Metagenome / Metatranscriptome Family F050037

Overview

Basic Information

• Family ID: F050037
• Family Type: Metagenome / Metatranscriptome
• Number of Sequences: 146
• Average Sequence Length: 38 residues
• Representative Sequence: MIKKFFRDETGLELSEYAVAAALVAIAVVGAFAALGT
• Number of Associated Samples: 124
• Number of Associated Scaffolds: 146

Quality Assessment

• Transcriptomic Evidence: Yes
• Most common taxonomic group: Bacteria
• % of genes with valid RBS motifs: 94.52 %
• % of genes near scaffold ends (potentially truncated): 100.00 %
• % of genes from short scaffolds (< 2000 bps): 96.58 %
• Associated GOLD sequencing projects: 119
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.47

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Bacteria (77.397 % of family members)
• NCBI Taxonomy ID: 2
• Taxonomy: All Organisms → cellular organisms → Bacteria

Most Common Ecosystem

• GOLD Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil (11.644 % of family members)
• Environment Ontology (ENVO): Unclassified (41.781 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant rhizosphere (47.945 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Transmembrane (alpha-helical)
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 52.31%
  β-sheet: 0.00%
  Coil/Unstructured: 47.69%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 146 Family Scaffolds
PF04964	Flp_Fap	26.03
PF02954	HTH_8	4.79
PF02163	Peptidase_M50	0.68
PF01642	MM_CoA_mutase	0.68
PF09720	Unstab_antitox	0.68
PF02366	PMT	0.68
PF01476	LysM	0.68
PF01478	Peptidase_A24	0.68

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 146 Family Scaffolds
COG3847	Flp pilus assembly protein, pilin Flp	Extracellular structures [W]	26.03
COG1884	Methylmalonyl-CoA mutase, N-terminal domain/subunit	Lipid transport and metabolism [I]	0.68

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	77.40 %
Unclassified	root	N/A	22.60 %

Level 2

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	77.40 %
Unclassified	root	N/A	22.60 %

Level 3

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	77.40 %
Unclassified	root	N/A	22.60 %

Level 4

Name	Rank	Taxonomy	Distribution
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	38.36 %
Unclassified	root	N/A	22.60 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	17.12 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	22.60 %
Blastocatellia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia	15.07 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	14.38 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	10.96 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1.37 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	22.60 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	14.38 %
unclassified Blastocatellia	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia	13.70 %
Pseudomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales	8.22 %
Blastocatellales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales	1.37 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.68 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	22.60 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	14.38 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	13.70 %
Marinobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae	7.53 %
Pyrinomonadaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae	1.37 %
Pseudomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae	0.68 %
Phyllobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae	0.68 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	22.60 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	14.38 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	13.70 %
Marinobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter	7.53 %
Pyrinomonas	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas	1.37 %
Nitratireductor	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Nitratireductor	0.68 %
Pseudomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas	0.68 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	22.60 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	14.38 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	13.70 %
Marinobacter lipolyticus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → Marinobacter lipolyticus	4.11 %
Marinobacter pelagius	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → Marinobacter pelagius	3.42 %
Pyrinomonas methylaliphatogenes	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	1.37 %
Nitratireductor aquibiodomus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Nitratireductor → Nitratireductor aquibiodomus	0.68 %
Pseudomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas	0.68 %

Associated Scaffolds

Scaffold	Taxonomy	Length
2140918013|NODE_1177_length_1057_cov_6.834437	All Organisms → cellular organisms → Bacteria	1089
2162886007|SwRhRL2b_contig_1832240	All Organisms → cellular organisms → Bacteria → Proteobacteria	989
3300000364|INPhiseqgaiiFebDRAFT_104475331	Not Available	530
3300000953|JGI11615J12901_10609636	Not Available	564
3300000956|JGI10216J12902_100239314	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Nitratireductor → Nitratireductor aquibiodomus	587
3300004156|Ga0062589_101891451	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	602
3300004798|Ga0058859_10073028	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	793
3300004798|Ga0058859_11791511	All Organisms → cellular organisms → Bacteria → Proteobacteria	924
3300005289|Ga0065704_10879347	All Organisms → cellular organisms → Bacteria	501
3300005293|Ga0065715_11095158	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → Marinobacter lipolyticus	521
3300005331|Ga0070670_101801673	Not Available	563
3300005343|Ga0070687_100436951	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	867
3300005354|Ga0070675_101881870	All Organisms → cellular organisms → Bacteria → Acidobacteria	552
3300005364|Ga0070673_100187642	All Organisms → cellular organisms → Bacteria	1774
3300005466|Ga0070685_10121460	All Organisms → cellular organisms → Bacteria	1623
3300005518|Ga0070699_102014936	All Organisms → cellular organisms → Bacteria → Proteobacteria	528
3300005546|Ga0070696_100927913	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → Marinobacter lipolyticus	723
3300005546|Ga0070696_101447138	All Organisms → cellular organisms → Bacteria → Proteobacteria	587
3300005577|Ga0068857_101143861	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	752
3300005615|Ga0070702_100365036	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → Marinobacter lipolyticus	1022
3300005616|Ga0068852_102200431	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → Marinobacter lipolyticus	573
3300005617|Ga0068859_101726000	Not Available	691
3300005618|Ga0068864_100581075	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1085
3300005618|Ga0068864_101458890	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → Marinobacter lipolyticus	687
3300005618|Ga0068864_102623860	All Organisms → cellular organisms → Bacteria → Proteobacteria	510
3300005718|Ga0068866_10693606	All Organisms → cellular organisms → Bacteria → Proteobacteria	698
3300005840|Ga0068870_11219476	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas	545
3300005841|Ga0068863_102310135	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → Marinobacter lipolyticus	547
3300005876|Ga0075300_1043127	Not Available	636
3300005983|Ga0081540_1275443	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	581
3300006031|Ga0066651_10398237	All Organisms → cellular organisms → Bacteria	734
3300006806|Ga0079220_11244565	Not Available	618
3300006852|Ga0075433_11643632	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	554
3300006903|Ga0075426_11444156	All Organisms → cellular organisms → Bacteria → Proteobacteria	523
3300007076|Ga0075435_100237390	All Organisms → cellular organisms → Bacteria	1550
3300009088|Ga0099830_10854872	Not Available	751
3300009094|Ga0111539_12388586	All Organisms → cellular organisms → Bacteria	613
3300009098|Ga0105245_11892550	All Organisms → cellular organisms → Bacteria	650
3300009098|Ga0105245_13069507	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	517
3300009162|Ga0075423_10436733	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1375
3300010118|Ga0127465_1086796	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	694
3300010147|Ga0126319_1646591	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	777
3300010166|Ga0126306_10484905	All Organisms → cellular organisms → Bacteria	976
3300010166|Ga0126306_11435847	Not Available	571
3300010358|Ga0126370_10312356	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1252
3300010360|Ga0126372_11112188	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	809
3300010397|Ga0134124_10925723	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	879
3300010397|Ga0134124_11936681	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	625
3300010399|Ga0134127_10945773	Not Available	919
3300010403|Ga0134123_11667716	All Organisms → cellular organisms → Bacteria → Acidobacteria	687
3300011119|Ga0105246_10148897	All Organisms → cellular organisms → Bacteria → Acidobacteria	1769
3300011119|Ga0105246_12163389	Not Available	540
3300011332|Ga0126317_10766831	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	662
3300012187|Ga0136622_10375585	All Organisms → cellular organisms → Bacteria	597
3300012200|Ga0137382_10708217	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	722
3300012205|Ga0137362_11375032	All Organisms → cellular organisms → Bacteria → Acidobacteria	592
3300012353|Ga0137367_10846896	All Organisms → cellular organisms → Bacteria	633
3300012358|Ga0137368_10106713	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	2158
3300012469|Ga0150984_100213754	All Organisms → cellular organisms → Bacteria	556
3300012678|Ga0136615_10221243	Not Available	859
3300012685|Ga0137397_11100751	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	579
3300012929|Ga0137404_11218033	All Organisms → cellular organisms → Bacteria	693
3300012948|Ga0126375_10786669	Not Available	752
3300013102|Ga0157371_10882374	Not Available	677
3300013308|Ga0157375_11671078	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	754
3300013308|Ga0157375_12256637	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	649
3300014325|Ga0163163_10500592	All Organisms → cellular organisms → Bacteria → Acidobacteria	1277
3300014326|Ga0157380_10891722	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	915
3300014487|Ga0182000_10219844	All Organisms → cellular organisms → Bacteria	741
3300014968|Ga0157379_12170020	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	551
3300015162|Ga0167653_1000067	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	53040
3300015372|Ga0132256_101151811	Not Available	889
3300017695|Ga0180121_10008389	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	3843
3300017792|Ga0163161_11491937	All Organisms → cellular organisms → Bacteria	593
3300017792|Ga0163161_12065843	Not Available	507
3300018054|Ga0184621_10123687	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	925
3300018071|Ga0184618_10409597	All Organisms → cellular organisms → Bacteria	573
3300018429|Ga0190272_10501026	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	1031
3300018429|Ga0190272_11984752	All Organisms → cellular organisms → Bacteria → Acidobacteria	615
3300018939|Ga0193593_1003147	All Organisms → cellular organisms → Bacteria	4249
3300019142|Ga0193597_1051236	All Organisms → cellular organisms → Bacteria	1364
3300019244|Ga0180111_1404784	All Organisms → cellular organisms → Bacteria	508
3300019883|Ga0193725_1098768	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	692
3300020063|Ga0180118_1077615	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	753
3300020067|Ga0180109_1175459	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	788
3300020067|Ga0180109_1366439	All Organisms → cellular organisms → Bacteria	760
3300020202|Ga0196964_10247688	All Organisms → cellular organisms → Bacteria	835
3300020215|Ga0196963_10056793	All Organisms → cellular organisms → Bacteria	1632
3300021445|Ga0182009_10742762	Not Available	534
3300021475|Ga0210392_11162156	All Organisms → cellular organisms → Bacteria	578
3300023201|Ga0256614_1544547	Not Available	510
3300025908|Ga0207643_10673020	Not Available	668
3300025910|Ga0207684_11309150	Not Available	596
3300025911|Ga0207654_10822125	Not Available	672
3300025913|Ga0207695_11159276	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	653
3300025914|Ga0207671_10987868	Not Available	664
3300025919|Ga0207657_10739103	Not Available	763
3300025942|Ga0207689_11493546	Not Available	564
3300025960|Ga0207651_10289556	All Organisms → cellular organisms → Bacteria → Acidobacteria	1357
3300025981|Ga0207640_11036987	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	723
3300025986|Ga0207658_11449629	Not Available	628
3300026088|Ga0207641_10513853	Not Available	1164
3300026089|Ga0207648_11354894	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	669
3300026095|Ga0207676_11260469	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	733
3300026528|Ga0209378_1299654	All Organisms → cellular organisms → Bacteria → Acidobacteria	515
3300027787|Ga0209074_10372316	All Organisms → cellular organisms → Bacteria	591
3300028379|Ga0268266_10806740	Not Available	907
3300028380|Ga0268265_10371693	All Organisms → cellular organisms → Bacteria → Acidobacteria	1312
3300028380|Ga0268265_11535802	All Organisms → cellular organisms → Bacteria	670
3300028380|Ga0268265_12005569	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	586
3300030988|Ga0308183_1101826	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → Marinobacter pelagius	655
3300030989|Ga0308196_1019126	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	787
3300030990|Ga0308178_1045587	All Organisms → cellular organisms → Bacteria → Acidobacteria	803
3300030990|Ga0308178_1169988	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	512
3300031081|Ga0308185_1055807	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	516
3300031093|Ga0308197_10224660	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	652
3300031095|Ga0308184_1020955	All Organisms → cellular organisms → Bacteria	703
3300031096|Ga0308193_1088819	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	516
3300031099|Ga0308181_1188201	All Organisms → cellular organisms → Bacteria → Acidobacteria	502
3300031114|Ga0308187_10146776	Not Available	783
3300031231|Ga0170824_113604524	Not Available	560
3300031423|Ga0308177_1030538	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	518
3300031538|Ga0310888_10919694	Not Available	547
3300031720|Ga0307469_11817319	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	589
3300031908|Ga0310900_10525066	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	924
3300032205|Ga0307472_101487483	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	661
3300034137|Ga0334943_101071	All Organisms → cellular organisms → Bacteria	555
3300034138|Ga0334955_094761	All Organisms → cellular organisms → Bacteria	670
3300034174|Ga0334932_068335	Not Available	613
3300034178|Ga0364934_0326381	All Organisms → cellular organisms → Bacteria	581
3300034221|Ga0334937_000642	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	6904
3300034479|Ga0314785_021906	Not Available	527
3300034659|Ga0314780_060405	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	783
3300034659|Ga0314780_073995	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → Marinobacter pelagius	731
3300034659|Ga0314780_083437	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	702
3300034659|Ga0314780_122006	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → Marinobacter pelagius	616
3300034662|Ga0314783_094101	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → Marinobacter pelagius	630
3300034662|Ga0314783_106475	All Organisms → cellular organisms → Bacteria → Acidobacteria	604
3300034663|Ga0314784_062559	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → Marinobacter pelagius	707
3300034663|Ga0314784_169277	All Organisms → cellular organisms → Bacteria	507
3300034665|Ga0314787_045352	All Organisms → cellular organisms → Bacteria	710
3300034665|Ga0314787_077373	Not Available	587
3300034670|Ga0314795_020277	All Organisms → cellular organisms → Bacteria → Acidobacteria	1002
3300034670|Ga0314795_138102	Not Available	519
3300034675|Ga0314800_033196	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	681
3300034678|Ga0314803_047932	All Organisms → cellular organisms → Bacteria	731

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Environmental	Environmental	63.01%
Host-Associated	Host-Associated	36.30%
Engineered	Engineered	0.68%

Class

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	55.48%
Plants	Host-Associated → Plants	34.93%
Aquatic	Environmental → Aquatic	7.53%
Human	Host-Associated → Human	1.37%
Wastewater	Engineered → Wastewater	0.68%

Category

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	54.79%
Rhizosphere	Host-Associated → Plants → Rhizosphere	17.81%
Rhizoplane	Host-Associated → Plants → Rhizoplane	16.44%
Freshwater	Environmental → Aquatic → Freshwater	6.16%
Sediment	Environmental → Aquatic → Sediment	1.37%
Digestive System	Host-Associated → Human → Digestive System	1.37%
Floodplain	Environmental → Terrestrial → Floodplain	0.68%
Roots	Host-Associated → Plants → Roots	0.68%
Activated Sludge	Engineered → Wastewater → Activated Sludge	0.68%

Type

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	44.52%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	14.38%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	11.64%
Soil	Host-Associated → Plants → Rhizosphere → Soil	6.16%
Loam	Environmental → Terrestrial → Soil → Loam	4.79%
Sediment	Environmental → Aquatic → Freshwater → Sediment	2.74%
Sand	Environmental → Terrestrial → Soil → Sand	2.74%
Ice	Environmental → Aquatic → Freshwater → Ice	2.05%
Soil Crust	Environmental → Terrestrial → Soil → Soil Crust	2.05%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	2.05%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	1.37%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	1.37%
Large Intestine	Host-Associated → Human → Digestive System → Large Intestine	1.37%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	0.68%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	0.68%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.68%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified	0.68%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	23.29%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	14.38%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	11.64%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	11.64%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	6.16%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	4.79%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	4.11%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	2.74%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	2.74%
Desert	Environmental → Terrestrial → Soil → Sand → Desert	2.74%
Unclassified	Environmental → Aquatic → Freshwater → Ice → Unclassified	2.05%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	2.05%
Unclassified	Environmental → Terrestrial → Soil → Soil Crust → Unclassified	2.05%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	2.05%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	1.37%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	1.37%
Fecal	Host-Associated → Human → Digestive System → Large Intestine → Fecal	1.37%
Desert	Environmental → Terrestrial → Soil → Unclassified → Desert	0.68%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	0.68%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	0.68%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.68%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified	0.68%

Habitat

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	11.64%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	9.59%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	6.85%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	4.79%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	4.11%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	3.42%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	3.42%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	3.42%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	3.42%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	2.74%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	2.74%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.74%
Polar Desert Sand	Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand	2.05%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	2.05%
Biocrust	Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Biocrust	2.05%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	2.05%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	2.05%
Soil	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil	1.37%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	1.37%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.37%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	1.37%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	1.37%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	1.37%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	1.37%
Soil	Environmental → Terrestrial → Soil → Sand → Desert → Soil	1.37%
Soil	Environmental → Terrestrial → Soil → Sand → Desert → Soil	1.37%
Host-Associated	Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated	1.37%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere	1.37%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.37%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.37%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.37%
Glacier Forefield Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil	0.68%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	0.68%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.68%
Sub-Biocrust Soil	Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil	0.68%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.68%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	0.68%
Rice Paddy Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil	0.68%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	0.68%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere	0.68%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	0.68%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.68%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.68%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.68%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.68%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.68%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	0.68%
Activated Sludge	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge	0.68%

Associated Samples

Taxon OID	Sample Name	Habitat Type
2140918013	Soil microbial communities from Great Prairies - Iowa soil (MSU Assemblies)	Environmental
2162886007	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2	Host-Associated
3300000364	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental
3300000953	Soil microbial communities from Great Prairies - Kansas Corn soil	Environmental
3300000956	Soil microbial communities from Great Prairies - Kansas, Native Prairie soil	Environmental
3300004156	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1	Environmental
3300004798	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome)	Host-Associated
3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2	Host-Associated
3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1	Host-Associated
3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Host-Associated
3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Environmental
3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Host-Associated
3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Host-Associated
3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Environmental
3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Environmental
3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Environmental
3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Host-Associated
3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Environmental
3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Host-Associated
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated
3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Host-Associated
3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Host-Associated
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated
3300005876	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_401	Environmental
3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Host-Associated
3300006031	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100	Environmental
3300006806	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100	Environmental
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated
3300006903	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5	Host-Associated
3300007076	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Host-Associated
3300009088	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG	Environmental
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated
3300010118	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_16_1 metaT (Metagenome Metatranscriptome)	Environmental
3300010147	Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome)	Environmental
3300010166	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27	Environmental
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental
3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Host-Associated
3300011332	Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome)	Environmental
3300012187	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ448 (21.06)	Environmental
3300012200	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG	Environmental
3300012205	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG	Environmental
3300012353	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG	Environmental
3300012358	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG	Environmental
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated
3300012678	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ288 (22.06)	Environmental
3300012685	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG	Environmental
3300012929	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)	Environmental
3300012948	Tropical forest soil microbial communities from Panama - MetaG Plot_14	Environmental
3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Host-Associated
3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Host-Associated
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated
3300014487	Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG	Environmental
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated
3300015162	Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4c, rock/ice/stream interface)	Environmental
3300015372	Soil combined assembly	Host-Associated
3300017695	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ540 (21.06) (version 2)	Environmental
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated
3300018054	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1	Environmental
3300018071	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1	Environmental
3300018429	Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T	Environmental
3300018939	Soil crust microbial communities from Colorado Plateau, Utah, USA - midlate stage, 9 hrs after wetting v1	Environmental
3300019142	Soil crust microbial communities from Colorado Plateau, Utah, USA - mid late stage, 3 min after wetting v1	Environmental
3300019244	Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT293_16_1Ra (Metagenome Metatranscriptome)	Environmental
3300019883	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2	Environmental
3300020063	Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT730_16_1Ra (Metagenome Metatranscriptome)	Environmental
3300020067	Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT47_16_1Ra (Metagenome Metatranscriptome)	Environmental
3300020202	Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_10	Environmental
3300020215	Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_5	Environmental
3300021445	Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG	Environmental
3300021475	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O	Environmental
3300023201	Activated sludge enriched bacterial communities from WWTP in Fort Collins, Colorado, USA ? PN	Engineered
3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)	Host-Associated
3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)	Environmental
3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)	Host-Associated
3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)	Host-Associated
3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)	Host-Associated
3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)	Host-Associated
3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)	Host-Associated
3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)	Host-Associated
3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)	Host-Associated
3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)	Host-Associated
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated
3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)	Host-Associated
3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)	Host-Associated
3300026528	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes)	Environmental
3300027787	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)	Environmental
3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)	Host-Associated
3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)	Host-Associated
3300030988	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_157 (Metagenome Metatranscriptome)	Environmental
3300030989	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_197 (Metagenome Metatranscriptome)	Environmental
3300030990	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome)	Environmental
3300031081	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_159 (Metagenome Metatranscriptome)	Environmental
3300031093	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome)	Environmental
3300031095	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_158 (Metagenome Metatranscriptome)	Environmental
3300031096	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_194 (Metagenome Metatranscriptome)	Environmental
3300031099	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome)	Environmental
3300031114	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome)	Environmental
3300031231	Coassembly Site 11 (all samples) - Champenoux / Amance forest	Environmental
3300031423	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_148 (Metagenome Metatranscriptome)	Environmental
3300031538	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1	Environmental
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental
3300031908	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1	Environmental
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental
3300034137	Biocrust microbial communities from Mojave Desert, California, United States - 39SMC	Environmental
3300034138	Biocrust microbial communities from Mojave Desert, California, United States - 51SNC	Environmental
3300034174	Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 28HNS	Environmental
3300034178	Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17	Environmental
3300034221	Biocrust microbial communities from Mojave Desert, California, United States - 33SMC	Environmental
3300034479	Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R2 (Metagenome Metatranscriptome)	Environmental
3300034659	Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R1 (Metagenome Metatranscriptome)	Environmental
3300034662	Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R4 (Metagenome Metatranscriptome)	Environmental
3300034663	Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R1 (Metagenome Metatranscriptome)	Environmental
3300034665	Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R4 (Metagenome Metatranscriptome)	Environmental
3300034670	Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R4 (Metagenome Metatranscriptome)	Environmental
3300034675	Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R1 (Metagenome Metatranscriptome)	Environmental
3300034678	Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R4 (Metagenome Metatranscriptome)	Environmental

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Iowa-Corn-GraphCirc_00420780	2140918013	Soil	MTYFLRDETGLELSEYAVAAALIAMACALAFSTLGGA
SwRhRL2b_0719.00003820	2162886007	Switchgrass Rhizosphere	MFKKFLKDETGLELSEYAVAAALVAVATVAAFQLLG
INPhiseqgaiiFebDRAFT_1044753312	3300000364	Soil	MFRNLLKDESGLELSEYAVAAALVAIATVTAFQLIGANIGARI
JGI11615J12901_106096362	3300000953	Soil	VEKFLRCEKGLELSEYAVAAALVTALTVIAFASLGNVIV
JGI10216J12902_1002393143	3300000956	Soil	MIKNFLKDESGLELSEYAVAAALVTLAVIVAFTAVGTN
Ga0062589_1018914511	3300004156	Soil	MLKNFLSDETGLELSEYAVAAALIAIAVAGVFTALGDSIS
Ga0058859_100730283	3300004798	Host-Associated	MFKKFLKDESGLELSEYAVAAALVALACVVAFQTLGTQIG
Ga0058859_117915111	3300004798	Host-Associated	MIRSFLSDESGLELSEYAVAAALVTLAVVVAFTAVGTNIN
Ga0065704_108793471	3300005289	Switchgrass Rhizosphere	MRTKITMIKAFLMDEQGLELSEYAVAAALVALATVAAFSALS
Ga0065715_110951582	3300005293	Miscanthus Rhizosphere	MFKKFLIDETGLELSEYAVAAALVAVATIAAFQLLGTNIGSRI
Ga0070670_1018016732	3300005331	Switchgrass Rhizosphere	MIKRFFADETGLELSEYAVAAALIALACVAAFQLLGTNIG
Ga0070687_1004369513	3300005343	Switchgrass Rhizosphere	MIRKFLKDDTGLELSEYAVAAALIALAVVGIFGVLGNNINGVIN
Ga0070675_1018818701	3300005354	Miscanthus Rhizosphere	MIKKFLRDETGLELSEYAVAAALVAIAVVGAFFTLGGTISDKI
Ga0070673_1001876421	3300005364	Switchgrass Rhizosphere	MLKNFFSDETGLELSEYAVAAALIAIAVAGVFTALGDSISTKI
Ga0070685_101214603	3300005466	Switchgrass Rhizosphere	RKESIMFKKFLKDETGLELSEYAVAAALVAVATVAAFQLLGN*
Ga0070699_1020149361	3300005518	Corn, Switchgrass And Miscanthus Rhizosphere	LIRGTNVIKTFLQDETGLELSEYAVAAALVTLAVIGAFTSV
Ga0070696_1009279133	3300005546	Corn, Switchgrass And Miscanthus Rhizosphere	MLKRFFADETGLELSEYAVAAALIALACVVAFQTLGTNIGTKIN
Ga0070696_1014471382	3300005546	Corn, Switchgrass And Miscanthus Rhizosphere	MTKHFFQDETGLELSEYAVAAALVAMACVAAFTTLGTAIGAK
Ga0068857_1011438612	3300005577	Corn Rhizosphere	MIKRFFADETGLELSEYAVAAALIALACVAAFQLLGTN
Ga0070702_1003650363	3300005615	Corn, Switchgrass And Miscanthus Rhizosphere	MIKKFFADETGLELSEYAVAAALIALACVVAFQTLGTNIGTKIN
Ga0068852_1022004313	3300005616	Corn Rhizosphere	MFKRFINDETGLELSEYAVAAALVALAAVLAFQTL
Ga0068859_1017260001	3300005617	Switchgrass Rhizosphere	MIKRFFADETGLELSEYAVAAALIALACVAAFQLLGT
Ga0068864_1005810751	3300005618	Switchgrass Rhizosphere	MIKKFLKDESGLELSEYAVAAALVALACVAAFQLLG
Ga0068864_1014588901	3300005618	Switchgrass Rhizosphere	MTYFLRDETGLELSEYAVAAALIAMACALAFSTLGGAIGDR
Ga0068864_1026238602	3300005618	Switchgrass Rhizosphere	MKNFWLDETGLELSEYAVAAALVAIAVVGAFTALGT
Ga0068866_106936063	3300005718	Miscanthus Rhizosphere	MKQFLIDETGLELSEYAVAAALVAIAVVGAFTALGTAIG
Ga0068870_112194762	3300005840	Miscanthus Rhizosphere	MIRKFIRDESGLELSEYAVAAALVAIAVVGAFFTLGGTISDK
Ga0068863_1023101351	3300005841	Switchgrass Rhizosphere	MFKKFLKDESGLELSEYAVAAALVALACVVAFQTLGTQ
Ga0075300_10431272	3300005876	Rice Paddy Soil	MIKRFFRDETGLELSEYAVAAALVALAAVAAFQLL
Ga0081540_12754431	3300005983	Tabebuia Heterophylla Rhizosphere	MIKKFFADETGLELSEYAVAAALVALACVVAFQTLGTNI
Ga0066651_103982373	3300006031	Soil	MIKKFFRDETGLELSEYAVAAALVAIAVVGAFAALGT
Ga0079220_112445651	3300006806	Agricultural Soil	MIKRFFHDETGLELSEYAVAAALVALACVAAFQLL
Ga0075433_116436321	3300006852	Populus Rhizosphere	MIKKFFSDETGLELSEYAVAAALVALACVAAFQLLGTNI
Ga0075426_114441561	3300006903	Populus Rhizosphere	MITNFLKDETGLELSEYAVAAALIALAVVGIFTTLGN
Ga0075435_1002373904	3300007076	Populus Rhizosphere	MITKFLKDETGLELSEYAVAAALIALAVVGIFTTL
Ga0099830_108548723	3300009088	Vadose Zone Soil	MFTKFFKDETGLELSEYAVAAALVAVAVVGAFAALGTT
Ga0111539_123885863	3300009094	Populus Rhizosphere	MFRKFLKDESGLELSEYAVAAALVALACVVAFQTLG
Ga0105245_118925502	3300009098	Miscanthus Rhizosphere	MIKNFFRDETGLELSEYAVAAALVAIAVVGAFFTLGGTIS
Ga0105245_130695073	3300009098	Miscanthus Rhizosphere	MIKKFFADETGLELSEYAVAAALVALACVVAFQTLGTNIGT
Ga0075423_104367335	3300009162	Populus Rhizosphere	MFKKFLKDESGLELSEYAVAAALVALACVVAFQTLGTQI
Ga0127465_10867963	3300010118	Grasslands Soil	MIRKFLSDETGLELSEYAVAAALIALATVGAFQLLGTNI
Ga0126319_16465913	3300010147	Soil	MFKTFLSDETGLELSEYAVAAALIAIAVAGVFTALG
Ga0126306_104849052	3300010166	Serpentine Soil	MLKRFFRDETGLELSEYAVAAALVILVAAGAFSALGGSI
Ga0126306_114358471	3300010166	Serpentine Soil	MLKKFFRDETGLELSEYAVAAALIALATVTAFSGLGTTIKNA
Ga0126370_103123565	3300010358	Tropical Forest Soil	MFKRFLSDETGLELSEYAVAAALVALACVAAFQLLGTN
Ga0126372_111121883	3300010360	Tropical Forest Soil	MKEGMKPMFKRFMKDETGLELSEYAVAAALVALAAVL
Ga0134124_109257231	3300010397	Terrestrial Soil	MKKFFLNETGLELSEYAVAAALVAIAVAAAYTALGDAIGVR
Ga0134124_119366813	3300010397	Terrestrial Soil	MIMIKRFFADETGLELSEYAVAAALIALACVVAFQTLGTNIGTKIN
Ga0134127_109457733	3300010399	Terrestrial Soil	MFIEFLRDETGLELSEYAVAAALVTIATVTAFQLVGT
Ga0134123_116677161	3300010403	Terrestrial Soil	MELPMIKKFLKDESGLELSEYAVAAVLIAIAVVGVFGTLGTNI
Ga0105246_101488974	3300011119	Miscanthus Rhizosphere	MLKRFFADETGLELSEYAVAAALIALACVVAFQTLGTNIGTKI
Ga0105246_121633892	3300011119	Miscanthus Rhizosphere	MFKKFFKDETGLELSEYAVAAALVAIAAVAAFQLLGTN
Ga0126317_107668313	3300011332	Soil	MFWKFLKDETGLELSEYAVAAALVALAAVVAFQTLG
Ga0136622_103755852	3300012187	Polar Desert Sand	MIKKFLRDETGLELSEYAVAAALVALAVITAFSTLG
Ga0137382_107082172	3300012200	Vadose Zone Soil	MIRNFFRDETGLELSEYAVAAALVAIAVVGAFSALGTTI
Ga0137362_113750323	3300012205	Vadose Zone Soil	MIKNFLQDETGLELSEYAVAAALIALAVVGVFTTLGKNIGN
Ga0137367_108468963	3300012353	Vadose Zone Soil	MIKNFLRDETGLELSEYAVAAALIAIACVTAFTNL
Ga0137368_101067131	3300012358	Vadose Zone Soil	MQMIKRFFQDETGLELSEYAVAAALIAIAVVAAFTALG
Ga0150984_1002137542	3300012469	Avena Fatua Rhizosphere	MIKRFLRDETGLELSEYAVAAALVALAAVAAFQLL
Ga0136615_102212431	3300012678	Polar Desert Sand	MIKKFLRDETGLELSEYAVAAALVVAAGVAVFTLL
Ga0137397_111007511	3300012685	Vadose Zone Soil	MIKKFFRDETGLELSEYAVAAASVAIAVVGAFTALGTAIS
Ga0137404_112180333	3300012929	Vadose Zone Soil	MIKNFLRDETGLELSEYAVAAPLIATAGVLAFTTLAAPIPRKIK
Ga0126375_107866693	3300012948	Tropical Forest Soil	MKDETGMELSEYAVAAALVTLAVVAAFGTLGRNIN
Ga0157371_108823741	3300013102	Corn Rhizosphere	MFKKFLIDETGLELSEYAVAAALVAVATIAAFQLLGTNIGS
Ga0157375_116710782	3300013308	Miscanthus Rhizosphere	MIKKFFADETGLELSEYAVAAALVALACVVAFQTLGTNIGTKINE
Ga0157375_122566372	3300013308	Miscanthus Rhizosphere	MKNFWLDETGLELSEYAVAAALVAIAVVGAFTALGTAI
Ga0163163_105005921	3300014325	Switchgrass Rhizosphere	MLKRFFADETGLELSEYAVAAALIALACVVAFQTL
Ga0157380_108917222	3300014326	Switchgrass Rhizosphere	MKNFWLDETGLELSEYAVAAALVAIAVVGAFTALGTAIGD
Ga0182000_102198441	3300014487	Soil	MIKRFFRDETGLELSEYAVAAALVALAAVLAFTALG
Ga0157379_121700202	3300014968	Switchgrass Rhizosphere	MIKRFFSDETGLELSEYAVAAALVALAAVVAFQALGTNIGTK
Ga0167653_100006745	3300015162	Glacier Forefield Soil	MISKFFRDETGLELSEYAVAAALVAIAVVGALTALG
Ga0132256_1011518111	3300015372	Arabidopsis Rhizosphere	MLKRFLNDETGLELSEYAVAAALVALACVAAFQLLG
Ga0180121_100083891	3300017695	Polar Desert Sand	MKKFLLDETGLELSEYAVAAALVAIAVVGAFTSLGT
Ga0163161_114919372	3300017792	Switchgrass Rhizosphere	MIKSFFRDETGLELSEYAVAAALVALAAVAAFTAL
Ga0163161_120658433	3300017792	Switchgrass Rhizosphere	MIKRFLMDEQGLELSEYAVAAALVALATVAAFTML
Ga0184621_101236871	3300018054	Groundwater Sediment	MIRKFFRDETGLELSEYAVAAALVAIAVVGAFGLL
Ga0184618_104095971	3300018071	Groundwater Sediment	MISKFLRDETGLELSEYAVAAALVAIAVVGAFFTLGGSI
Ga0190272_105010261	3300018429	Soil	MFKQFLKDETGLELSEYAVAAALIAVAAAGVFTALG
Ga0190272_119847523	3300018429	Soil	MIRKFFNDETGLELSEYAVAAALIALAVVGIFGTLGNNINGVIGN
Ga0193593_10031476	3300018939	Soil	MIKKFLRDETGLELSEYAVAAALVALAVITAFSTLGT
Ga0193597_10512364	3300019142	Soil	MIKKFLQDETGLELSEYAVAAALVALAVITAFSTLGKNIGIKIGD
Ga0180111_14047842	3300019244	Groundwater Sediment	MIKRFFRDETGLELSEYAVAAALVAIAVVGAFTALGTAIS
Ga0193725_10987681	3300019883	Soil	MIRKFFRDETGLELSEYAVAAALVAIAVVVAFTALGTAISSKI
Ga0180118_10776153	3300020063	Groundwater Sediment	MIRNFFRDETGLELSEYAVAAALVAIAVVAAFTALG
Ga0180109_11754593	3300020067	Groundwater Sediment	MIKNFLRDETGLELSEYAVAAALVAMACALAFTTLGVAIGDKIN
Ga0180109_13664393	3300020067	Groundwater Sediment	MTKNFLQDETGLELSEYAVAAALVAMACALAFTTLGVAIGDKINT
Ga0196964_102476882	3300020202	Soil	MIKRFLRDETGLELSEYAVAAALVAIAAVAAFKALG
Ga0196963_100567933	3300020215	Soil	MLKRFFRDETGLELSEYAVAAALVAIATVVAFETLG
Ga0182009_107427621	3300021445	Soil	MFRKFWSDESGLELSEYAVAAALVALACVAAFQLLGT
Ga0210392_111621563	3300021475	Soil	MIIRFLKDEAGLELSEYAAAAALVTLAIVVAISTLGTNIAGKI
Ga0256614_15445471	3300023201	Activated Sludge	MNKIKNFFLNDETGLELSEYAVAAALIAVVCVAAFTALSGGIGDA
Ga0207643_106730201	3300025908	Miscanthus Rhizosphere	MIKRFFADETGLELSEYAVAAALIALACVAAFQLLG
Ga0207684_113091501	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	MIKRFFSDETGLELSEYAVAAALVALAAVAAFQVAVV
Ga0207654_108221253	3300025911	Corn Rhizosphere	MFKKFLKDESGLELSEYAVAAALVALACVVAFQTLGTQIGARI
Ga0207695_111592761	3300025913	Corn Rhizosphere	MKNFWLDETGLELSEYAVAAALVAIAVVGAFTALGTAIGDK
Ga0207671_109878683	3300025914	Corn Rhizosphere	MFKKFLKDETGLELSEYAVAAALVAVATIAAFQLL
Ga0207657_107391031	3300025919	Corn Rhizosphere	MIKRFFADETGLELSEYAVAAALIALACVAAFQLLGTNIGIKI
Ga0207689_114935461	3300025942	Miscanthus Rhizosphere	MIKRFFSDETGLELSEYAVAAALVALAAVAAFQLLGE
Ga0207651_102895563	3300025960	Switchgrass Rhizosphere	MIKKFLNDETGLELSEYAVAAALVAMAAVVAFRTL
Ga0207640_110369871	3300025981	Corn Rhizosphere	MIKRFFSDETGLELSEYAVAAALIALATVAAFQLLGTN
Ga0207658_114496293	3300025986	Switchgrass Rhizosphere	MFRKFLKDESGLELSEYAVAAALIALACVAAFQLL
Ga0207641_105138533	3300026088	Switchgrass Rhizosphere	MFKKFLKDETGLELSEYAVAAALVAVATVAAFQLLGTN
Ga0207648_113548943	3300026089	Miscanthus Rhizosphere	MKQFLIDETGLELSEYAVAAALVAIAVVGAFTALGT
Ga0207676_112604691	3300026095	Switchgrass Rhizosphere	MIKRFFADETGLELSEYAVAAALVALACVVAFQTLGTNIGT
Ga0209378_12996542	3300026528	Soil	MIKRFFRDETGLELSEYAVAAALVAIAVVGAFFTLGG
Ga0209074_103723162	3300027787	Agricultural Soil	VFRKFWSDESGLELSEYAVAAALVALACVAAFQLLGG
Ga0268266_108067404	3300028379	Switchgrass Rhizosphere	MFKKFLKDETGLELSEYAVAAALVAVATVAAFQLLGT
Ga0268265_103716931	3300028380	Switchgrass Rhizosphere	MIKRFFADETGLELSEYAVAAALIALACVAAFQLL
Ga0268265_115358022	3300028380	Switchgrass Rhizosphere	MIKRFFRDETGLELSEYAVAAALIAIAVVGAFTAL
Ga0268265_120055691	3300028380	Switchgrass Rhizosphere	MIKKFFRDETGLELSEYAVAAALVAIAVVGAFTALGTA
Ga0308183_11018262	3300030988	Soil	VIRLFIRDETGLELSEYAVAAALVTLAVIGVFTALGGKI
Ga0308196_10191263	3300030989	Soil	MKKFFIDETGLELSEYAVAAALVAIAVVGAFTALGTA
Ga0308178_10455873	3300030990	Soil	MINKFLHDETGLELSEYAVAAALVAIAVAGVFMALGDAITTRIS
Ga0308178_11699882	3300030990	Soil	MIRNFFRDETGLELSEYAVAAALVAMAVVAAFSALGTAIS
Ga0308185_10558072	3300031081	Soil	MIKNFFRDETGLELSEYAVAAALVAIAVVGAFTALGGAI
Ga0308197_102246603	3300031093	Soil	MFREFWKDETGLELSEYAVAAALVALACVVAFQTLGT
Ga0308184_10209553	3300031095	Soil	MISKFLRDETGLELSEYAVAAALVAIAVVGAFFTL
Ga0308193_10888192	3300031096	Soil	MISKFFRDETGLELSEYAVAAALVAIAVVGAFSALDETGLELS
Ga0308181_11882011	3300031099	Soil	MIKRFFRDETGLELSEYAVAAALVAIAVVGAFFTLG
Ga0308187_101467762	3300031114	Soil	MIKNFMIDETGLELSEYAVAAALIALAVVGVFTTLGN
Ga0170824_1136045242	3300031231	Forest Soil	MIKNFLQDESGLELSEYAVAAALIALAVVGVFGLLGTSIKT
Ga0308177_10305382	3300031423	Soil	MIKNFFRDETGLELSEYAVAAALVAIAVVGAFTALGTAIS
Ga0310888_109196942	3300031538	Soil	MIRNFFRDETGLELSEYAVAAALVAIAAVVAFTTLG
Ga0307469_118173193	3300031720	Hardwood Forest Soil	MIRTFLSDDTGLELSEYAVAAALIAVATVAAFQLLGTS
Ga0310900_105250661	3300031908	Soil	MFRKFLTDETGLELSEYAVAAALVALACVVAYQTLGTNIGARIE
Ga0307472_1014874831	3300032205	Hardwood Forest Soil	MIKRFFRDETGLELSEYAVAAALIALACVAAFQLLGT
Ga0334943_101071_444_554	3300034137	Biocrust	MLKRFFRDETGLELSEYAVAAALVILVAAGAFSALGG
Ga0334955_094761_2_109	3300034138	Biocrust	MIKKFLRDETGLELSEYAVAAALVALAVITAFTTLG
Ga0334932_068335_2_124	3300034174	Sub-Biocrust Soil	MLKKFFRDETGLELSEYAVAAALVALATVTAFTSLGTTIKA
Ga0364934_0326381_1_111	3300034178	Sediment	MSSRFLRDETGLELSEYAVAAALVAITVVVAFTYLGE
Ga0334937_000642_2_118	3300034221	Biocrust	MLKKFFRDETGLELSEYAVAAALIALATVTAFSGLGTTS
Ga0314785_021906_3_107	3300034479	Soil	MIRNFFRDETGLELSEYAVAAALVAIAAVIAFTTL
Ga0314780_060405_662_781	3300034659	Soil	MRKFLLDETGLELSEYAVAAALVAIGAVGAFTALGNAIVL
Ga0314780_073995_2_121	3300034659	Soil	MFKKFLIDETGLELSEYAVAAALVAVATIAAFQLLGTNIG
Ga0314780_083437_587_700	3300034659	Soil	MIRKFFSDETGLELSEYAVAAAMIALATVAAFQLLGTS
Ga0314780_122006_1_108	3300034659	Soil	MIKNFLQDETGLELSEYAVAAALIALAVVGVFATLG
Ga0314783_094101_510_629	3300034662	Soil	MFKTFWKDETGLELSEYAVAAALVAIAAVLAFQTLGTNIG
Ga0314783_106475_2_121	3300034662	Soil	MIKSFFSDESGLELSEYAVAAALVTLAVMVAFTAVGTNIN
Ga0314784_062559_598_705	3300034663	Soil	MFKKFLIDETGLELSEYAVAAALVAVATIAAFQLLG
Ga0314784_169277_396_506	3300034663	Soil	MFTRFLKDETGLELSEYAVAAALIALACVVAFQTLGT
Ga0314787_045352_3_113	3300034665	Soil	MFKRFFRAEEGLELSEYAVAAALVVAGVVVAFTVLGN
Ga0314787_077373_477_587	3300034665	Soil	MFTKFLKDESGLELSEYAVAAALVALAAVLAFQTLGG
Ga0314795_020277_2_121	3300034670	Soil	MIRSFFSDESGLELSEYAVAAALVTLAVVVAFTAVGTNIN
Ga0314795_138102_410_517	3300034670	Soil	MFRKFLKDESGLELSEYAVAAALIALACVAAFQLLG
Ga0314800_033196_577_681	3300034675	Soil	MFRKFLKDESGLELSEYAVAAALVAIAAVAAFQLL
Ga0314803_047932_610_729	3300034678	Soil	MFTKFFRDETGLELSEYAVAAALVAVATVLAFELLGSSIG