| Basic Information | |
|---|---|
| Family ID | F050037 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 146 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MIKKFFRDETGLELSEYAVAAALVAIAVVGAFAALGT |
| Number of Associated Samples | 124 |
| Number of Associated Scaffolds | 146 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 94.52 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 96.58 % |
| Associated GOLD sequencing projects | 119 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (77.397 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil (11.644 % of family members) |
| Environment Ontology (ENVO) | Unclassified (41.781 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (47.945 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.31% β-sheet: 0.00% Coil/Unstructured: 47.69% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 146 Family Scaffolds |
|---|---|---|
| PF04964 | Flp_Fap | 26.03 |
| PF02954 | HTH_8 | 4.79 |
| PF02163 | Peptidase_M50 | 0.68 |
| PF01642 | MM_CoA_mutase | 0.68 |
| PF09720 | Unstab_antitox | 0.68 |
| PF02366 | PMT | 0.68 |
| PF01476 | LysM | 0.68 |
| PF01478 | Peptidase_A24 | 0.68 |
| COG ID | Name | Functional Category | % Frequency in 146 Family Scaffolds |
|---|---|---|---|
| COG3847 | Flp pilus assembly protein, pilin Flp | Extracellular structures [W] | 26.03 |
| COG1884 | Methylmalonyl-CoA mutase, N-terminal domain/subunit | Lipid transport and metabolism [I] | 0.68 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 77.40 % |
| Unclassified | root | N/A | 22.60 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2140918013|NODE_1177_length_1057_cov_6.834437 | All Organisms → cellular organisms → Bacteria | 1089 | Open in IMG/M |
| 2162886007|SwRhRL2b_contig_1832240 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 989 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_104475331 | Not Available | 530 | Open in IMG/M |
| 3300000953|JGI11615J12901_10609636 | Not Available | 564 | Open in IMG/M |
| 3300000956|JGI10216J12902_100239314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Nitratireductor → Nitratireductor aquibiodomus | 587 | Open in IMG/M |
| 3300004156|Ga0062589_101891451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 602 | Open in IMG/M |
| 3300004798|Ga0058859_10073028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 793 | Open in IMG/M |
| 3300004798|Ga0058859_11791511 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 924 | Open in IMG/M |
| 3300005289|Ga0065704_10879347 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300005293|Ga0065715_11095158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → Marinobacter lipolyticus | 521 | Open in IMG/M |
| 3300005331|Ga0070670_101801673 | Not Available | 563 | Open in IMG/M |
| 3300005343|Ga0070687_100436951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 867 | Open in IMG/M |
| 3300005354|Ga0070675_101881870 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300005364|Ga0070673_100187642 | All Organisms → cellular organisms → Bacteria | 1774 | Open in IMG/M |
| 3300005466|Ga0070685_10121460 | All Organisms → cellular organisms → Bacteria | 1623 | Open in IMG/M |
| 3300005518|Ga0070699_102014936 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 528 | Open in IMG/M |
| 3300005546|Ga0070696_100927913 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → Marinobacter lipolyticus | 723 | Open in IMG/M |
| 3300005546|Ga0070696_101447138 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 587 | Open in IMG/M |
| 3300005577|Ga0068857_101143861 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 752 | Open in IMG/M |
| 3300005615|Ga0070702_100365036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → Marinobacter lipolyticus | 1022 | Open in IMG/M |
| 3300005616|Ga0068852_102200431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → Marinobacter lipolyticus | 573 | Open in IMG/M |
| 3300005617|Ga0068859_101726000 | Not Available | 691 | Open in IMG/M |
| 3300005618|Ga0068864_100581075 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1085 | Open in IMG/M |
| 3300005618|Ga0068864_101458890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → Marinobacter lipolyticus | 687 | Open in IMG/M |
| 3300005618|Ga0068864_102623860 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 510 | Open in IMG/M |
| 3300005718|Ga0068866_10693606 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 698 | Open in IMG/M |
| 3300005840|Ga0068870_11219476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas | 545 | Open in IMG/M |
| 3300005841|Ga0068863_102310135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → Marinobacter lipolyticus | 547 | Open in IMG/M |
| 3300005876|Ga0075300_1043127 | Not Available | 636 | Open in IMG/M |
| 3300005983|Ga0081540_1275443 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 581 | Open in IMG/M |
| 3300006031|Ga0066651_10398237 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300006806|Ga0079220_11244565 | Not Available | 618 | Open in IMG/M |
| 3300006852|Ga0075433_11643632 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 554 | Open in IMG/M |
| 3300006903|Ga0075426_11444156 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 523 | Open in IMG/M |
| 3300007076|Ga0075435_100237390 | All Organisms → cellular organisms → Bacteria | 1550 | Open in IMG/M |
| 3300009088|Ga0099830_10854872 | Not Available | 751 | Open in IMG/M |
| 3300009094|Ga0111539_12388586 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300009098|Ga0105245_11892550 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300009098|Ga0105245_13069507 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
| 3300009162|Ga0075423_10436733 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1375 | Open in IMG/M |
| 3300010118|Ga0127465_1086796 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 694 | Open in IMG/M |
| 3300010147|Ga0126319_1646591 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 777 | Open in IMG/M |
| 3300010166|Ga0126306_10484905 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
| 3300010166|Ga0126306_11435847 | Not Available | 571 | Open in IMG/M |
| 3300010358|Ga0126370_10312356 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1252 | Open in IMG/M |
| 3300010360|Ga0126372_11112188 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 809 | Open in IMG/M |
| 3300010397|Ga0134124_10925723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 879 | Open in IMG/M |
| 3300010397|Ga0134124_11936681 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 625 | Open in IMG/M |
| 3300010399|Ga0134127_10945773 | Not Available | 919 | Open in IMG/M |
| 3300010403|Ga0134123_11667716 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 687 | Open in IMG/M |
| 3300011119|Ga0105246_10148897 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1769 | Open in IMG/M |
| 3300011119|Ga0105246_12163389 | Not Available | 540 | Open in IMG/M |
| 3300011332|Ga0126317_10766831 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 662 | Open in IMG/M |
| 3300012187|Ga0136622_10375585 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300012200|Ga0137382_10708217 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 722 | Open in IMG/M |
| 3300012205|Ga0137362_11375032 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| 3300012353|Ga0137367_10846896 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300012358|Ga0137368_10106713 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 2158 | Open in IMG/M |
| 3300012469|Ga0150984_100213754 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300012678|Ga0136615_10221243 | Not Available | 859 | Open in IMG/M |
| 3300012685|Ga0137397_11100751 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 579 | Open in IMG/M |
| 3300012929|Ga0137404_11218033 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300012948|Ga0126375_10786669 | Not Available | 752 | Open in IMG/M |
| 3300013102|Ga0157371_10882374 | Not Available | 677 | Open in IMG/M |
| 3300013308|Ga0157375_11671078 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 754 | Open in IMG/M |
| 3300013308|Ga0157375_12256637 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 649 | Open in IMG/M |
| 3300014325|Ga0163163_10500592 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1277 | Open in IMG/M |
| 3300014326|Ga0157380_10891722 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 915 | Open in IMG/M |
| 3300014487|Ga0182000_10219844 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300014968|Ga0157379_12170020 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
| 3300015162|Ga0167653_1000067 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 53040 | Open in IMG/M |
| 3300015372|Ga0132256_101151811 | Not Available | 889 | Open in IMG/M |
| 3300017695|Ga0180121_10008389 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 3843 | Open in IMG/M |
| 3300017792|Ga0163161_11491937 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300017792|Ga0163161_12065843 | Not Available | 507 | Open in IMG/M |
| 3300018054|Ga0184621_10123687 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 925 | Open in IMG/M |
| 3300018071|Ga0184618_10409597 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300018429|Ga0190272_10501026 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1031 | Open in IMG/M |
| 3300018429|Ga0190272_11984752 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
| 3300018939|Ga0193593_1003147 | All Organisms → cellular organisms → Bacteria | 4249 | Open in IMG/M |
| 3300019142|Ga0193597_1051236 | All Organisms → cellular organisms → Bacteria | 1364 | Open in IMG/M |
| 3300019244|Ga0180111_1404784 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300019883|Ga0193725_1098768 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 692 | Open in IMG/M |
| 3300020063|Ga0180118_1077615 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 753 | Open in IMG/M |
| 3300020067|Ga0180109_1175459 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 788 | Open in IMG/M |
| 3300020067|Ga0180109_1366439 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300020202|Ga0196964_10247688 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300020215|Ga0196963_10056793 | All Organisms → cellular organisms → Bacteria | 1632 | Open in IMG/M |
| 3300021445|Ga0182009_10742762 | Not Available | 534 | Open in IMG/M |
| 3300021475|Ga0210392_11162156 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300023201|Ga0256614_1544547 | Not Available | 510 | Open in IMG/M |
| 3300025908|Ga0207643_10673020 | Not Available | 668 | Open in IMG/M |
| 3300025910|Ga0207684_11309150 | Not Available | 596 | Open in IMG/M |
| 3300025911|Ga0207654_10822125 | Not Available | 672 | Open in IMG/M |
| 3300025913|Ga0207695_11159276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 653 | Open in IMG/M |
| 3300025914|Ga0207671_10987868 | Not Available | 664 | Open in IMG/M |
| 3300025919|Ga0207657_10739103 | Not Available | 763 | Open in IMG/M |
| 3300025942|Ga0207689_11493546 | Not Available | 564 | Open in IMG/M |
| 3300025960|Ga0207651_10289556 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1357 | Open in IMG/M |
| 3300025981|Ga0207640_11036987 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 723 | Open in IMG/M |
| 3300025986|Ga0207658_11449629 | Not Available | 628 | Open in IMG/M |
| 3300026088|Ga0207641_10513853 | Not Available | 1164 | Open in IMG/M |
| 3300026089|Ga0207648_11354894 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 669 | Open in IMG/M |
| 3300026095|Ga0207676_11260469 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 733 | Open in IMG/M |
| 3300026528|Ga0209378_1299654 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300027787|Ga0209074_10372316 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300028379|Ga0268266_10806740 | Not Available | 907 | Open in IMG/M |
| 3300028380|Ga0268265_10371693 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1312 | Open in IMG/M |
| 3300028380|Ga0268265_11535802 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300028380|Ga0268265_12005569 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 586 | Open in IMG/M |
| 3300030988|Ga0308183_1101826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → Marinobacter pelagius | 655 | Open in IMG/M |
| 3300030989|Ga0308196_1019126 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 787 | Open in IMG/M |
| 3300030990|Ga0308178_1045587 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 803 | Open in IMG/M |
| 3300030990|Ga0308178_1169988 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 512 | Open in IMG/M |
| 3300031081|Ga0308185_1055807 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 516 | Open in IMG/M |
| 3300031093|Ga0308197_10224660 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 652 | Open in IMG/M |
| 3300031095|Ga0308184_1020955 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300031096|Ga0308193_1088819 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 516 | Open in IMG/M |
| 3300031099|Ga0308181_1188201 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300031114|Ga0308187_10146776 | Not Available | 783 | Open in IMG/M |
| 3300031231|Ga0170824_113604524 | Not Available | 560 | Open in IMG/M |
| 3300031423|Ga0308177_1030538 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 518 | Open in IMG/M |
| 3300031538|Ga0310888_10919694 | Not Available | 547 | Open in IMG/M |
| 3300031720|Ga0307469_11817319 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 589 | Open in IMG/M |
| 3300031908|Ga0310900_10525066 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 924 | Open in IMG/M |
| 3300032205|Ga0307472_101487483 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 661 | Open in IMG/M |
| 3300034137|Ga0334943_101071 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300034138|Ga0334955_094761 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300034174|Ga0334932_068335 | Not Available | 613 | Open in IMG/M |
| 3300034178|Ga0364934_0326381 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300034221|Ga0334937_000642 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 6904 | Open in IMG/M |
| 3300034479|Ga0314785_021906 | Not Available | 527 | Open in IMG/M |
| 3300034659|Ga0314780_060405 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 783 | Open in IMG/M |
| 3300034659|Ga0314780_073995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → Marinobacter pelagius | 731 | Open in IMG/M |
| 3300034659|Ga0314780_083437 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 702 | Open in IMG/M |
| 3300034659|Ga0314780_122006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → Marinobacter pelagius | 616 | Open in IMG/M |
| 3300034662|Ga0314783_094101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → Marinobacter pelagius | 630 | Open in IMG/M |
| 3300034662|Ga0314783_106475 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 604 | Open in IMG/M |
| 3300034663|Ga0314784_062559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → Marinobacter pelagius | 707 | Open in IMG/M |
| 3300034663|Ga0314784_169277 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300034665|Ga0314787_045352 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300034665|Ga0314787_077373 | Not Available | 587 | Open in IMG/M |
| 3300034670|Ga0314795_020277 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1002 | Open in IMG/M |
| 3300034670|Ga0314795_138102 | Not Available | 519 | Open in IMG/M |
| 3300034675|Ga0314800_033196 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 681 | Open in IMG/M |
| 3300034678|Ga0314803_047932 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 11.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.59% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 6.85% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.11% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.42% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.42% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.42% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.42% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 2.74% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.74% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.74% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 2.05% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.05% |
| Biocrust | Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Biocrust | 2.05% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.05% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.05% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 1.37% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.37% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.37% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.37% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.37% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.37% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.37% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 1.37% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 1.37% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 1.37% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.37% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.37% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.37% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.37% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.68% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.68% |
| Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.68% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.68% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.68% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.68% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.68% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.68% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.68% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.68% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.68% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.68% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2140918013 | Soil microbial communities from Great Prairies - Iowa soil (MSU Assemblies) | Environmental | Open in IMG/M |
| 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005876 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_401 | Environmental | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300010118 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010147 | Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011332 | Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012187 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ448 (21.06) | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012678 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ288 (22.06) | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015162 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4c, rock/ice/stream interface) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300017695 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ540 (21.06) (version 2) | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018939 | Soil crust microbial communities from Colorado Plateau, Utah, USA - midlate stage, 9 hrs after wetting v1 | Environmental | Open in IMG/M |
| 3300019142 | Soil crust microbial communities from Colorado Plateau, Utah, USA - mid late stage, 3 min after wetting v1 | Environmental | Open in IMG/M |
| 3300019244 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT293_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
| 3300020063 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT730_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020067 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT47_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020202 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_10 | Environmental | Open in IMG/M |
| 3300020215 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_5 | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300023201 | Activated sludge enriched bacterial communities from WWTP in Fort Collins, Colorado, USA ? PN | Engineered | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300030988 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_157 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030989 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_197 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030990 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031081 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_159 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031095 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_158 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031096 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_194 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031099 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031423 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_148 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300034137 | Biocrust microbial communities from Mojave Desert, California, United States - 39SMC | Environmental | Open in IMG/M |
| 3300034138 | Biocrust microbial communities from Mojave Desert, California, United States - 51SNC | Environmental | Open in IMG/M |
| 3300034174 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 28HNS | Environmental | Open in IMG/M |
| 3300034178 | Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17 | Environmental | Open in IMG/M |
| 3300034221 | Biocrust microbial communities from Mojave Desert, California, United States - 33SMC | Environmental | Open in IMG/M |
| 3300034479 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034659 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034662 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034663 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034665 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034670 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034675 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034678 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Iowa-Corn-GraphCirc_00420780 | 2140918013 | Soil | MTYFLRDETGLELSEYAVAAALIAMACALAFSTLGGA |
| SwRhRL2b_0719.00003820 | 2162886007 | Switchgrass Rhizosphere | MFKKFLKDETGLELSEYAVAAALVAVATVAAFQLLG |
| INPhiseqgaiiFebDRAFT_1044753312 | 3300000364 | Soil | MFRNLLKDESGLELSEYAVAAALVAIATVTAFQLIGANIGARI |
| JGI11615J12901_106096362 | 3300000953 | Soil | VEKFLRCEKGLELSEYAVAAALVTALTVIAFASLGNVIV |
| JGI10216J12902_1002393143 | 3300000956 | Soil | MIKNFLKDESGLELSEYAVAAALVTLAVIVAFTAVGTN |
| Ga0062589_1018914511 | 3300004156 | Soil | MLKNFLSDETGLELSEYAVAAALIAIAVAGVFTALGDSIS |
| Ga0058859_100730283 | 3300004798 | Host-Associated | MFKKFLKDESGLELSEYAVAAALVALACVVAFQTLGTQIG |
| Ga0058859_117915111 | 3300004798 | Host-Associated | MIRSFLSDESGLELSEYAVAAALVTLAVVVAFTAVGTNIN |
| Ga0065704_108793471 | 3300005289 | Switchgrass Rhizosphere | MRTKITMIKAFLMDEQGLELSEYAVAAALVALATVAAFSALS |
| Ga0065715_110951582 | 3300005293 | Miscanthus Rhizosphere | MFKKFLIDETGLELSEYAVAAALVAVATIAAFQLLGTNIGSRI |
| Ga0070670_1018016732 | 3300005331 | Switchgrass Rhizosphere | MIKRFFADETGLELSEYAVAAALIALACVAAFQLLGTNIG |
| Ga0070687_1004369513 | 3300005343 | Switchgrass Rhizosphere | MIRKFLKDDTGLELSEYAVAAALIALAVVGIFGVLGNNINGVIN |
| Ga0070675_1018818701 | 3300005354 | Miscanthus Rhizosphere | MIKKFLRDETGLELSEYAVAAALVAIAVVGAFFTLGGTISDKI |
| Ga0070673_1001876421 | 3300005364 | Switchgrass Rhizosphere | MLKNFFSDETGLELSEYAVAAALIAIAVAGVFTALGDSISTKI |
| Ga0070685_101214603 | 3300005466 | Switchgrass Rhizosphere | RKESIMFKKFLKDETGLELSEYAVAAALVAVATVAAFQLLGN* |
| Ga0070699_1020149361 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | LIRGTNVIKTFLQDETGLELSEYAVAAALVTLAVIGAFTSV |
| Ga0070696_1009279133 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MLKRFFADETGLELSEYAVAAALIALACVVAFQTLGTNIGTKIN |
| Ga0070696_1014471382 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MTKHFFQDETGLELSEYAVAAALVAMACVAAFTTLGTAIGAK |
| Ga0068857_1011438612 | 3300005577 | Corn Rhizosphere | MIKRFFADETGLELSEYAVAAALIALACVAAFQLLGTN |
| Ga0070702_1003650363 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MIKKFFADETGLELSEYAVAAALIALACVVAFQTLGTNIGTKIN |
| Ga0068852_1022004313 | 3300005616 | Corn Rhizosphere | MFKRFINDETGLELSEYAVAAALVALAAVLAFQTL |
| Ga0068859_1017260001 | 3300005617 | Switchgrass Rhizosphere | MIKRFFADETGLELSEYAVAAALIALACVAAFQLLGT |
| Ga0068864_1005810751 | 3300005618 | Switchgrass Rhizosphere | MIKKFLKDESGLELSEYAVAAALVALACVAAFQLLG |
| Ga0068864_1014588901 | 3300005618 | Switchgrass Rhizosphere | MTYFLRDETGLELSEYAVAAALIAMACALAFSTLGGAIGDR |
| Ga0068864_1026238602 | 3300005618 | Switchgrass Rhizosphere | MKNFWLDETGLELSEYAVAAALVAIAVVGAFTALGT |
| Ga0068866_106936063 | 3300005718 | Miscanthus Rhizosphere | MKQFLIDETGLELSEYAVAAALVAIAVVGAFTALGTAIG |
| Ga0068870_112194762 | 3300005840 | Miscanthus Rhizosphere | MIRKFIRDESGLELSEYAVAAALVAIAVVGAFFTLGGTISDK |
| Ga0068863_1023101351 | 3300005841 | Switchgrass Rhizosphere | MFKKFLKDESGLELSEYAVAAALVALACVVAFQTLGTQ |
| Ga0075300_10431272 | 3300005876 | Rice Paddy Soil | MIKRFFRDETGLELSEYAVAAALVALAAVAAFQLL |
| Ga0081540_12754431 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MIKKFFADETGLELSEYAVAAALVALACVVAFQTLGTNI |
| Ga0066651_103982373 | 3300006031 | Soil | MIKKFFRDETGLELSEYAVAAALVAIAVVGAFAALGT |
| Ga0079220_112445651 | 3300006806 | Agricultural Soil | MIKRFFHDETGLELSEYAVAAALVALACVAAFQLL |
| Ga0075433_116436321 | 3300006852 | Populus Rhizosphere | MIKKFFSDETGLELSEYAVAAALVALACVAAFQLLGTNI |
| Ga0075426_114441561 | 3300006903 | Populus Rhizosphere | MITNFLKDETGLELSEYAVAAALIALAVVGIFTTLGN |
| Ga0075435_1002373904 | 3300007076 | Populus Rhizosphere | MITKFLKDETGLELSEYAVAAALIALAVVGIFTTL |
| Ga0099830_108548723 | 3300009088 | Vadose Zone Soil | MFTKFFKDETGLELSEYAVAAALVAVAVVGAFAALGTT |
| Ga0111539_123885863 | 3300009094 | Populus Rhizosphere | MFRKFLKDESGLELSEYAVAAALVALACVVAFQTLG |
| Ga0105245_118925502 | 3300009098 | Miscanthus Rhizosphere | MIKNFFRDETGLELSEYAVAAALVAIAVVGAFFTLGGTIS |
| Ga0105245_130695073 | 3300009098 | Miscanthus Rhizosphere | MIKKFFADETGLELSEYAVAAALVALACVVAFQTLGTNIGT |
| Ga0075423_104367335 | 3300009162 | Populus Rhizosphere | MFKKFLKDESGLELSEYAVAAALVALACVVAFQTLGTQI |
| Ga0127465_10867963 | 3300010118 | Grasslands Soil | MIRKFLSDETGLELSEYAVAAALIALATVGAFQLLGTNI |
| Ga0126319_16465913 | 3300010147 | Soil | MFKTFLSDETGLELSEYAVAAALIAIAVAGVFTALG |
| Ga0126306_104849052 | 3300010166 | Serpentine Soil | MLKRFFRDETGLELSEYAVAAALVILVAAGAFSALGGSI |
| Ga0126306_114358471 | 3300010166 | Serpentine Soil | MLKKFFRDETGLELSEYAVAAALIALATVTAFSGLGTTIKNA |
| Ga0126370_103123565 | 3300010358 | Tropical Forest Soil | MFKRFLSDETGLELSEYAVAAALVALACVAAFQLLGTN |
| Ga0126372_111121883 | 3300010360 | Tropical Forest Soil | MKEGMKPMFKRFMKDETGLELSEYAVAAALVALAAVL |
| Ga0134124_109257231 | 3300010397 | Terrestrial Soil | MKKFFLNETGLELSEYAVAAALVAIAVAAAYTALGDAIGVR |
| Ga0134124_119366813 | 3300010397 | Terrestrial Soil | MIMIKRFFADETGLELSEYAVAAALIALACVVAFQTLGTNIGTKIN |
| Ga0134127_109457733 | 3300010399 | Terrestrial Soil | MFIEFLRDETGLELSEYAVAAALVTIATVTAFQLVGT |
| Ga0134123_116677161 | 3300010403 | Terrestrial Soil | MELPMIKKFLKDESGLELSEYAVAAVLIAIAVVGVFGTLGTNI |
| Ga0105246_101488974 | 3300011119 | Miscanthus Rhizosphere | MLKRFFADETGLELSEYAVAAALIALACVVAFQTLGTNIGTKI |
| Ga0105246_121633892 | 3300011119 | Miscanthus Rhizosphere | MFKKFFKDETGLELSEYAVAAALVAIAAVAAFQLLGTN |
| Ga0126317_107668313 | 3300011332 | Soil | MFWKFLKDETGLELSEYAVAAALVALAAVVAFQTLG |
| Ga0136622_103755852 | 3300012187 | Polar Desert Sand | MIKKFLRDETGLELSEYAVAAALVALAVITAFSTLG |
| Ga0137382_107082172 | 3300012200 | Vadose Zone Soil | MIRNFFRDETGLELSEYAVAAALVAIAVVGAFSALGTTI |
| Ga0137362_113750323 | 3300012205 | Vadose Zone Soil | MIKNFLQDETGLELSEYAVAAALIALAVVGVFTTLGKNIGN |
| Ga0137367_108468963 | 3300012353 | Vadose Zone Soil | MIKNFLRDETGLELSEYAVAAALIAIACVTAFTNL |
| Ga0137368_101067131 | 3300012358 | Vadose Zone Soil | MQMIKRFFQDETGLELSEYAVAAALIAIAVVAAFTALG |
| Ga0150984_1002137542 | 3300012469 | Avena Fatua Rhizosphere | MIKRFLRDETGLELSEYAVAAALVALAAVAAFQLL |
| Ga0136615_102212431 | 3300012678 | Polar Desert Sand | MIKKFLRDETGLELSEYAVAAALVVAAGVAVFTLL |
| Ga0137397_111007511 | 3300012685 | Vadose Zone Soil | MIKKFFRDETGLELSEYAVAAASVAIAVVGAFTALGTAIS |
| Ga0137404_112180333 | 3300012929 | Vadose Zone Soil | MIKNFLRDETGLELSEYAVAAPLIATAGVLAFTTLAAPIPRKIK |
| Ga0126375_107866693 | 3300012948 | Tropical Forest Soil | MKDETGMELSEYAVAAALVTLAVVAAFGTLGRNIN |
| Ga0157371_108823741 | 3300013102 | Corn Rhizosphere | MFKKFLIDETGLELSEYAVAAALVAVATIAAFQLLGTNIGS |
| Ga0157375_116710782 | 3300013308 | Miscanthus Rhizosphere | MIKKFFADETGLELSEYAVAAALVALACVVAFQTLGTNIGTKINE |
| Ga0157375_122566372 | 3300013308 | Miscanthus Rhizosphere | MKNFWLDETGLELSEYAVAAALVAIAVVGAFTALGTAI |
| Ga0163163_105005921 | 3300014325 | Switchgrass Rhizosphere | MLKRFFADETGLELSEYAVAAALIALACVVAFQTL |
| Ga0157380_108917222 | 3300014326 | Switchgrass Rhizosphere | MKNFWLDETGLELSEYAVAAALVAIAVVGAFTALGTAIGD |
| Ga0182000_102198441 | 3300014487 | Soil | MIKRFFRDETGLELSEYAVAAALVALAAVLAFTALG |
| Ga0157379_121700202 | 3300014968 | Switchgrass Rhizosphere | MIKRFFSDETGLELSEYAVAAALVALAAVVAFQALGTNIGTK |
| Ga0167653_100006745 | 3300015162 | Glacier Forefield Soil | MISKFFRDETGLELSEYAVAAALVAIAVVGALTALG |
| Ga0132256_1011518111 | 3300015372 | Arabidopsis Rhizosphere | MLKRFLNDETGLELSEYAVAAALVALACVAAFQLLG |
| Ga0180121_100083891 | 3300017695 | Polar Desert Sand | MKKFLLDETGLELSEYAVAAALVAIAVVGAFTSLGT |
| Ga0163161_114919372 | 3300017792 | Switchgrass Rhizosphere | MIKSFFRDETGLELSEYAVAAALVALAAVAAFTAL |
| Ga0163161_120658433 | 3300017792 | Switchgrass Rhizosphere | MIKRFLMDEQGLELSEYAVAAALVALATVAAFTML |
| Ga0184621_101236871 | 3300018054 | Groundwater Sediment | MIRKFFRDETGLELSEYAVAAALVAIAVVGAFGLL |
| Ga0184618_104095971 | 3300018071 | Groundwater Sediment | MISKFLRDETGLELSEYAVAAALVAIAVVGAFFTLGGSI |
| Ga0190272_105010261 | 3300018429 | Soil | MFKQFLKDETGLELSEYAVAAALIAVAAAGVFTALG |
| Ga0190272_119847523 | 3300018429 | Soil | MIRKFFNDETGLELSEYAVAAALIALAVVGIFGTLGNNINGVIGN |
| Ga0193593_10031476 | 3300018939 | Soil | MIKKFLRDETGLELSEYAVAAALVALAVITAFSTLGT |
| Ga0193597_10512364 | 3300019142 | Soil | MIKKFLQDETGLELSEYAVAAALVALAVITAFSTLGKNIGIKIGD |
| Ga0180111_14047842 | 3300019244 | Groundwater Sediment | MIKRFFRDETGLELSEYAVAAALVAIAVVGAFTALGTAIS |
| Ga0193725_10987681 | 3300019883 | Soil | MIRKFFRDETGLELSEYAVAAALVAIAVVVAFTALGTAISSKI |
| Ga0180118_10776153 | 3300020063 | Groundwater Sediment | MIRNFFRDETGLELSEYAVAAALVAIAVVAAFTALG |
| Ga0180109_11754593 | 3300020067 | Groundwater Sediment | MIKNFLRDETGLELSEYAVAAALVAMACALAFTTLGVAIGDKIN |
| Ga0180109_13664393 | 3300020067 | Groundwater Sediment | MTKNFLQDETGLELSEYAVAAALVAMACALAFTTLGVAIGDKINT |
| Ga0196964_102476882 | 3300020202 | Soil | MIKRFLRDETGLELSEYAVAAALVAIAAVAAFKALG |
| Ga0196963_100567933 | 3300020215 | Soil | MLKRFFRDETGLELSEYAVAAALVAIATVVAFETLG |
| Ga0182009_107427621 | 3300021445 | Soil | MFRKFWSDESGLELSEYAVAAALVALACVAAFQLLGT |
| Ga0210392_111621563 | 3300021475 | Soil | MIIRFLKDEAGLELSEYAAAAALVTLAIVVAISTLGTNIAGKI |
| Ga0256614_15445471 | 3300023201 | Activated Sludge | MNKIKNFFLNDETGLELSEYAVAAALIAVVCVAAFTALSGGIGDA |
| Ga0207643_106730201 | 3300025908 | Miscanthus Rhizosphere | MIKRFFADETGLELSEYAVAAALIALACVAAFQLLG |
| Ga0207684_113091501 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MIKRFFSDETGLELSEYAVAAALVALAAVAAFQVAVV |
| Ga0207654_108221253 | 3300025911 | Corn Rhizosphere | MFKKFLKDESGLELSEYAVAAALVALACVVAFQTLGTQIGARI |
| Ga0207695_111592761 | 3300025913 | Corn Rhizosphere | MKNFWLDETGLELSEYAVAAALVAIAVVGAFTALGTAIGDK |
| Ga0207671_109878683 | 3300025914 | Corn Rhizosphere | MFKKFLKDETGLELSEYAVAAALVAVATIAAFQLL |
| Ga0207657_107391031 | 3300025919 | Corn Rhizosphere | MIKRFFADETGLELSEYAVAAALIALACVAAFQLLGTNIGIKI |
| Ga0207689_114935461 | 3300025942 | Miscanthus Rhizosphere | MIKRFFSDETGLELSEYAVAAALVALAAVAAFQLLGE |
| Ga0207651_102895563 | 3300025960 | Switchgrass Rhizosphere | MIKKFLNDETGLELSEYAVAAALVAMAAVVAFRTL |
| Ga0207640_110369871 | 3300025981 | Corn Rhizosphere | MIKRFFSDETGLELSEYAVAAALIALATVAAFQLLGTN |
| Ga0207658_114496293 | 3300025986 | Switchgrass Rhizosphere | MFRKFLKDESGLELSEYAVAAALIALACVAAFQLL |
| Ga0207641_105138533 | 3300026088 | Switchgrass Rhizosphere | MFKKFLKDETGLELSEYAVAAALVAVATVAAFQLLGTN |
| Ga0207648_113548943 | 3300026089 | Miscanthus Rhizosphere | MKQFLIDETGLELSEYAVAAALVAIAVVGAFTALGT |
| Ga0207676_112604691 | 3300026095 | Switchgrass Rhizosphere | MIKRFFADETGLELSEYAVAAALVALACVVAFQTLGTNIGT |
| Ga0209378_12996542 | 3300026528 | Soil | MIKRFFRDETGLELSEYAVAAALVAIAVVGAFFTLGG |
| Ga0209074_103723162 | 3300027787 | Agricultural Soil | VFRKFWSDESGLELSEYAVAAALVALACVAAFQLLGG |
| Ga0268266_108067404 | 3300028379 | Switchgrass Rhizosphere | MFKKFLKDETGLELSEYAVAAALVAVATVAAFQLLGT |
| Ga0268265_103716931 | 3300028380 | Switchgrass Rhizosphere | MIKRFFADETGLELSEYAVAAALIALACVAAFQLL |
| Ga0268265_115358022 | 3300028380 | Switchgrass Rhizosphere | MIKRFFRDETGLELSEYAVAAALIAIAVVGAFTAL |
| Ga0268265_120055691 | 3300028380 | Switchgrass Rhizosphere | MIKKFFRDETGLELSEYAVAAALVAIAVVGAFTALGTA |
| Ga0308183_11018262 | 3300030988 | Soil | VIRLFIRDETGLELSEYAVAAALVTLAVIGVFTALGGKI |
| Ga0308196_10191263 | 3300030989 | Soil | MKKFFIDETGLELSEYAVAAALVAIAVVGAFTALGTA |
| Ga0308178_10455873 | 3300030990 | Soil | MINKFLHDETGLELSEYAVAAALVAIAVAGVFMALGDAITTRIS |
| Ga0308178_11699882 | 3300030990 | Soil | MIRNFFRDETGLELSEYAVAAALVAMAVVAAFSALGTAIS |
| Ga0308185_10558072 | 3300031081 | Soil | MIKNFFRDETGLELSEYAVAAALVAIAVVGAFTALGGAI |
| Ga0308197_102246603 | 3300031093 | Soil | MFREFWKDETGLELSEYAVAAALVALACVVAFQTLGT |
| Ga0308184_10209553 | 3300031095 | Soil | MISKFLRDETGLELSEYAVAAALVAIAVVGAFFTL |
| Ga0308193_10888192 | 3300031096 | Soil | MISKFFRDETGLELSEYAVAAALVAIAVVGAFSALDETGLELS |
| Ga0308181_11882011 | 3300031099 | Soil | MIKRFFRDETGLELSEYAVAAALVAIAVVGAFFTLG |
| Ga0308187_101467762 | 3300031114 | Soil | MIKNFMIDETGLELSEYAVAAALIALAVVGVFTTLGN |
| Ga0170824_1136045242 | 3300031231 | Forest Soil | MIKNFLQDESGLELSEYAVAAALIALAVVGVFGLLGTSIKT |
| Ga0308177_10305382 | 3300031423 | Soil | MIKNFFRDETGLELSEYAVAAALVAIAVVGAFTALGTAIS |
| Ga0310888_109196942 | 3300031538 | Soil | MIRNFFRDETGLELSEYAVAAALVAIAAVVAFTTLG |
| Ga0307469_118173193 | 3300031720 | Hardwood Forest Soil | MIRTFLSDDTGLELSEYAVAAALIAVATVAAFQLLGTS |
| Ga0310900_105250661 | 3300031908 | Soil | MFRKFLTDETGLELSEYAVAAALVALACVVAYQTLGTNIGARIE |
| Ga0307472_1014874831 | 3300032205 | Hardwood Forest Soil | MIKRFFRDETGLELSEYAVAAALIALACVAAFQLLGT |
| Ga0334943_101071_444_554 | 3300034137 | Biocrust | MLKRFFRDETGLELSEYAVAAALVILVAAGAFSALGG |
| Ga0334955_094761_2_109 | 3300034138 | Biocrust | MIKKFLRDETGLELSEYAVAAALVALAVITAFTTLG |
| Ga0334932_068335_2_124 | 3300034174 | Sub-Biocrust Soil | MLKKFFRDETGLELSEYAVAAALVALATVTAFTSLGTTIKA |
| Ga0364934_0326381_1_111 | 3300034178 | Sediment | MSSRFLRDETGLELSEYAVAAALVAITVVVAFTYLGE |
| Ga0334937_000642_2_118 | 3300034221 | Biocrust | MLKKFFRDETGLELSEYAVAAALIALATVTAFSGLGTTS |
| Ga0314785_021906_3_107 | 3300034479 | Soil | MIRNFFRDETGLELSEYAVAAALVAIAAVIAFTTL |
| Ga0314780_060405_662_781 | 3300034659 | Soil | MRKFLLDETGLELSEYAVAAALVAIGAVGAFTALGNAIVL |
| Ga0314780_073995_2_121 | 3300034659 | Soil | MFKKFLIDETGLELSEYAVAAALVAVATIAAFQLLGTNIG |
| Ga0314780_083437_587_700 | 3300034659 | Soil | MIRKFFSDETGLELSEYAVAAAMIALATVAAFQLLGTS |
| Ga0314780_122006_1_108 | 3300034659 | Soil | MIKNFLQDETGLELSEYAVAAALIALAVVGVFATLG |
| Ga0314783_094101_510_629 | 3300034662 | Soil | MFKTFWKDETGLELSEYAVAAALVAIAAVLAFQTLGTNIG |
| Ga0314783_106475_2_121 | 3300034662 | Soil | MIKSFFSDESGLELSEYAVAAALVTLAVMVAFTAVGTNIN |
| Ga0314784_062559_598_705 | 3300034663 | Soil | MFKKFLIDETGLELSEYAVAAALVAVATIAAFQLLG |
| Ga0314784_169277_396_506 | 3300034663 | Soil | MFTRFLKDETGLELSEYAVAAALIALACVVAFQTLGT |
| Ga0314787_045352_3_113 | 3300034665 | Soil | MFKRFFRAEEGLELSEYAVAAALVVAGVVVAFTVLGN |
| Ga0314787_077373_477_587 | 3300034665 | Soil | MFTKFLKDESGLELSEYAVAAALVALAAVLAFQTLGG |
| Ga0314795_020277_2_121 | 3300034670 | Soil | MIRSFFSDESGLELSEYAVAAALVTLAVVVAFTAVGTNIN |
| Ga0314795_138102_410_517 | 3300034670 | Soil | MFRKFLKDESGLELSEYAVAAALIALACVAAFQLLG |
| Ga0314800_033196_577_681 | 3300034675 | Soil | MFRKFLKDESGLELSEYAVAAALVAIAAVAAFQLL |
| Ga0314803_047932_610_729 | 3300034678 | Soil | MFTKFFRDETGLELSEYAVAAALVAVATVLAFELLGSSIG |
| ⦗Top⦘ |