MNATRFLAAMVLGTAICAAQANAQSCSGTGTCNLTNTA |
| Ga0184619_100082294 | 3300018061 | Groundwater Sediment | MKATRLMAAMVLGTAIGASHANAQCSGNAGSCNTTNTASVTVGALVK |
| Ga0184619_103550281 | 3300018061 | Groundwater Sediment | MNATRILLAAMVLGTAIGVEQANAQCSGNAGSCNTTNTASVSVNAL |
| Ga0184617_10753132 | 3300018066 | Groundwater Sediment | MNATRFLLAAMVLGTAIGVEQVNAQCSGNAGSCNTTNTASVSVNALVKLGMSGVATSLTSPT |
| Ga0184618_101364892 | 3300018071 | Groundwater Sediment | MTATRFLLAAMVLGTAIGVEQANAQCTGNAGSCNTTNTASVSVNALVKLGMGGTATT |
| Ga0184618_101744451 | 3300018071 | Groundwater Sediment | MAAMLLGNAVAANHANAQCSGSGSCNTTNTASVSVNAVVKLGM |
| Ga0184618_104524341 | 3300018071 | Groundwater Sediment | MNATRSLLAAMVLGTAIGATQANAQCSGNAGTCNTTNTASVTVGSLV |
| Ga0184629_104904191 | 3300018084 | Groundwater Sediment | MNATRFLLAAMVLGTAIGVEQANAQCSGNAGSCNTTNTASVSVNALVKLGMSGVATSLTS |
| Ga0190272_109906082 | 3300018429 | Soil | MNSTRFVLAAMVLGTALGSSQANAQGCIGIGSCTATNTASVSVGALVKLDMSSATT |
| Ga0066669_103502841 | 3300018482 | Grasslands Soil | MNATRFLLAAMVLGSAISVTQADAQCSGNAGSCNTTNTASV |
| Ga0193748_10245591 | 3300019865 | Soil | MKATRNLLAAMVLGTAISASQANAQCSGNAGTCNTTNTASVTVGALVKLGMSSAATALTN |
| Ga0193722_10413911 | 3300019877 | Soil | MNATRFFMAVTVLASVLGANQANAQCSSNSGSCNTTNTASVTMNALVKLDMGSTTTSLTS |
| Ga0193722_10837471 | 3300019877 | Soil | MSATRYLLAAMVLGSAISATQANAQCSGNAGGCLTVNTAS |
| Ga0193715_10892002 | 3300019878 | Soil | MAAMVLGTAVAANHANAQCSGNSGSCNTTNTASVSVNAV |
| Ga0193692_10707341 | 3300020000 | Soil | MRATRTLLAAMVLGTAICASQANAQCSGNAGTCNTTNTASVTVGALVKLGMSSAATAL |
| Ga0193734_10029913 | 3300020015 | Soil | MRATRTLLAAMVLGTAIGASQANAQCSGNAGTCNTTNTA |
| Ga0193721_10948652 | 3300020018 | Soil | MNATRFLLAAMVLGTAIGVEQVNAQCSGNAGSCNTTNTASVSVNALVKLGMSG |
| Ga0193733_10545562 | 3300020022 | Soil | MSATRYLLAAMVLGSAISANQANAQCSGNAGGCLTVNTASATVNALVKLGMSGTTST |
| Ga0193745_10086101 | 3300020059 | Soil | MNATRTLLAAMVLGTAIGATQANAQCSGNAGTCNTTNTAS |
| Ga0193745_10385592 | 3300020059 | Soil | MNATRFLLAAMVLGTAIAGNQANAQCSGNAGSCFTTNTASV |
| Ga0206356_112179191 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MKATRTILAAMVLGTVIGASQANAQCTGNAGTCNTTNTASVTVGALVKLGMSSA |
| Ga0210382_104793412 | 3300021080 | Groundwater Sediment | MNATRFLLAAMVLGTAIGVEQANAQCSGNAGSCNTTNTASVSV |
| Ga0193694_10165822 | 3300021415 | Soil | MRATRTLLAAMVLGTAISASQANAQCSGNAGTCNTTNTASVTVGALVK |
| Ga0213880_102291962 | 3300021953 | Exposed Rock | MNATRFVLAAMVLGTAIGANQANAQCSGNAGSCNTTNTVS |
| Ga0193698_10133191 | 3300021968 | Soil | MRATQYLLAAMVLGTTIVASQANAQCSGNGGTCNTTNTASVTVGALVKLGMSSAVTTLTN |
| Ga0224452_11121971 | 3300022534 | Groundwater Sediment | MNATRTLLAAMVLGTAIGAVQANAQCSGNAGTCNTTNTASVTVGA |
| Ga0222622_100688411 | 3300022756 | Groundwater Sediment | MKATRTLLAAMVLGTAIGAVQANAQCSGNAGTCNTTNTASVT |
| Ga0222622_101284524 | 3300022756 | Groundwater Sediment | MNATRFLMAAMVLGTAIGVEANAQCSGNAGSCNTTNTASVSVNALVKLGMSG |
| Ga0247670_10789961 | 3300024283 | Soil | MSATRYLLAAMVLGSAISATQANAQCSGNAGGCLTVNTASATVNALVKLGMSGTTTT |
| Ga0247668_11023792 | 3300024331 | Soil | MSATRYLLAAMVLGSAISATQANAQCSGNAGGCLTVN |
| Ga0207929_10035923 | 3300025505 | Arctic Peat Soil | MRATRTLLAAMVLGTAIGASQANAQCSNGAGTCTTTNTA |
| Ga0207654_111581531 | 3300025911 | Corn Rhizosphere | MKATRTILAAMVLGTVIGASQANAQCTGNAGTCNT |
| Ga0207707_115604092 | 3300025912 | Corn Rhizosphere | MNATRFILAAMVLGTAIGAEQANAQCSGNAGTCNTTNTASVTLGAVVKLGMSSAATSLTA |
| Ga0207660_108633782 | 3300025917 | Corn Rhizosphere | MKATRSLLAAMVLATVGATTANAQCSGNAGSCNTTNT |
| Ga0207657_103794581 | 3300025919 | Corn Rhizosphere | MKATNSLLAAIALVSAIGATQANAQCSGNAGSCNTTNTASVTVGTLVKLGMSSAT |
| Ga0207706_116113311 | 3300025933 | Corn Rhizosphere | MKATRTLLAAMVLGTAIGASQASAQCSGNAGSCNTTNTASVTVGALVKLNELD |
| Ga0207686_114037702 | 3300025934 | Miscanthus Rhizosphere | MNATRFILAAMVIGSAICVNQAEAQCSGNGSCNLTNTVSASVNNLVKLQMTSAT |
| Ga0207704_113462662 | 3300025938 | Miscanthus Rhizosphere | MNATRFILAAMVLGSAISVNQASAQCSGNAGSCNTTNTVTASVNALVKLGMSSAATT |
| Ga0207704_113630541 | 3300025938 | Miscanthus Rhizosphere | MKATRNLLAAMVLGTAICASQASAQCSGNAGSCNTTNTASVTVGALVKLGMSSA |
| Ga0207651_112954401 | 3300025960 | Switchgrass Rhizosphere | MKATRTLLAAMVLVTAIGATSANAQCSGNAGTCNTTNTASVTVGALVKLGMSGT |
| Ga0207640_116456792 | 3300025981 | Corn Rhizosphere | MNATRFLAAMVLGTAIGVNQANAQCSGNAGSCNSTNTVSATVNALVKLGMSAATTTLSSPTA |
| Ga0207658_118107601 | 3300025986 | Switchgrass Rhizosphere | MNATRIILAAMVIGSAISVNQAGAQCSGNAGSCNSTNTASVTVNALVKLGMSSATTSLTS |
| Ga0207639_110536601 | 3300026041 | Corn Rhizosphere | MKATRTILAALVLGTVIGASQANAQCTGNAGTCNTT |
| Ga0209840_10329771 | 3300026223 | Soil | MRATRTLLAAMVLGTAIGASQANAQCSGSAGTCNTTN |
| Ga0209239_13592231 | 3300026310 | Grasslands Soil | MNATRFILAAMVLGSAISVNQAGAQCSGNAGSCNTTNTASVSVNALVKLGMSSAAT |
| Ga0209472_12942471 | 3300026323 | Soil | MKATRSLLAAMVLATAIGATEANAQCSGNAGSCNTTNTASVTVGALVKLGMSSATTTL |
| Ga0209056_107237691 | 3300026538 | Soil | MNATRSFLAAMVLVFAISANQASAQCSGNAGGCLTVNTASATVNALVKLGMGATATTLSS |
| Ga0209331_11601592 | 3300027603 | Forest Soil | MKATRLLLAAMVFGTVIGASQANAQGCSGANSCAGTN |
| Ga0209983_11337801 | 3300027665 | Arabidopsis Thaliana Rhizosphere | MKATRNLLAAMVLGTIITASQANAQCSGNAGSCNTTNTASVTVGALVKLGMSAATTSLTSPTADD |
| Ga0307293_101616701 | 3300028711 | Soil | MTATRFLLAAMVLGTAIGVEQANAQCSGNAGSCNTTNTAS |
| Ga0307293_101650451 | 3300028711 | Soil | MNATRTLLAAMVLGTAIGAVQANAQCSGNAGTCNTTNTASVTVG |
| Ga0307313_100825322 | 3300028715 | Soil | MNATRFLLAAMVLGTAIGVEQVNAQCSGNAGSCNTTNTASVSVNALVKLGMSGVATS |
| Ga0307282_101160222 | 3300028784 | Soil | MRATRSLLAAMVLGTAIGASQANAQCSGNAGTCNTTNTASVTVGALVKLDMTT |
| Ga0307299_100422541 | 3300028793 | Soil | MTATRFLLAAMVLGTAIGVEQANAQCSGNAGSCNTTNTASVSVNALVKLGMS |
| Ga0307284_102327082 | 3300028799 | Soil | MRATRTLLAAMVLGTAIGASQANAQCSGNAGTCNT |
| Ga0307305_100706201 | 3300028807 | Soil | MTATRFLLAAMVLGTAIGVEQANAQCSGNAGSCNTTN |
| Ga0307310_105478911 | 3300028824 | Soil | MNATRFLMAAMVLGTAIGVEANAQCSGNAGSCNTTNTASVSVNALV |
| Ga0307312_100040558 | 3300028828 | Soil | MNATRTLLAAMVLGTAIGAVQANAQCSGNAGTCNTTNTASVTVGALVK |
| Ga0307312_100912982 | 3300028828 | Soil | MNATRFLLAAMVLGTAIGVEQANAQCSGNAGSCNTTNTASVSVNALVK |
| Ga0307312_101226852 | 3300028828 | Soil | MKATRTLLAAMVLGTAIGAVQANAQCSGNAGTCNTTNTASVTVGALVK |
| Ga0307312_108102032 | 3300028828 | Soil | MNATRFLLAAMVLGTAIGVEQVNAQCSGNAGSCNTTNTASVSVNALVKLGMSGVATSLTS |
| Ga0310813_102770401 | 3300031716 | Soil | MFSSRLIAIALVVGSAVGAMPAMAQCSGSDSCSTTNTASVTVGALVNLEMSSAT |
| Ga0307469_102678091 | 3300031720 | Hardwood Forest Soil | MNATRFILAAMVLGSAIGVNQASAQCSGNAGSCNTTNTVSASVNALVKLGMSTAAT |
| Ga0307469_114252182 | 3300031720 | Hardwood Forest Soil | MNATRLILAAMVLGSAIGVNQASAQCSGNAGSCNTTNTASVSVNAL |
| Ga0307468_1021621701 | 3300031740 | Hardwood Forest Soil | MNATRFVLAAMVFGAAISVNQAGAQCSGNAGSCNTTNTASVSV |
| Ga0307468_1024867961 | 3300031740 | Hardwood Forest Soil | MKATRNLLAALVLGTVITASQANAQCSGNAGSCNTTNTASVTVG |
| Ga0307471_1005467431 | 3300032180 | Hardwood Forest Soil | MRATRSLLAAMVLGTAIGASQANAQCSGNAGTCNTTNTASVTVGALVKLGMSSA |
| Ga0372946_0107643_2_157 | 3300034384 | Soil | MKATRILLAAMVLGIVSASQANAQCSGNAGTCNTTNTASVTVGALVKLAMPT |
| ⦗Top⦘ |