Basic Information | |
---|---|
Family ID | F050559 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 145 |
Average Sequence Length | 45 residues |
Representative Sequence | LGDRQIVLTVDHRFALSNPALVSAPSKKLISALRAPCGIETGCR |
Number of Associated Samples | 137 |
Number of Associated Scaffolds | 145 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 99.31 % |
% of genes from short scaffolds (< 2000 bps) | 96.55 % |
Associated GOLD sequencing projects | 129 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.20 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (71.034 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (13.793 % of family members) |
Environment Ontology (ENVO) | Unclassified (26.897 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (41.379 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 11.11% β-sheet: 0.00% Coil/Unstructured: 88.89% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.20 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 145 Family Scaffolds |
---|---|---|
PF01548 | DEDD_Tnp_IS110 | 35.86 |
PF02371 | Transposase_20 | 35.86 |
PF01527 | HTH_Tnp_1 | 4.14 |
PF00665 | rve | 0.69 |
PF13384 | HTH_23 | 0.69 |
PF13751 | DDE_Tnp_1_6 | 0.69 |
PF13358 | DDE_3 | 0.69 |
PF13936 | HTH_38 | 0.69 |
PF13683 | rve_3 | 0.69 |
COG ID | Name | Functional Category | % Frequency in 145 Family Scaffolds |
---|---|---|---|
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 71.72 |
COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.69 |
COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.69 |
COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.69 |
COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.69 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 71.03 % |
Unclassified | root | N/A | 28.97 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000858|JGI10213J12805_10776287 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 950 | Open in IMG/M |
3300001305|C688J14111_10171507 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 670 | Open in IMG/M |
3300001305|C688J14111_10233802 | Not Available | 575 | Open in IMG/M |
3300001618|JGI20264J16347_10219 | Not Available | 868 | Open in IMG/M |
3300002077|JGI24744J21845_10108564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 515 | Open in IMG/M |
3300002244|JGI24742J22300_10014260 | Not Available | 1335 | Open in IMG/M |
3300002568|C688J35102_120441233 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1071 | Open in IMG/M |
3300002886|JGI25612J43240_1008333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1495 | Open in IMG/M |
3300002914|JGI25617J43924_10227779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 624 | Open in IMG/M |
3300002917|JGI25616J43925_10170961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 857 | Open in IMG/M |
3300005159|Ga0066808_1007185 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 956 | Open in IMG/M |
3300005165|Ga0066869_10047449 | Not Available | 746 | Open in IMG/M |
3300005294|Ga0065705_10233574 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1262 | Open in IMG/M |
3300005332|Ga0066388_100529949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1810 | Open in IMG/M |
3300005339|Ga0070660_101855104 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 514 | Open in IMG/M |
3300005341|Ga0070691_10063629 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1778 | Open in IMG/M |
3300005344|Ga0070661_101903980 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 506 | Open in IMG/M |
3300005354|Ga0070675_100668714 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 944 | Open in IMG/M |
3300005438|Ga0070701_10676849 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 691 | Open in IMG/M |
3300005535|Ga0070684_100653893 | Not Available | 978 | Open in IMG/M |
3300005539|Ga0068853_101564809 | Not Available | 639 | Open in IMG/M |
3300005543|Ga0070672_100784783 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 838 | Open in IMG/M |
3300005552|Ga0066701_10798118 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 563 | Open in IMG/M |
3300005615|Ga0070702_101806729 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 511 | Open in IMG/M |
3300005618|Ga0068864_101073154 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 801 | Open in IMG/M |
3300005718|Ga0068866_10070958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1840 | Open in IMG/M |
3300005842|Ga0068858_100226213 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1773 | Open in IMG/M |
3300005983|Ga0081540_1128286 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1040 | Open in IMG/M |
3300006028|Ga0070717_11202859 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 690 | Open in IMG/M |
3300006047|Ga0075024_100040320 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1930 | Open in IMG/M |
3300006057|Ga0075026_100624528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 636 | Open in IMG/M |
3300006102|Ga0075015_100683671 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 607 | Open in IMG/M |
3300006102|Ga0075015_100736033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 587 | Open in IMG/M |
3300006175|Ga0070712_100194167 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1590 | Open in IMG/M |
3300006640|Ga0075527_10049429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1134 | Open in IMG/M |
3300006640|Ga0075527_10050215 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1125 | Open in IMG/M |
3300006640|Ga0075527_10171021 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 618 | Open in IMG/M |
3300006844|Ga0075428_100296533 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1739 | Open in IMG/M |
3300006852|Ga0075433_11921981 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 507 | Open in IMG/M |
3300009088|Ga0099830_11038397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 131 | 679 | Open in IMG/M |
3300009177|Ga0105248_12000982 | Not Available | 658 | Open in IMG/M |
3300009545|Ga0105237_12408664 | Not Available | 537 | Open in IMG/M |
3300009643|Ga0116110_1200682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 647 | Open in IMG/M |
3300010159|Ga0099796_10006561 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2987 | Open in IMG/M |
3300010397|Ga0134124_10210142 | Not Available | 1771 | Open in IMG/M |
3300010398|Ga0126383_13415115 | Not Available | 519 | Open in IMG/M |
3300011271|Ga0137393_10384063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 131 | 1202 | Open in IMG/M |
3300012203|Ga0137399_10270594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1397 | Open in IMG/M |
3300012359|Ga0137385_11316086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 585 | Open in IMG/M |
3300012361|Ga0137360_10239146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1486 | Open in IMG/M |
3300012362|Ga0137361_10351280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1353 | Open in IMG/M |
3300012469|Ga0150984_122704561 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1771 | Open in IMG/M |
3300012509|Ga0157334_1070734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 524 | Open in IMG/M |
3300012923|Ga0137359_10189765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1835 | Open in IMG/M |
3300012924|Ga0137413_10096278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1835 | Open in IMG/M |
3300012924|Ga0137413_11031713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 131 | 647 | Open in IMG/M |
3300012939|Ga0162650_100062970 | Not Available | 623 | Open in IMG/M |
3300012951|Ga0164300_11203169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 502 | Open in IMG/M |
3300012984|Ga0164309_10707668 | Not Available | 800 | Open in IMG/M |
3300012987|Ga0164307_11746120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 527 | Open in IMG/M |
3300013297|Ga0157378_10750103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 999 | Open in IMG/M |
3300014042|Ga0117790_1020656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum | 1531 | Open in IMG/M |
3300014200|Ga0181526_10109252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1768 | Open in IMG/M |
3300014200|Ga0181526_10816870 | Not Available | 587 | Open in IMG/M |
3300014498|Ga0182019_10451183 | Not Available | 884 | Open in IMG/M |
3300015372|Ga0132256_101357923 | Not Available | 823 | Open in IMG/M |
3300015374|Ga0132255_100412422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1969 | Open in IMG/M |
3300015374|Ga0132255_102607814 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 131 | 772 | Open in IMG/M |
3300017792|Ga0163161_10118953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1983 | Open in IMG/M |
3300017792|Ga0163161_10832804 | Not Available | 777 | Open in IMG/M |
3300018017|Ga0187872_10070145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1817 | Open in IMG/M |
3300018026|Ga0187857_10054905 | Not Available | 2028 | Open in IMG/M |
3300018034|Ga0187863_10825718 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 526 | Open in IMG/M |
3300018052|Ga0184638_1057466 | Not Available | 1420 | Open in IMG/M |
3300018076|Ga0184609_10154044 | Not Available | 1059 | Open in IMG/M |
3300018469|Ga0190270_10817825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 131 | 940 | Open in IMG/M |
3300018481|Ga0190271_13843864 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 502 | Open in IMG/M |
3300019789|Ga0137408_1322612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1681 | Open in IMG/M |
3300019886|Ga0193727_1162220 | Not Available | 595 | Open in IMG/M |
3300020000|Ga0193692_1016006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1810 | Open in IMG/M |
3300020581|Ga0210399_10166824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1824 | Open in IMG/M |
3300021078|Ga0210381_10016689 | Not Available | 1886 | Open in IMG/M |
3300021384|Ga0213876_10249414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 943 | Open in IMG/M |
3300021406|Ga0210386_10539215 | Not Available | 1008 | Open in IMG/M |
3300022756|Ga0222622_10113131 | Not Available | 1692 | Open in IMG/M |
3300025509|Ga0208848_1035548 | All Organisms → cellular organisms → Bacteria | 1081 | Open in IMG/M |
3300025898|Ga0207692_10332199 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 933 | Open in IMG/M |
3300025915|Ga0207693_10165517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1741 | Open in IMG/M |
3300025920|Ga0207649_10792103 | Not Available | 739 | Open in IMG/M |
3300025930|Ga0207701_11331862 | Not Available | 587 | Open in IMG/M |
3300025932|Ga0207690_10559328 | Not Available | 930 | Open in IMG/M |
3300025933|Ga0207706_10169204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1920 | Open in IMG/M |
3300025941|Ga0207711_12072088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 511 | Open in IMG/M |
3300026075|Ga0207708_11318976 | Not Available | 632 | Open in IMG/M |
3300026095|Ga0207676_10598814 | Not Available | 1058 | Open in IMG/M |
3300026285|Ga0209438_1003871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 5083 | Open in IMG/M |
3300026340|Ga0257162_1035951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 615 | Open in IMG/M |
3300026377|Ga0257171_1010280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1524 | Open in IMG/M |
3300026480|Ga0257177_1006016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1491 | Open in IMG/M |
3300026498|Ga0257156_1015441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1488 | Open in IMG/M |
3300026721|Ga0208841_100433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1141 | Open in IMG/M |
3300026984|Ga0208732_1001311 | Not Available | 1714 | Open in IMG/M |
3300026995|Ga0208761_1000490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1805 | Open in IMG/M |
3300027065|Ga0208489_1000370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1804 | Open in IMG/M |
3300027073|Ga0208366_1001820 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1805 | Open in IMG/M |
3300027108|Ga0207946_100347 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1823 | Open in IMG/M |
3300027173|Ga0208097_1002309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1810 | Open in IMG/M |
3300027480|Ga0208993_1008079 | Not Available | 1789 | Open in IMG/M |
3300027523|Ga0208890_1003561 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1770 | Open in IMG/M |
3300027701|Ga0209447_10023002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1747 | Open in IMG/M |
3300027729|Ga0209248_10027603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1768 | Open in IMG/M |
3300027737|Ga0209038_10173386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 653 | Open in IMG/M |
3300027894|Ga0209068_10412374 | Not Available | 771 | Open in IMG/M |
3300027903|Ga0209488_10203456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1491 | Open in IMG/M |
3300027915|Ga0209069_10053915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1892 | Open in IMG/M |
3300028592|Ga0247822_11607127 | Not Available | 551 | Open in IMG/M |
3300028665|Ga0302160_10005849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum | 2029 | Open in IMG/M |
3300028678|Ga0302165_10042942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum | 1201 | Open in IMG/M |
3300028704|Ga0307321_1005919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2031 | Open in IMG/M |
3300028711|Ga0307293_10072082 | Not Available | 1086 | Open in IMG/M |
3300028713|Ga0307303_10008068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1815 | Open in IMG/M |
3300028722|Ga0307319_10024522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1851 | Open in IMG/M |
3300028786|Ga0307517_10661096 | Not Available | 507 | Open in IMG/M |
3300028792|Ga0307504_10029190 | Not Available | 1445 | Open in IMG/M |
3300028793|Ga0307299_10034386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1848 | Open in IMG/M |
3300028799|Ga0307284_10032176 | Not Available | 1760 | Open in IMG/M |
3300028819|Ga0307296_10204224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1072 | Open in IMG/M |
3300028824|Ga0307310_10108885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1240 | Open in IMG/M |
3300028876|Ga0307286_10046254 | Not Available | 1469 | Open in IMG/M |
3300028885|Ga0307304_10032299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1849 | Open in IMG/M |
3300029987|Ga0311334_11556143 | Not Available | 560 | Open in IMG/M |
3300030019|Ga0311348_10646201 | Not Available | 789 | Open in IMG/M |
3300030618|Ga0311354_11801965 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 532 | Open in IMG/M |
3300030855|Ga0075374_11327803 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 697 | Open in IMG/M |
3300031090|Ga0265760_10034900 | Not Available | 1488 | Open in IMG/M |
3300031231|Ga0170824_109084180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 566 | Open in IMG/M |
3300031474|Ga0170818_102952974 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1150 | Open in IMG/M |
3300031521|Ga0311364_10357591 | Not Available | 1484 | Open in IMG/M |
3300031680|Ga0318574_10513618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 131 | 702 | Open in IMG/M |
3300031724|Ga0318500_10589177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 563 | Open in IMG/M |
3300031744|Ga0306918_10141989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1764 | Open in IMG/M |
3300031962|Ga0307479_11814689 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 561 | Open in IMG/M |
3300032160|Ga0311301_10445815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1952 | Open in IMG/M |
3300032205|Ga0307472_101737899 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 617 | Open in IMG/M |
3300034115|Ga0364945_0076224 | Not Available | 963 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 13.79% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.28% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.21% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.52% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.83% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.14% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 3.45% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.45% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.76% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 2.76% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.76% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.07% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.07% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.07% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.07% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.38% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.38% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.38% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.38% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.38% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.38% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.38% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.38% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.38% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.38% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.38% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.69% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.69% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.69% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.69% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.69% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.69% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.69% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.69% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.69% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.69% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.69% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.69% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.69% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.69% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.69% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.69% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.69% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.69% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.69% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.69% |
Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.69% |
Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.69% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.69% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.69% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.69% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.69% |
Epidermal Mucus | Host-Associated → Fish → Skin → Epidermal Mucus → Unclassified → Epidermal Mucus | 0.69% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000858 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300001618 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF030 | Environmental | Open in IMG/M |
3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Host-Associated | Open in IMG/M |
3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Host-Associated | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300002886 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm | Environmental | Open in IMG/M |
3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
3300005159 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPB | Environmental | Open in IMG/M |
3300005165 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC | Environmental | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006640 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11B | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009643 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012509 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_6 | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012939 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t1i015 | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300014042 | Epidermal mucus viral and microbial communities from European eel in Spain - Ebro delta (0.22 um filter) | Host-Associated | Open in IMG/M |
3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
3300020000 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a1 | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300025509 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026340 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-A | Environmental | Open in IMG/M |
3300026377 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-B | Environmental | Open in IMG/M |
3300026480 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-B | Environmental | Open in IMG/M |
3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
3300026721 | Forest soil microbial communities from Willamette National Forest, Oregon, USA, amended with Nitrogen - NN395 (SPAdes) | Environmental | Open in IMG/M |
3300026984 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF048 (SPAdes) | Environmental | Open in IMG/M |
3300026995 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAB (SPAdes) | Environmental | Open in IMG/M |
3300027065 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF006 (SPAdes) | Environmental | Open in IMG/M |
3300027073 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF010 (SPAdes) | Environmental | Open in IMG/M |
3300027108 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF030 (SPAdes) | Environmental | Open in IMG/M |
3300027173 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF036 (SPAdes) | Environmental | Open in IMG/M |
3300027480 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027523 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA (SPAdes) | Environmental | Open in IMG/M |
3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
3300028665 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_3 | Environmental | Open in IMG/M |
3300028678 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E3_2 | Environmental | Open in IMG/M |
3300028704 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_379 | Environmental | Open in IMG/M |
3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
3300028713 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184 | Environmental | Open in IMG/M |
3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Host-Associated | Open in IMG/M |
3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
3300030019 | II_Fen_E2 coassembly | Environmental | Open in IMG/M |
3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030855 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA9 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300034115 | Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI10213J12805_107762872 | 3300000858 | Soil | TVDHRFALSNPALVSAPSKKLISALRAPCGIETGCR* |
C688J14111_101715072 | 3300001305 | Soil | RQIVFTVDHRFALSNPALVSAPSKKLITALLAPCGIETSCR* |
C688J14111_102338022 | 3300001305 | Soil | PRLPGDRQIVRAVDHRFALSRPALLSAPSKKLTAALHAPCGIETSIR* |
JGI20264J16347_102192 | 3300001618 | Forest Soil | KNLGLLGDRKIVPAVDHRFALSNPALVSAPSKKLISAVRAPCGVETEGR* |
JGI24744J21845_101085641 | 3300002077 | Corn, Switchgrass And Miscanthus Rhizosphere | TATADAQNQCLLGDRQIVLTVDHRFTLNKPALPSAPSKKLTTALHAPCGIETSSR* |
JGI24742J22300_100142601 | 3300002244 | Corn, Switchgrass And Miscanthus Rhizosphere | VLTVDHRFTLNKPALPSAPSKKLTTALHAPCGIETSSR* |
C688J35102_1204412331 | 3300002568 | Soil | RLLGDRQIVCTVDHRFALSNPALVSAPSKKLITALLAPCGIETSCR* |
JGI25612J43240_10083331 | 3300002886 | Grasslands Soil | FRLLDDRQIVLAVDHRFALSNPALVSAPSKKLISALRDPCGIETGWR* |
JGI25617J43924_102277792 | 3300002914 | Grasslands Soil | LGDRQIVLAVDHRFALSNPALVSAPSKKLISALRDPCGIETGWR* |
JGI25616J43925_101709612 | 3300002917 | Grasslands Soil | VRLLGDRQIVLAVDHRFALSNPALVSAPSKKLISALLPPCGIETG* |
Ga0066808_10071851 | 3300005159 | Soil | IVPAVDHRFALSNPALVSAPSKKLISALRAPCGVETEGLD* |
Ga0066869_100474491 | 3300005165 | Soil | KNLGLLGDRQIVPAVDHRFALSNPALVSAPSKKLISAVRAPCGVETEGR* |
Ga0065705_102335741 | 3300005294 | Switchgrass Rhizosphere | RLLADRQIVLTVDHRFALSNPALVSAPSKKLISALRAPCGIETGCR* |
Ga0066388_1005299491 | 3300005332 | Tropical Forest Soil | DGQIVLTVDHRFALSNPALVSATSKKPISALRAPCGVETEGLD* |
Ga0070660_1018551041 | 3300005339 | Corn Rhizosphere | ADAQNLGLLADRQVVSAVNHRFALSNPALVSAPSKKLISALRAPCGVETEGR* |
Ga0070691_100636292 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | GDRQIVRAVDHRFALSRPALLSAPSKKLTTALHAPCGIETSSR* |
Ga0070661_1019039801 | 3300005344 | Corn Rhizosphere | DRQIMLAVDHRFALSNPALVSAPSKKLISARHAPCGIETDWR* |
Ga0070675_1006687142 | 3300005354 | Miscanthus Rhizosphere | QNLRLLADRQIVLTVDHRFALSNPALVSAPSKKLISALRAPCGIETGCR* |
Ga0070701_106768491 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | AAADAQNLRLLADRQIVLTVDHRFALSNPALVSAPSKKLISALRAPCGIETGCR* |
Ga0070684_1006538932 | 3300005535 | Corn Rhizosphere | VQRRRLLRDRQIVRTVDHRFALNRPALPSAPSKKLTTALHASCGIETSSR* |
Ga0068853_1015648092 | 3300005539 | Corn Rhizosphere | LLGDRQIVLTVDHRFALSNPALVSASSKKLISARHAPCGIETDWR* |
Ga0070672_1007847831 | 3300005543 | Miscanthus Rhizosphere | LGDRQIVLTVDHRFALSNPALVSAPSKKLISALRAPCGIETGCR* |
Ga0066701_107981181 | 3300005552 | Soil | GDRQIVLTVDHRFALSNPALVSAPSKKLISALHAPCGIETGWR* |
Ga0070702_1018067291 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | VVSAVDHRFALSNPALVSAPSKKLISALRAPCGVETEGR* |
Ga0068864_1010731541 | 3300005618 | Switchgrass Rhizosphere | MLAVDHRFALSNPALVSAPSKKLCAALRSPCGIETGRR* |
Ga0068866_100709583 | 3300005718 | Miscanthus Rhizosphere | GDRQIVLTVDHRFTLNKPALPSAPSKKLTTALHAPCGIETSSR* |
Ga0068858_1002262132 | 3300005842 | Switchgrass Rhizosphere | LLGDRQIVLTVDHRFALSNPALVSAPSKKLCAALRSPSGIETGRR* |
Ga0081540_11282861 | 3300005983 | Tabebuia Heterophylla Rhizosphere | LQNFRLFRDRQLVLTVDHRFALSRPALLSAPSKKTILALRAPCGDRNGQC* |
Ga0070717_112028592 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LQNLCLLGDRQIVLTVDHRFALSNPALVSAPSKKLLSALHAPCGIETGW* |
Ga0075024_1000403201 | 3300006047 | Watersheds | LLGDRQIVLTVDHRFALSNPALVSAPSKKLISALRDPCGIETGWR* |
Ga0075026_1006245282 | 3300006057 | Watersheds | RLLGDRQIVLTVDHRFAFSNPALLSAPSKKLSAALRVPCGIETGRLRVGRERPI* |
Ga0075015_1006836711 | 3300006102 | Watersheds | IVPAVDHRFALSNPALVSAPSKKLISAVRAPCGVETEGR* |
Ga0075015_1007360331 | 3300006102 | Watersheds | ERLGLPGDRQVVLTVDHRLALSNPALVSAPSKKLSAARPAACGIETGSR* |
Ga0070712_1001941671 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | NLCLLGDRQIVLTVDHRFALSNPALVSAPSKKLLSALHAPCGIETGW* |
Ga0075527_100494291 | 3300006640 | Arctic Peat Soil | ATADVQSFRLFRDCQVVLTVDHRLALSKPALPSAPSKKLSSALRAPCGERNGQC* |
Ga0075527_100502151 | 3300006640 | Arctic Peat Soil | VDHRFALSKPALVSAPSKKLSAALRASCGIETGSR* |
Ga0075527_101710212 | 3300006640 | Arctic Peat Soil | VVRSVDHRFALSKPALVSAPSKKLSAALRASCGIETGSR* |
Ga0075428_1002965332 | 3300006844 | Populus Rhizosphere | IVLTVDHRFALSNPALVSAPSKKLISALRAPCGIETGCR* |
Ga0075433_119219811 | 3300006852 | Populus Rhizosphere | RLPGDRQIVRAVDHRFSLSRPALLSAPSKKLTTALHAPCGIETSSR* |
Ga0099830_110383972 | 3300009088 | Vadose Zone Soil | AAADLQNFRLLDDRQIVLAVDHRFALSNPALVSAPSKKLISALRDPCGIETGWR* |
Ga0105248_120009822 | 3300009177 | Switchgrass Rhizosphere | LTVDHRFALSNPALVSAPSKKLISALRAPCGIETGCR* |
Ga0105237_124086642 | 3300009545 | Corn Rhizosphere | RQIVLTVDHRFALSNPALVSASSKKLISARHAPCGIETDWR* |
Ga0116110_12006822 | 3300009643 | Peatland | GDRQIVRTVDHRLALSSPALLSAPSKKLCTALRAPCGIETGWG* |
Ga0099796_100065615 | 3300010159 | Vadose Zone Soil | LQNFRLLDDRQIVLAVDHRFALSNPALVSAPSKKLISALRDPCGIETGWR* |
Ga0134124_102101421 | 3300010397 | Terrestrial Soil | DRQVVPAVDHRFALSNPALVSAPSKKLISAVRAPCGVETEGR* |
Ga0126383_134151152 | 3300010398 | Tropical Forest Soil | DRQVVLTVDHRFALSRPALLSAPSKKLSAALRAPCGIETGNR* |
Ga0137393_103840631 | 3300011271 | Vadose Zone Soil | VDHRFALSNPALVSAPSKKLISALRDPCGIETGWR* |
Ga0137399_102705941 | 3300012203 | Vadose Zone Soil | DAAAADLQNFRLLDDRQIVLAVDHRFALSNPALVSAPSKKLISALRDPCGIETGWR* |
Ga0137385_113160862 | 3300012359 | Vadose Zone Soil | LGDRQIVSTVDHRFALSNPALVSAPSKKLVTALRAPCGVETGWR* |
Ga0137360_102391462 | 3300012361 | Vadose Zone Soil | TVDHRFALSNPALVSAPSKKLISALRDPCGIETGWR* |
Ga0137361_103512801 | 3300012362 | Vadose Zone Soil | MFTVDHRFALSNPALVSAPSKKLISALLAPCGIETH |
Ga0150984_1227045612 | 3300012469 | Avena Fatua Rhizosphere | PRLLGDRQIVCTVDHRFALSNPALVSAPSKKLITALLAPCGIETSCR* |
Ga0157334_10707341 | 3300012509 | Soil | AVDHRFALSRPALLSAPSKKLTTALHAPCGIETSSR* |
Ga0137359_101897653 | 3300012923 | Vadose Zone Soil | QNFRLLGDRQIVLTVDHRFALSNPALVSAPSKKLCAALRSPCGIETGRR* |
Ga0137413_100962783 | 3300012924 | Vadose Zone Soil | VQGFCLLGDRQVVRTVDHRFALSNPALVSAPSKKLVTAPRAPCGIETGWR* |
Ga0137413_110317132 | 3300012924 | Vadose Zone Soil | AVDHRFALSNPALVSAPSKKLISALRDPCGIETGWR* |
Ga0162650_1000629702 | 3300012939 | Soil | VRAVDHRFALSRPALLSAPSKKLITALHAPCGIETSSL* |
Ga0164300_112031692 | 3300012951 | Soil | GDRQIVFTVDHRFALSNPALVSAPSKKLITARHAPCGIETGCR* |
Ga0164309_107076681 | 3300012984 | Soil | RLLRDRQIVRTVDHRFALNRPALPSAPSKKLTTALHASCGIETSSR* |
Ga0164307_117461202 | 3300012987 | Soil | GDRKIVPAVDHRFALSNPALVSAPSKKRISAVRAPCGVETEGR* |
Ga0157378_107501031 | 3300013297 | Miscanthus Rhizosphere | QNLGLLGDRQIVLTVDHRFALSNPALVSAPSKKLISALRAPCGIETGCR* |
Ga0117790_10206562 | 3300014042 | Epidermal Mucus | XXXDRQFVLAVDHRFALSNPALLSAPSKKLISALRAPCGIETGWR* |
Ga0181526_101092522 | 3300014200 | Bog | VQSFRLLGDRQIVRTVDHRLALSSPALLSAPSKKLCTALRAPCGIETGWG* |
Ga0181526_108168701 | 3300014200 | Bog | LINFTNLRLTDDGKIVITVDHRFALSMPALMSAPSKKLSAALRASCGIETDKVAR |
Ga0182019_104511831 | 3300014498 | Fen | PTDVQRLRLPDEGEFVIPVDHRFALSKPALVSAPSKKLGAARRASCGIETGRR* |
Ga0132256_1013579233 | 3300015372 | Arabidopsis Rhizosphere | ADRQVVPAVDHRLALSNPALVSAPSKKLISALRASCGVETEGR* |
Ga0132255_1004124223 | 3300015374 | Arabidopsis Rhizosphere | AAAADVQSFRLSGDRQIVRTVNHRFALSRPALLSAPSKKLITALHAPCGIETSSL* |
Ga0132255_1026078141 | 3300015374 | Arabidopsis Rhizosphere | TVDHRFALSNPALVSAPSKKLSAALRAPCGIETCRR* |
Ga0163161_101189531 | 3300017792 | Switchgrass Rhizosphere | QIVLTVDHRFALSNPALVSAPSKKLGAALRAPCGIETG |
Ga0163161_108328041 | 3300017792 | Switchgrass Rhizosphere | LLGDRQIVLTVDHRFTLNKPALPSAPSKKLTTALHAPCGIETSSR |
Ga0187872_100701451 | 3300018017 | Peatland | LGDGQIVLTVDHRFALSNPALVSAPSKKLCTALRAPCGIETGWG |
Ga0187857_100549051 | 3300018026 | Peatland | LLGDGQIVLTVDHRFALSNPALVSAPSKKLCTALRAPCGIETGWG |
Ga0187863_108257181 | 3300018034 | Peatland | QIVPAVDHRFALSNPALVSAPSKKLSTALRAPCRIETG |
Ga0184638_10574662 | 3300018052 | Groundwater Sediment | ATDLQNFRLPGDRQIVLTVDHRFALSNPALVSAPSKKLISALHAPCGIETGWR |
Ga0184609_101540442 | 3300018076 | Groundwater Sediment | TVDHRFALSNPALVSAPSKKLTTALHAPCGIETSSR |
Ga0190270_108178252 | 3300018469 | Soil | VLTVDHRFALSNPALVSAPSKKLISALRAPCGIETGCR |
Ga0190271_138438642 | 3300018481 | Soil | SRQRQNLALPGHRQIMRTVDHPFALSNPALLSAPSKKLSAVLRAPCGIETGCR |
Ga0137408_13226122 | 3300019789 | Vadose Zone Soil | FTVDHRFALSNPALVSAPSKKLISALRDPCGIETGWR |
Ga0193727_11622201 | 3300019886 | Soil | IMLAVDHRFALSNPALVSAPSKKLILALRAPCGDRNGKC |
Ga0193692_10160063 | 3300020000 | Soil | ATADAQNLCLLGDRQIVLTVDHRFALNKPALPSAPSKKLTTALHAPCGIETSSR |
Ga0210399_101668241 | 3300020581 | Soil | NFGLLGDRQIMFTVDHRFALSNPALVSAPSKKLCAALRSPCGIETGRR |
Ga0210381_100166891 | 3300021078 | Groundwater Sediment | DTATADAQNLRLLGDRQIVLTVDHRFALSNPALVSAPSKKLTTALHAPCGIETSSR |
Ga0213876_102494141 | 3300021384 | Plant Roots | GAVDHRFALSNPALVSAPSKKLITALAAPCGIETGYR |
Ga0210386_105392152 | 3300021406 | Soil | DAKNLGLLGDRKIVPAVDHRFALSNPALVSAPSKKLISAVRAPCGVETEGR |
Ga0222622_101131312 | 3300022756 | Groundwater Sediment | DRQIMLAVDHRFALSNPALVSAPSKKLILALRAPCGDRNGKC |
Ga0208848_10355481 | 3300025509 | Arctic Peat Soil | REVVRSVDHRFALSKPALVSAPSKKLSAALRASCGIETGSR |
Ga0207692_103321992 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | IVLTVDHRFALSNPALVSAPSKKLLSALHAPCGIETGW |
Ga0207693_101655171 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | NLCLLGDRQIVLTVDHRFALSNPALVSAPSKKLLSALHAPCGIETGW |
Ga0207649_107921031 | 3300025920 | Corn Rhizosphere | PGDREIVRAVDHRFALSRPALLSAPSKKLTTALHAPCGIETSSR |
Ga0207701_113318622 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | RLLADRQIVLTVDHRFALSNPALVSAPSKKLISALRAPCGIETGCR |
Ga0207690_105593282 | 3300025932 | Corn Rhizosphere | DRQAVSAVDHRFALSNPALVSAPSKKLISALRAPCGVETEGR |
Ga0207706_101692043 | 3300025933 | Corn Rhizosphere | QNFRLPGDRQIMLAVDHRFALSNPALVSAPSKKLCAALRSPCGIETGRR |
Ga0207711_120720882 | 3300025941 | Switchgrass Rhizosphere | RQVVSAVDHRFALSNPALVSARSKKPISAVHAPCGVETEGR |
Ga0207708_113189762 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | TATADAQNQCLLGDRQIVLTVDHRFTLNKPALPSAPSKKLTTALHAPCGIETSSR |
Ga0207676_105988142 | 3300026095 | Switchgrass Rhizosphere | RQIVPAVDHRFALSNPALVSALSKKYLGGCSPPVGIETDGS |
Ga0209438_10038719 | 3300026285 | Grasslands Soil | AAAADLQNFRLLDDRQIVLAVDHRFALSNPALVSAPSKKLISALRDPCGIETGWR |
Ga0257162_10359511 | 3300026340 | Soil | PAVDHRFALSNPALVSAPSKKLISAVRAPCGVETEGR |
Ga0257171_10102802 | 3300026377 | Soil | NFRLLDDRQIVLAVDHRFALSNPALVSAPSKKLISALRDPCGIETGWR |
Ga0257177_10060162 | 3300026480 | Soil | LTVDHRFALSNPALVSAPSKKLISALRDPCGIETGWR |
Ga0257156_10154412 | 3300026498 | Soil | TVDHRFALSNPALVSAPSKKLISALRDPCGIETGWR |
Ga0208841_1004332 | 3300026721 | Soil | IVLTVDHRFALSHPALVSAPSKKLCAALRSPCGIETGRR |
Ga0208732_10013111 | 3300026984 | Forest Soil | KNLGLLGDRKIVPAVDHRFALSNPALVSAPSKKLISAVRAPCGLETEGR |
Ga0208761_10004901 | 3300026995 | Soil | LGDRKIVPAVDHRFALRNPALVSAPSKKLISAVRAPCGVETEGR |
Ga0208489_10003703 | 3300027065 | Forest Soil | LGLLGDRQIVPAVDHRFALSNPALVSAPSKKLISAVRAPCGLETEGR |
Ga0208366_10018201 | 3300027073 | Forest Soil | KNLGLLGDRKIVPAVDHRFALSNPALVSAPSKKLISAVRAPCGVETEGR |
Ga0207946_1003471 | 3300027108 | Forest Soil | NLGLLGDRKIVPAVDHRFALSNPALVSAPSKKLISAVRAPCGVETEGR |
Ga0208097_10023093 | 3300027173 | Forest Soil | KNLGLLGDRQIVPAVDHRFALSNPALVSAPSKKLISAVRAPCGLETEGR |
Ga0208993_10080794 | 3300027480 | Forest Soil | QRRRLLCERQIVRTVDHRFALNRPALLSAPSKKLSAALRAPCGE |
Ga0208890_10035611 | 3300027523 | Soil | VDHRFALSNPALVSAPSKKLISAVRAPCGVETEGR |
Ga0209447_100230021 | 3300027701 | Bog Forest Soil | ERLGLPGDRQVVLTVDHRLALSNPALVSAPSKKLSAARPAACGIETGSR |
Ga0209248_100276031 | 3300027729 | Bog Forest Soil | RLGLPGDRQVVLTVDHRLALSNPALVSAPSKKLSAARPAACGIETGSR |
Ga0209038_101733862 | 3300027737 | Bog Forest Soil | GDRQVVLTVDHRLALSNPALVSAPSKKLSAARPAACGIETGSR |
Ga0209068_104123742 | 3300027894 | Watersheds | IVLTVDHRFALSNPALVSAPSKKLISALHAPCGIETGLR |
Ga0209488_102034561 | 3300027903 | Vadose Zone Soil | RLLDDRQIVLAVDHRFALSNPALVSAPSKKLISALRDPCGIETGWR |
Ga0209069_100539151 | 3300027915 | Watersheds | QNLCLLGDRQIVLTVDHRFALSNPALVSAPSKKLISALRDPCGIETGWR |
Ga0247822_116071272 | 3300028592 | Soil | LTVDHRFALNNPALVSAPSKKLTTALHAPCGIETSSR |
Ga0302160_100058491 | 3300028665 | Fen | DLQNLSLPGDRQIVLTVDHRFALSNPALVSAPSKKLISALRAPCGIETGLR |
Ga0302165_100429421 | 3300028678 | Fen | GDRQIVLTVDHRFALSNPALVSAPSKKLISALRAPCGIETGLR |
Ga0307321_10059193 | 3300028704 | Soil | TATADAQNLCLLGDRQIVLTVDHRFALNKPALPSAPSKKLTTALHAPCGIETSSR |
Ga0307293_100720821 | 3300028711 | Soil | DAQNPRLPRDRQVVLTVDHRFALSNPALVSAPSKKLSTALRAPCGIETGSS |
Ga0307303_100080681 | 3300028713 | Soil | ADAQNLRLLGDRQIVLTVDHRFALSNPALVSAPSKKLTTALHAPCGIETSSR |
Ga0307319_100245223 | 3300028722 | Soil | DTADAQNLCLLGDRQIVLTVDHRFALNKPALPSAPSKKLTTALHAPCGIETSSR |
Ga0307517_106610961 | 3300028786 | Ectomycorrhiza | NFRLPGDRQIMLAVDHRFALSNPALVSAPSKKLILALRAPCGDRNGKC |
Ga0307504_100291902 | 3300028792 | Soil | TKNLGLLGDRQIVPAVDHRFALSNPALVSAPSKKLISAVRAPCGVETEGR |
Ga0307299_100343863 | 3300028793 | Soil | ADAQNVRLLCDRQVVLTVDHRFALSNPALLSAPSKKLSTALRAPCGIETGSS |
Ga0307284_100321761 | 3300028799 | Soil | TADAQNLRLLGDRQIVLTVDHRFALSNPALVSAPSKKLTTALHAPCGIETSSR |
Ga0307296_102042241 | 3300028819 | Soil | QNVRLLGDRQIVLAVDHRFALSNPALVSAPSKKLISALLPPCGIETG |
Ga0307310_101088851 | 3300028824 | Soil | NLHLFCDRQIVLAVDHRLALSNPALLSAPSKKLVTALRAPCGIETGSR |
Ga0307286_100462542 | 3300028876 | Soil | QNFRLPGDRQIMLAVDHRFALSNPALVSAPSKKLILALRAPCGDRNGKC |
Ga0307304_100322993 | 3300028885 | Soil | ATADAQNLRLLGDRQIVLTVDHRFALSNPALVSAPSKKLTTALHAPCGIETSSR |
Ga0311334_115561431 | 3300029987 | Fen | TVDHRFALSNPALVSAPSKKLILALRAPCGIETGLR |
Ga0311348_106462011 | 3300030019 | Fen | VLTVDHRFALSNPALVSAPSKKLSAALRAPCGIETGLR |
Ga0311354_118019652 | 3300030618 | Palsa | DTATADLQRFGLSGDRKVVLTVDHRFALSRPALLSAPSKKTISALFAPCGIETGGC |
Ga0075374_113278031 | 3300030855 | Soil | IVLTVDHRFALSNPALLSAPSKKLISALRAPCGVETEGLD |
Ga0265760_100349001 | 3300031090 | Soil | AVDHRFALSNPALVSAPSKKLISAVRAPCGVETEGR |
Ga0170824_1090841801 | 3300031231 | Forest Soil | IVPAVDHRFALSNPALVSAPSKKLISAVRAPCGVETEGR |
Ga0170818_1029529742 | 3300031474 | Forest Soil | GDRQIVLTVDHRFALSNPALVSAPSKKLCAALRSPCGIETGRR |
Ga0311364_103575911 | 3300031521 | Fen | PGDRQIVLTVDHRFALSNPALVSAPSKKLISALRAPCGIETGLR |
Ga0318574_105136181 | 3300031680 | Soil | TATADIQSRRLLGDGQIVLTVDHRFALSNPALVSATSKKPISALRAPCGVETEGLD |
Ga0318500_105891771 | 3300031724 | Soil | VDHRFALSNPALVSATSKKPISALRAPCGVETEGLD |
Ga0306918_101419891 | 3300031744 | Soil | RLLGDGQIVLTVDHRFALSNPALVSATSKKPISALRAPCGVETEGLD |
Ga0307479_118146891 | 3300031962 | Hardwood Forest Soil | AKNLGLLGDRKIVPAVDHRFALSNPALVSAPSKKLISAVRAPCGVETEGR |
Ga0311301_104458151 | 3300032160 | Peatlands Soil | AAADAKNLGLLGDRKIVPAVDHRFALSNPALVSAPSKKLISAVRAPCGVETEGR |
Ga0307472_1017378991 | 3300032205 | Hardwood Forest Soil | DRKIVPAVDHRFALSNPALVSAPSKKLISAVRAPCGVETEGR |
Ga0364945_0076224_1_147 | 3300034115 | Sediment | NFRLPGDRQIVLTVDHRFALSNPALVSAPSKKLILALRAPCGDRNGKC |
⦗Top⦘ |