Basic Information | |
---|---|
Family ID | F049826 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 146 |
Average Sequence Length | 41 residues |
Representative Sequence | KGCDFGYALAANSCEGVTSVDACTVTALDAITAFAVPNPG |
Number of Associated Samples | 140 |
Number of Associated Scaffolds | 146 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 9.15 % |
% of genes near scaffold ends (potentially truncated) | 94.52 % |
% of genes from short scaffolds (< 2000 bps) | 91.78 % |
Associated GOLD sequencing projects | 135 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.25 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (58.219 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (18.493 % of family members) |
Environment Ontology (ENVO) | Unclassified (24.658 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (58.904 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 14.71% β-sheet: 17.65% Coil/Unstructured: 67.65% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.25 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 146 Family Scaffolds |
---|---|---|
PF13456 | RVT_3 | 21.92 |
PF00075 | RNase_H | 4.11 |
PF08238 | Sel1 | 1.37 |
PF14499 | DUF4437 | 1.37 |
PF02381 | MraZ | 0.68 |
PF02769 | AIRS_C | 0.68 |
PF13193 | AMP-binding_C | 0.68 |
PF02467 | Whib | 0.68 |
PF10099 | RskA | 0.68 |
PF04909 | Amidohydro_2 | 0.68 |
PF13883 | Pyrid_oxidase_2 | 0.68 |
PF13787 | HXXEE | 0.68 |
PF00313 | CSD | 0.68 |
PF13668 | Ferritin_2 | 0.68 |
PF01895 | PhoU | 0.68 |
PF00150 | Cellulase | 0.68 |
PF00589 | Phage_integrase | 0.68 |
PF02954 | HTH_8 | 0.68 |
PF00012 | HSP70 | 0.68 |
PF01494 | FAD_binding_3 | 0.68 |
PF00486 | Trans_reg_C | 0.68 |
PF04454 | Linocin_M18 | 0.68 |
PF01451 | LMWPc | 0.68 |
PF02771 | Acyl-CoA_dh_N | 0.68 |
PF02754 | CCG | 0.68 |
PF13286 | HD_assoc | 0.68 |
PF04542 | Sigma70_r2 | 0.68 |
PF04343 | DUF488 | 0.68 |
PF13561 | adh_short_C2 | 0.68 |
COG ID | Name | Functional Category | % Frequency in 146 Family Scaffolds |
---|---|---|---|
COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.37 |
COG0247 | Fe-S cluster-containing oxidoreductase, includes glycolate oxidase subunit GlcF | Energy production and conversion [C] | 0.68 |
COG0443 | Molecular chaperone DnaK (HSP70) | Posttranslational modification, protein turnover, chaperones [O] | 0.68 |
COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.68 |
COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.68 |
COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.68 |
COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.68 |
COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.68 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.68 |
COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.68 |
COG2001 | MraZ, DNA-binding transcriptional regulator and inhibitor of RsmH methyltransferase activity | Translation, ribosomal structure and biogenesis [J] | 0.68 |
COG2048 | Heterodisulfide reductase, subunit B | Energy production and conversion [C] | 0.68 |
COG2730 | Aryl-phospho-beta-D-glucosidase BglC, GH1 family | Carbohydrate transport and metabolism [G] | 0.68 |
COG3189 | Uncharacterized conserved protein YeaO, DUF488 family | Function unknown [S] | 0.68 |
COG3934 | Endo-1,4-beta-mannosidase | Carbohydrate transport and metabolism [G] | 0.68 |
COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.68 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 58.22 % |
All Organisms | root | All Organisms | 41.78 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001213|JGIcombinedJ13530_101181214 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1021 | Open in IMG/M |
3300002162|JGI24139J26690_1084129 | Not Available | 571 | Open in IMG/M |
3300003368|JGI26340J50214_10161201 | Not Available | 560 | Open in IMG/M |
3300004091|Ga0062387_101304151 | Not Available | 574 | Open in IMG/M |
3300004152|Ga0062386_101767533 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300004479|Ga0062595_100425021 | Not Available | 964 | Open in IMG/M |
3300004479|Ga0062595_102191700 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
3300005332|Ga0066388_100192581 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2655 | Open in IMG/M |
3300005345|Ga0070692_10267605 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1030 | Open in IMG/M |
3300005548|Ga0070665_101299184 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 737 | Open in IMG/M |
3300005880|Ga0075298_1032463 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
3300005921|Ga0070766_10000117 | All Organisms → cellular organisms → Bacteria | 30029 | Open in IMG/M |
3300005921|Ga0070766_11104102 | Not Available | 547 | Open in IMG/M |
3300006034|Ga0066656_10971406 | Not Available | 545 | Open in IMG/M |
3300006086|Ga0075019_11166139 | Not Available | 502 | Open in IMG/M |
3300006174|Ga0075014_100941789 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
3300006237|Ga0097621_100598511 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1007 | Open in IMG/M |
3300006797|Ga0066659_11426023 | Not Available | 579 | Open in IMG/M |
3300007255|Ga0099791_10315409 | Not Available | 746 | Open in IMG/M |
3300008785|Ga0103638_1002767 | Not Available | 592 | Open in IMG/M |
3300009629|Ga0116119_1149069 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
3300010075|Ga0127434_114372 | Not Available | 534 | Open in IMG/M |
3300010080|Ga0127448_124791 | Not Available | 1585 | Open in IMG/M |
3300010108|Ga0127474_1080273 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
3300010322|Ga0134084_10115878 | Not Available | 870 | Open in IMG/M |
3300010343|Ga0074044_10184490 | Not Available | 1389 | Open in IMG/M |
3300010358|Ga0126370_10006021 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6147 | Open in IMG/M |
3300010360|Ga0126372_10313182 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1387 | Open in IMG/M |
3300010857|Ga0126354_1170956 | Not Available | 518 | Open in IMG/M |
3300011028|Ga0138577_117479 | Not Available | 530 | Open in IMG/M |
3300012189|Ga0137388_10655866 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 975 | Open in IMG/M |
3300012208|Ga0137376_11505437 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
3300012354|Ga0137366_10717773 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 712 | Open in IMG/M |
3300012373|Ga0134042_1220430 | Not Available | 526 | Open in IMG/M |
3300012387|Ga0134030_1005507 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300012407|Ga0134050_1070522 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300013296|Ga0157374_12518454 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
3300014158|Ga0181521_10021583 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 5330 | Open in IMG/M |
3300014162|Ga0181538_10354841 | Not Available | 788 | Open in IMG/M |
3300014165|Ga0181523_10393421 | Not Available | 773 | Open in IMG/M |
3300014199|Ga0181535_10147313 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1478 | Open in IMG/M |
3300014200|Ga0181526_10531803 | Not Available | 744 | Open in IMG/M |
3300015053|Ga0137405_1190100 | Not Available | 1633 | Open in IMG/M |
3300015245|Ga0137409_10000190 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 62520 | Open in IMG/M |
3300015371|Ga0132258_11299240 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1839 | Open in IMG/M |
3300016319|Ga0182033_11032927 | Not Available | 732 | Open in IMG/M |
3300016371|Ga0182034_11090810 | Not Available | 692 | Open in IMG/M |
3300016422|Ga0182039_12250652 | Not Available | 503 | Open in IMG/M |
3300016445|Ga0182038_11767366 | Not Available | 558 | Open in IMG/M |
3300016698|Ga0181503_1370207 | Not Available | 542 | Open in IMG/M |
3300016705|Ga0181507_1143035 | Not Available | 606 | Open in IMG/M |
3300017932|Ga0187814_10376325 | Not Available | 551 | Open in IMG/M |
3300017934|Ga0187803_10464624 | Not Available | 516 | Open in IMG/M |
3300017938|Ga0187854_10226592 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 817 | Open in IMG/M |
3300017955|Ga0187817_11135898 | Not Available | 502 | Open in IMG/M |
3300017970|Ga0187783_10954678 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 618 | Open in IMG/M |
3300017996|Ga0187891_1311292 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
3300018035|Ga0187875_10409189 | Not Available | 724 | Open in IMG/M |
3300018044|Ga0187890_10734386 | Not Available | 558 | Open in IMG/M |
3300018057|Ga0187858_10226411 | All Organisms → cellular organisms → Bacteria | 1209 | Open in IMG/M |
3300018086|Ga0187769_11180869 | Not Available | 579 | Open in IMG/M |
3300019178|Ga0184583_117388 | Not Available | 860 | Open in IMG/M |
3300019179|Ga0184593_128238 | Not Available | 555 | Open in IMG/M |
3300019181|Ga0184594_114584 | Not Available | 557 | Open in IMG/M |
3300019230|Ga0181501_1021287 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
3300019260|Ga0181506_1050938 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
3300020583|Ga0210401_10601783 | Not Available | 961 | Open in IMG/M |
3300021401|Ga0210393_10963904 | Not Available | 691 | Open in IMG/M |
3300021405|Ga0210387_10008403 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7892 | Open in IMG/M |
3300021559|Ga0210409_10473249 | Not Available | 1115 | Open in IMG/M |
3300022499|Ga0242641_1016583 | Not Available | 713 | Open in IMG/M |
3300022502|Ga0242646_1007110 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 865 | Open in IMG/M |
3300022503|Ga0242650_1008885 | Not Available | 720 | Open in IMG/M |
3300022507|Ga0222729_1026534 | Not Available | 714 | Open in IMG/M |
3300022508|Ga0222728_1071557 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
3300022509|Ga0242649_1005315 | Not Available | 1218 | Open in IMG/M |
3300022523|Ga0242663_1062085 | Not Available | 682 | Open in IMG/M |
3300022531|Ga0242660_1084962 | Not Available | 751 | Open in IMG/M |
3300022531|Ga0242660_1148859 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Magnetospirillum | 611 | Open in IMG/M |
3300022711|Ga0242674_1022190 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 750 | Open in IMG/M |
3300022711|Ga0242674_1023171 | Not Available | 739 | Open in IMG/M |
3300022714|Ga0242671_1114264 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
3300022716|Ga0242673_1098820 | Not Available | 562 | Open in IMG/M |
3300022718|Ga0242675_1047552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 709 | Open in IMG/M |
3300022726|Ga0242654_10441192 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 506 | Open in IMG/M |
3300023551|Ga0247546_105888 | Not Available | 521 | Open in IMG/M |
3300023558|Ga0247526_112395 | Not Available | 705 | Open in IMG/M |
3300023666|Ga0247531_112148 | Not Available | 669 | Open in IMG/M |
3300024288|Ga0179589_10563992 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
3300025527|Ga0208714_1038113 | Not Available | 1089 | Open in IMG/M |
3300025650|Ga0209385_1014998 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3189 | Open in IMG/M |
3300025711|Ga0207696_1121260 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 705 | Open in IMG/M |
3300025878|Ga0209584_10325074 | Not Available | 592 | Open in IMG/M |
3300025981|Ga0207640_10735593 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 849 | Open in IMG/M |
3300026502|Ga0255350_1053454 | Not Available | 954 | Open in IMG/M |
3300026515|Ga0257158_1046420 | Not Available | 795 | Open in IMG/M |
3300026849|Ga0207804_105343 | All Organisms → cellular organisms → Bacteria | 1248 | Open in IMG/M |
3300026908|Ga0207787_1030038 | Not Available | 534 | Open in IMG/M |
3300026910|Ga0207840_1022880 | Not Available | 618 | Open in IMG/M |
3300026928|Ga0207779_1014374 | Not Available | 1064 | Open in IMG/M |
3300026990|Ga0207824_1016918 | Not Available | 780 | Open in IMG/M |
3300027031|Ga0208986_1035691 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
3300027330|Ga0207777_1005412 | All Organisms → cellular organisms → Bacteria | 2956 | Open in IMG/M |
3300027330|Ga0207777_1060625 | Not Available | 665 | Open in IMG/M |
3300027768|Ga0209772_10252601 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 559 | Open in IMG/M |
3300027812|Ga0209656_10195641 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
3300027826|Ga0209060_10140456 | Not Available | 1122 | Open in IMG/M |
3300027867|Ga0209167_10375794 | Not Available | 774 | Open in IMG/M |
3300027889|Ga0209380_10799006 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
3300027898|Ga0209067_10977682 | Not Available | 500 | Open in IMG/M |
3300028857|Ga0302289_1158108 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
3300028868|Ga0302163_10142804 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
3300029817|Ga0247275_1023944 | All Organisms → cellular organisms → Bacteria | 1898 | Open in IMG/M |
3300029984|Ga0311332_10173017 | Not Available | 1614 | Open in IMG/M |
3300030880|Ga0265776_103035 | Not Available | 800 | Open in IMG/M |
3300030886|Ga0265772_105188 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 579 | Open in IMG/M |
3300030888|Ga0265769_105312 | Not Available | 780 | Open in IMG/M |
3300030982|Ga0265748_106052 | Not Available | 592 | Open in IMG/M |
3300031017|Ga0265744_107066 | Not Available | 643 | Open in IMG/M |
3300031043|Ga0265779_105502 | Not Available | 695 | Open in IMG/M |
3300031231|Ga0170824_103604873 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
3300031543|Ga0318516_10127056 | All Organisms → cellular organisms → Bacteria | 1456 | Open in IMG/M |
3300031679|Ga0318561_10405318 | Not Available | 749 | Open in IMG/M |
3300031726|Ga0302321_102058140 | Not Available | 663 | Open in IMG/M |
3300031770|Ga0318521_10106606 | All Organisms → cellular organisms → Bacteria | 1550 | Open in IMG/M |
3300031833|Ga0310917_10628940 | Not Available | 728 | Open in IMG/M |
3300031879|Ga0306919_11033201 | Not Available | 628 | Open in IMG/M |
3300031880|Ga0318544_10299551 | Not Available | 624 | Open in IMG/M |
3300031910|Ga0306923_10929820 | Not Available | 950 | Open in IMG/M |
3300031946|Ga0310910_10210365 | Not Available | 1511 | Open in IMG/M |
3300032072|Ga0326631_109927 | Not Available | 622 | Open in IMG/M |
3300032089|Ga0318525_10399146 | Not Available | 705 | Open in IMG/M |
3300032180|Ga0307471_102517664 | Not Available | 651 | Open in IMG/M |
3300032261|Ga0306920_101564293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylocaldum → Methylocaldum marinum | 939 | Open in IMG/M |
3300032515|Ga0348332_14009730 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter modestus | 620 | Open in IMG/M |
3300032515|Ga0348332_14388840 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1300 | Open in IMG/M |
3300032828|Ga0335080_10262582 | All Organisms → cellular organisms → Bacteria | 1884 | Open in IMG/M |
3300032892|Ga0335081_12559240 | Not Available | 525 | Open in IMG/M |
3300032898|Ga0335072_11508345 | Not Available | 573 | Open in IMG/M |
3300033134|Ga0335073_11101655 | Not Available | 809 | Open in IMG/M |
3300033158|Ga0335077_10574993 | All Organisms → cellular organisms → Bacteria | 1180 | Open in IMG/M |
3300034820|Ga0373959_0230106 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.49% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.90% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 6.16% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.48% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.79% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.79% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.79% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.42% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 3.42% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.42% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 2.74% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.74% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 2.74% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.05% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.05% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.05% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.37% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.37% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.37% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.37% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 1.37% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.68% |
Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.68% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.68% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.68% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.68% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.68% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.68% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.68% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.68% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.68% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.68% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.68% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.68% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.68% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.68% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.68% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.68% |
Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.68% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.68% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.68% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.68% |
Wetland Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Wetland Soil | 0.68% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
3300002162 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 002-21A | Environmental | Open in IMG/M |
3300003368 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 | Environmental | Open in IMG/M |
3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005880 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_201 | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300008785 | Microbial communities from wetland soil in Czech Republic - R1_cDNA | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009629 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100 | Environmental | Open in IMG/M |
3300010075 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010080 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010108 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010857 | Boreal forest soil eukaryotic communities from Alaska, USA - W1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011028 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 64 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012373 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012387 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012407 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300016698 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300016705 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017996 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40 | Environmental | Open in IMG/M |
3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300019178 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019179 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZI2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019181 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZI3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019230 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019260 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300022499 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022502 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022503 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022507 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022508 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022509 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022523 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022711 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022714 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022716 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022718 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300023551 | Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSA4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300023558 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300023666 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
3300025527 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025650 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B (SPAdes) | Environmental | Open in IMG/M |
3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025878 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes) | Environmental | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026502 | Peat soil microbial communities from Stordalen Mire, Sweden - H.B.S.T-25.r1 | Environmental | Open in IMG/M |
3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
3300026849 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 46 (SPAdes) | Environmental | Open in IMG/M |
3300026908 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 77 (SPAdes) | Environmental | Open in IMG/M |
3300026910 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 65 (SPAdes) | Environmental | Open in IMG/M |
3300026928 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 44 (SPAdes) | Environmental | Open in IMG/M |
3300026990 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 73 (SPAdes) | Environmental | Open in IMG/M |
3300027031 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027330 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 35 (SPAdes) | Environmental | Open in IMG/M |
3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
3300028857 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N1_2 | Environmental | Open in IMG/M |
3300028868 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E2_3 | Environmental | Open in IMG/M |
3300029817 | Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Bog25 | Environmental | Open in IMG/M |
3300029984 | I_Fen_E1 coassembly | Environmental | Open in IMG/M |
3300030880 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030886 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030888 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030982 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031017 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031043 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300032072 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSI2 metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGIcombinedJ13530_1011812143 | 3300001213 | Wetland | VAKNRKGCDFGYAPAADSCEGVSGVDACTVAALDTITAF |
JGI24139J26690_10841291 | 3300002162 | Arctic Peat Soil | KTASNRKGCDFGYALAADSCEGATGVDACTVTALGAITAFAVPNPG* |
JGI26340J50214_101612012 | 3300003368 | Bog Forest Soil | GCDFGYALADNSCEGVPGVDACTVTAFDAVTAFAVPNPN* |
Ga0062387_1013041511 | 3300004091 | Bog Forest Soil | AKGKGCDFGYALADNSRERVTSVDACTVTALDAVTAFAVPNPN* |
Ga0062386_1017675332 | 3300004152 | Bog Forest Soil | VVGRIATRRAIEKGCDFGYALAAGSCERVTGVDACTVTALGAITAF |
Ga0062595_1004250212 | 3300004479 | Soil | KGCDIGYALATRSCEGACSVDACTVTALDVISAFAVPDPN* |
Ga0062595_1021917003 | 3300004479 | Soil | MREGNRKGRDIGYALAASSCEEANSVDACTITALDVIAAFAV |
Ga0066684_109977481 | 3300005179 | Soil | VVTGKIKGRDIGYAPTINSCEGVNSVDTCTITALDVITAFAVPNPNCS |
Ga0066388_1001925813 | 3300005332 | Tropical Forest Soil | VEDNREEPGKKRKGCDLGYALARYSCERVAGVDACTVTALDVITAFAVPDPG* |
Ga0070692_102676051 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | KGCDIGYALAARSCEGADCVDACTVTALDVITAFAVPNPG* |
Ga0070665_1012991842 | 3300005548 | Switchgrass Rhizosphere | VTKKLKGCDIGYALAARSCEGADCVDACTVTALDVITAFAVP |
Ga0066703_105434652 | 3300005568 | Soil | GYALATGSCEEANSVDAYTVTTLDVITAFAVQQG* |
Ga0075298_10324631 | 3300005880 | Rice Paddy Soil | KGRDIGYALAASSCEGANNVEACTVTTLDAITAFAVPDPN* |
Ga0070766_100001172 | 3300005921 | Soil | LGNRKGCDFGYALADNSCEGALGVDACTVTALDAATAFAVPNPG* |
Ga0070766_111041021 | 3300005921 | Soil | LAADSCEGVSSVDARTVAAPDAITAFAVPNDERPL* |
Ga0066656_109714061 | 3300006034 | Soil | KGRDIGYALAASSCEEANNVETCTVTTPDAIAAFAAPNPG* |
Ga0075019_111661391 | 3300006086 | Watersheds | KGKGCDFGYALADNSRERVPSVDACTVTALDAITAFAVPNPG* |
Ga0075014_1009417891 | 3300006174 | Watersheds | KGKGCDFGYALADNSRERVPGVDACTVTALDAITAFAVPNPG* |
Ga0097621_1005985111 | 3300006237 | Miscanthus Rhizosphere | KLKGCDIGYALAARSCEGADCVDACTVTALDVITAFAVPNPG* |
Ga0066659_114260232 | 3300006797 | Soil | CDIGYALAASSCEGANNVDACTVTALDVITVFTVPNPNCSSQS* |
Ga0099791_103154092 | 3300007255 | Vadose Zone Soil | YALAASSCEEANNVETCTVTTPDATAAFAAPNPG* |
Ga0103638_10027671 | 3300008785 | Wetland Soil | KGCDFGYALADNSCERVPGVDACTVAALDVTTAFADS* |
Ga0066709_1030306362 | 3300009137 | Grasslands Soil | VNEIDGKRHKEVKGRDIGYALAAHSCEGVSRVETCTVTAPDVITTFAVPN |
Ga0116119_11490691 | 3300009629 | Peatland | LSDYRWRVLGRTNGKGCDFGYALAANSCEGVTGVDACTVTAFDAITA |
Ga0127434_1143721 | 3300010075 | Grasslands Soil | DIGYALAAGSCEEANNVETCTVTTPDATTAFAVPNPG* |
Ga0127448_1247912 | 3300010080 | Grasslands Soil | YALVASSCEEANNVETCTVTTPDAIAAFAAPNPG* |
Ga0127474_10802732 | 3300010108 | Grasslands Soil | DIGYALAADSCEEANNVETCTVTTPDAITAFAVPNPG* |
Ga0134084_101158781 | 3300010322 | Grasslands Soil | GRDIGYALAAGSCEEANNVETCTVTTPDATTAFAVPNPG* |
Ga0074044_101844903 | 3300010343 | Bog Forest Soil | AASINGALKHRKGCDFGYASAANSCEGVSGVDACIVTALDVITGFAVPSPN* |
Ga0126370_100060213 | 3300010358 | Tropical Forest Soil | VEDNREEPRKKRKGCDLGYALARYSCERVAGVDACTVTALDVITAFAVPDPG* |
Ga0126372_103131823 | 3300010360 | Tropical Forest Soil | EDNREEPRKKRKGCDLGYALASYSCERVAGVDACTVTALDVITAFAVPDPG* |
Ga0126354_11709561 | 3300010857 | Boreal Forest Soil | GCDFGYALADNSCEGAPGVDACTVTALDAATAFAVPNPG* |
Ga0138577_1174791 | 3300011028 | Peatlands Soil | IGYALANDSCEGAPGVDACTVTALGAITAFAVPDPG* |
Ga0137388_106558661 | 3300012189 | Vadose Zone Soil | KGRDIGYALAASSCEGANNVETCTVTTLDATTAFAVPNPG* |
Ga0137376_115054371 | 3300012208 | Vadose Zone Soil | RNGKGCDIGYALAVCSCEEADSVDACTVTALDATTAFAVPNPG* |
Ga0137366_107177731 | 3300012354 | Vadose Zone Soil | IGYALAISSCEGANSVDACTVTALDAITAFAVPNPNCSSQS* |
Ga0134042_12204301 | 3300012373 | Grasslands Soil | MRVLAVRSCEEANSVDACTVTTLDVITAFAVPNLNCP |
Ga0134030_10055072 | 3300012387 | Grasslands Soil | DIGYALAASSCEEANNVEKCTVTTLDVTTAFAVPNPG* |
Ga0134050_10705221 | 3300012407 | Grasslands Soil | IGYALAANSCEGANNVETCTVTTLDVTTAFAVPNPG* |
Ga0157374_125184541 | 3300013296 | Miscanthus Rhizosphere | VTKKLKGCDIGYALAARSCEGADCVDACTVTALDVITAFAVPN |
Ga0181521_100215836 | 3300014158 | Bog | GYALADNSRERVPSVDACTVTALDAITAFAVPNPG* |
Ga0181538_103548412 | 3300014162 | Bog | YALAANSCEGVTSVDACTVTALDAITAFAVPNPG* |
Ga0181523_103934211 | 3300014165 | Bog | KGCDFGYAPSDNSCERVPGLDACTVAALDVTTAFADS* |
Ga0181535_101473131 | 3300014199 | Bog | KGCDFGYALAANSCEGVTSVDACTVTALDAITAFAVPNPG* |
Ga0181526_105318031 | 3300014200 | Bog | FGYALAANSCEGVTSVDACTVTALDAITAFAVPNPG* |
Ga0137405_11901001 | 3300015053 | Vadose Zone Soil | ASSCEEACEEADSVDACTVTALDATTAFAVPNPG* |
Ga0137409_100001901 | 3300015245 | Vadose Zone Soil | GYALAASSCEEANSVDACTVTALDATTAFAVPYPG* |
Ga0132258_112992404 | 3300015371 | Arabidopsis Rhizosphere | LKGCDIGYALAARSCEGADCVDACTVTALDVITAFAVPNPG* |
Ga0182033_110329271 | 3300016319 | Soil | VSRSRREGCGIGYALATNSCERVNSMDACTVTAFGAITAFAVPSPGSSLAT |
Ga0182034_110908101 | 3300016371 | Soil | KNRRDNLKGCDFGYALAGNSCEEVTSVDACTVTAPDVITAFTVPGPG |
Ga0182039_122506521 | 3300016422 | Soil | GCDFGYALASNSCEGVPSVDACTVTAPDVITAFAVPDPG |
Ga0182038_117673662 | 3300016445 | Soil | RDNLKGCDFGYALAGNSCEEVPSVDACTVTAPDVITAFAVPNPG |
Ga0181503_13702071 | 3300016698 | Peatland | CDFGYALAANSCEGVTGVDACTVTALDAITAFAVPNPG |
Ga0181507_11430351 | 3300016705 | Peatland | GYALAANSCEGVTSVDACTVTALDAITAFAVPNPG |
Ga0187814_103763251 | 3300017932 | Freshwater Sediment | GYAPAGNSHERVPSVDACTVTALDVITAFAVPNPG |
Ga0187803_104646241 | 3300017934 | Freshwater Sediment | DIGYALAADSCEGAHSVDACTVTAPEAITTFAVPNPN |
Ga0187854_102265921 | 3300017938 | Peatland | KGCDFGYALAANSCEGVTSVDACTVTAFDAITAFAVPNPG |
Ga0187817_111358981 | 3300017955 | Freshwater Sediment | KGKGCDFGYALADNSRERVPSVDACTVTALDAITAFAVPDPG |
Ga0187783_109546781 | 3300017970 | Tropical Peatland | GCDFGYAPASNSRERVPSVDACTVTALDAITAFAVPNPG |
Ga0187891_13112922 | 3300017996 | Peatland | VGSNRKGCDIGYGLAANSCEGVNSVDACTVTALDAITAFAVPNPGG |
Ga0187875_104091892 | 3300018035 | Peatland | WRVLGRTNGKGCDFGYALAANSCEGVTGVDACTVTAFDAITAFAVPNPG |
Ga0187890_107343861 | 3300018044 | Peatland | GCDFGYALAANSCEGVTSVDACTVTAFDAITAFAVPNPG |
Ga0187858_102264111 | 3300018057 | Peatland | KGKGCDFGYALADNSRERVPSVDACTVTALDAITAFAVPNPG |
Ga0187769_111808691 | 3300018086 | Tropical Peatland | MKGCDIGYVPAADSGEGVDNVETCTVTAPGAITAFAVPNPGN |
Ga0184583_1173881 | 3300019178 | Soil | IGYALAVGSCEGANDVESCTITAFDVITAFAVPNPGHILAE |
Ga0184593_1282381 | 3300019179 | Soil | FGYALATNSCEGATGVDACTVTALQAITAFAVPNPG |
Ga0184594_1145841 | 3300019181 | Soil | DFGYALAANSCEGVTSVDARTVTALDAITAFAVPNPG |
Ga0181501_10212872 | 3300019230 | Peatland | DFGYGLAADSCEGVLGVDACTVTALGAISAFAASDPG |
Ga0181506_10509381 | 3300019260 | Peatland | YALAIRSCERAHSVEACTVTALDAITAFAVPNPNQFPA |
Ga0210401_106017831 | 3300020583 | Soil | EFEEKGKGRDIGYALAVNSCEGANDVESCTITAFDVITAFAVPYPGHILAE |
Ga0210393_109639042 | 3300021401 | Soil | YALAVNSCEGAGDVESCTITAFDVITAFAVPYPGHILAE |
Ga0210387_1000840313 | 3300021405 | Soil | ERKRKGRDIGYALAVNSCEGAGDVESCTITAFDVITAFAVPYPGHILAE |
Ga0210409_104732493 | 3300021559 | Soil | KGCDFGYALAGNSCEGAPGVDACTVTALDVTTAFAVPNLG |
Ga0242641_10165832 | 3300022499 | Soil | CDFGYALAANSCEGATGVDACTVTALCAITAFADRD |
Ga0242646_10071102 | 3300022502 | Soil | DIGYALADSSCEGAPSVDACTVTALDAITAFAVPYPNCPSQFQPG |
Ga0242650_10088851 | 3300022503 | Soil | FGYALAANSCEGVAGVDACTVTAFRAINAFAVPDPG |
Ga0222729_10265341 | 3300022507 | Soil | DFGYALAADSCEGADSVDACTVTALGAIAAFAVPDPG |
Ga0222728_10715572 | 3300022508 | Soil | AAGSCEGANDVESCTITAFDVITAFAVPNPGHILAE |
Ga0242649_10053152 | 3300022509 | Soil | DFGYALADNSCEGALGVDACTVTALDAATAFAVPNPG |
Ga0242663_10620851 | 3300022523 | Soil | DFGYALAAASCEGATGVDACTVTALGAITAFAVPNPG |
Ga0242660_10849621 | 3300022531 | Soil | DFGYALADNSCEGATGVDACTVTALGAITAFAVPNPG |
Ga0242660_11488591 | 3300022531 | Soil | IGYALAASSCEEANSVDACTVTALDATTAFAVPNPG |
Ga0242674_10221901 | 3300022711 | Soil | GYALAASSCEGAFSVDACTVTALDAITAFAVPNPG |
Ga0242674_10231712 | 3300022711 | Soil | YALAVNSCEGAGDVESCTITAFDVITAFAVPYPGLILAD |
Ga0242671_11142641 | 3300022714 | Soil | DIGYALAASSCEGANNVDACTVTALDAITVFTVPNPNCSSQS |
Ga0242673_10988201 | 3300022716 | Soil | DIGYAIAVNSCEGAGDVESCTITAFDVITAFAVPYPGLILAD |
Ga0242675_10475522 | 3300022718 | Soil | ENARKGKGRDLGYALAVNSCEGAGDVESCTITAFDVITAFAVPNPGHILAE |
Ga0242654_104411921 | 3300022726 | Soil | DIGYALAASSCEEANSVDACTVTAFDAITAFAVPNPG |
Ga0247546_1058881 | 3300023551 | Soil | DFGYALAAASCEGATGVDACTVTALGAITAFAVPDPG |
Ga0247526_1123951 | 3300023558 | Soil | CDFGYALATDSCEGADSVDACTVTALGAITAFAVPDPG |
Ga0247531_1121481 | 3300023666 | Soil | DFGYALATDSCEGADSVDACTVTALGAITAFAVPDPG |
Ga0179589_105639921 | 3300024288 | Vadose Zone Soil | DIGYALAASSCEEANNVETCTVTTLGATTAFAVPNPG |
Ga0208714_10381131 | 3300025527 | Arctic Peat Soil | GYALAADSCEGATGVDACTVTALGAITAFAVPNPG |
Ga0209385_10149981 | 3300025650 | Arctic Peat Soil | AKGKGCDFGYALADNSRERVPSVDACTVTALDAVTAFADPNPN |
Ga0207696_11212601 | 3300025711 | Switchgrass Rhizosphere | GYALAARSCEGADCVDACTVTALDVITAFAVPNPG |
Ga0209584_103250741 | 3300025878 | Arctic Peat Soil | DFGYALAADSCEGATGVDACTVTALGAITAFAVPDPG |
Ga0207690_109897821 | 3300025932 | Corn Rhizosphere | DCGCALANGSCEEANSVDAYTVPPLDVITAFAVQQG |
Ga0207640_107355931 | 3300025981 | Corn Rhizosphere | KKKLKGCDIGYALAARSCEGADCVDACTVTALDVITAFAVPNPG |
Ga0255350_10534541 | 3300026502 | Soil | KGCDFGYALAANSCEGVTGVDACTVTAFEAITAFAVPNPG |
Ga0257158_10464202 | 3300026515 | Soil | SRNKNGKGCDIGYALAASSCEEANSVDACTVTALDATTAFAVPNPG |
Ga0207804_1053432 | 3300026849 | Tropical Forest Soil | MRAVFPAKRKGCDFGYALADNSCERVPSVDACTVAALDVITAFT |
Ga0207787_10300381 | 3300026908 | Tropical Forest Soil | GYALADNSCERVPSVDACTVAALDVITAFTVPDLG |
Ga0207840_10228802 | 3300026910 | Tropical Forest Soil | VFQTKKKGCDFGYALADNSCERVPGVDACTVAALDVITAFTVPDLG |
Ga0207779_10143741 | 3300026928 | Tropical Forest Soil | CDFGYALADNSCERVPGVDACTVAALDVITTFAVPDLG |
Ga0207824_10169181 | 3300026990 | Tropical Forest Soil | IRAVFPAKRKGCDFGYALADNSCERVPSVDACTVAALDVITAFTVPDLG |
Ga0208986_10356911 | 3300027031 | Forest Soil | MEVFSEKRYKNSKGCDIGYALAANSCEGANNVDACTVTALDATTAFAVPDPGLLLA |
Ga0207777_10054124 | 3300027330 | Tropical Forest Soil | KKGCDFGYALADNSCERVPGVDACTVAALDVITTFAVPDLG |
Ga0207777_10606252 | 3300027330 | Tropical Forest Soil | KKGCDFGYALADNSCERVPGVDACTVAALDVITAFTVPDLG |
Ga0209772_102526011 | 3300027768 | Bog Forest Soil | SFTGSLRGNIKGRDIGYALAASSCEGANNVESCTITAFDVITAFAVPNPGHILAD |
Ga0209656_101956411 | 3300027812 | Bog Forest Soil | LSAKVKGCDFGYALADNSCEGVPGVDACTVTAFDAVTAFAVPNPN |
Ga0209060_101404562 | 3300027826 | Surface Soil | MLGGLAEGRNGKGRDIGYALAANSCEGVYSVESCTITALDVISAFAVPDPGYILAE |
Ga0209167_103757942 | 3300027867 | Surface Soil | DFGYALAAGSCERALSVEACTVTALDAITAFAVPNPG |
Ga0209380_107990062 | 3300027889 | Soil | KGCDIGYALAVNSCEGANDVESCTITAFDVITAFAVPNPGHILAE |
Ga0209067_109776821 | 3300027898 | Watersheds | KKKGRDFGYALASNSCEEVPGVDACTVTALQAVTAFAVPNPN |
Ga0302289_11581081 | 3300028857 | Fen | HVKGRCPGMGNRKGCDFGYALAGNSCEGAPGVDACTVTALDAVTAFAVPNPG |
Ga0302163_101428042 | 3300028868 | Fen | MGNRKGCDFGYALAGNSCEGAPGVDACTVTALDAVTAFAVPN |
Ga0247275_10239445 | 3300029817 | Soil | CDIGYALTADSCEGVNSVEACTVTAPDAITAFAVPNPN |
Ga0311332_101730173 | 3300029984 | Fen | KGCDFGYALAGNSCEGAPGVDACTVTALDAVTAFAVPNPG |
Ga0265776_1030351 | 3300030880 | Soil | DFGYALADNSCEGALGVDACTVTALDAATAFADPNPG |
Ga0265772_1051881 | 3300030886 | Soil | LATSSCEGANSVEACTVTALDAITAFAVPNPNYRTGN |
Ga0265769_1053121 | 3300030888 | Soil | LAASSCEEATDVDACTVTALDAITAFAVPNPNWSSQT |
Ga0265748_1060521 | 3300030982 | Soil | DFGYALAANSCEGVASVDACTVTAFDAITAFAVPNPG |
Ga0265744_1070661 | 3300031017 | Soil | DFGYALAANSCEGVTSVDACTVTALDAITAFAVPNPG |
Ga0265779_1055021 | 3300031043 | Soil | FGYALAAASCEGATGVDACTVTALGAITAFAVPDPG |
Ga0170824_1036048731 | 3300031231 | Forest Soil | AASSCEGANNVDACTVTALDAITVFTVPNPNCSSQS |
Ga0318516_101270561 | 3300031543 | Soil | IGQWAKGKGCDFGYATASNSRERATSVDACTVTALDVITAFAVPDPG |
Ga0318561_104053181 | 3300031679 | Soil | EEPRKKRKGCDLGYALARYSCERVAGVDACTVTALDVITAFAVPDPG |
Ga0302321_1020581401 | 3300031726 | Fen | AVHVKGRCPGMGNRKGCDFGYALAGNSCEGAPGVDACTVTALDAVTAFAVPNPG |
Ga0318521_101066063 | 3300031770 | Soil | EANCSGERGEDNREEPRKKRKGCDLGYALARYSCERVAGVDACTVTALDVITAFAVPDPG |
Ga0310917_106289401 | 3300031833 | Soil | FGYALAGNSCEEVTSVDACTVTAPDVITAFTVPGPG |
Ga0306919_110332011 | 3300031879 | Soil | CDFGYALAGNSCEEVTSVDACTVTAPDVITAFTVPGPG |
Ga0318544_102995511 | 3300031880 | Soil | KGCDFGYALASSSCEGAPSVDACTVTALDVITAFAVPDPG |
Ga0306923_109298201 | 3300031910 | Soil | RKGCDFGYALACYSCERVAGVDACTVTALDVITAFAIPDPG |
Ga0310910_102103651 | 3300031946 | Soil | CDFGYALACYSCERVAGVEACTVTALDVITAFAIPDPG |
Ga0326631_1099272 | 3300032072 | Soil | CDFGYALATNSCEGATGVDACTVTALQAITAFAVPNPG |
Ga0318525_103991461 | 3300032089 | Soil | NREEPRKKRKGCDLGYALARYSCERVAGVDACTVTALDVITAFAVPDPG |
Ga0307471_1025176642 | 3300032180 | Hardwood Forest Soil | RRAGLWGNRKGRDIGYALAVNSCEGASDVESCTITAFDVITAFAVPNPGHILAE |
Ga0306920_1015642931 | 3300032261 | Soil | VLENRKGCDFGYALACYSCERVAGVDACTVTALDVITAFA |
Ga0348332_140097301 | 3300032515 | Plant Litter | YALAASSCEEATDVDACTVTALDAITAFAVPNPNWSSQT |
Ga0348332_143888401 | 3300032515 | Plant Litter | LAASSCEGAFSVDACTVTALDAITAFAVPNPNCPSQF |
Ga0335080_102625824 | 3300032828 | Soil | LTEEVCREKLKGCDIGYGLAASSCEGVDNVDACTVTAPDAIAAFA |
Ga0335081_125592401 | 3300032892 | Soil | AANSCEGADSVESCTITALDVITAFAASNPSYILAE |
Ga0335072_115083451 | 3300032898 | Soil | RENGKGCDFGYALAANSCEGVTGVDACTVTALDAITTFAVPDPG |
Ga0335073_111016551 | 3300033134 | Soil | LKRRENGKGCDFGYALAANSCEGVTGVDACTVTAHDAITAFAVPDPG |
Ga0335077_105749932 | 3300033158 | Soil | GYAPAGNSRERVPRVDACTVTALDVITAFAVPNPG |
Ga0373959_0230106_369_500 | 3300034820 | Rhizosphere Soil | KKLKGCDIGYALAARSCEGADCVDACTVTALDVITAFAVPNPG |
⦗Top⦘ |