| Basic Information | |
|---|---|
| Family ID | F046404 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 151 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MNEKMSKRRIQITDLQKQEIEEKEERRLLIRLHIFYLILLINL |
| Number of Associated Samples | 135 |
| Number of Associated Scaffolds | 151 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Eukaryota |
| % of genes with valid RBS motifs | 50.34 % |
| % of genes near scaffold ends (potentially truncated) | 50.99 % |
| % of genes from short scaffolds (< 2000 bps) | 91.39 % |
| Associated GOLD sequencing projects | 128 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Eukaryota (93.377 % of family members) |
| NCBI Taxonomy ID | 2759 |
| Taxonomy | All Organisms → cellular organisms → Eukaryota |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (21.192 % of family members) |
| Environment Ontology (ENVO) | Unclassified (44.371 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (75.497 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 56.34% β-sheet: 0.00% Coil/Unstructured: 43.66% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 151 Family Scaffolds |
|---|---|---|
| PF00510 | COX3 | 4.64 |
| PF00115 | COX1 | 4.64 |
| PF00033 | Cytochrome_B | 3.97 |
| PF00032 | Cytochrom_B_C | 2.65 |
| PF13631 | Cytochrom_B_N_2 | 0.66 |
| COG ID | Name | Functional Category | % Frequency in 151 Family Scaffolds |
|---|---|---|---|
| COG1290 | Cytochrome b subunit of the bc complex | Energy production and conversion [C] | 6.62 |
| COG1845 | Heme/copper-type cytochrome/quinol oxidase, subunit 3 | Energy production and conversion [C] | 4.64 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.04 % |
| Unclassified | root | N/A | 5.96 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000115|DelMOSum2011_c10104439 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 920 | Open in IMG/M |
| 3300000203|TB18AUG2009E_c035789 | Not Available | 513 | Open in IMG/M |
| 3300000371|P_1C_Liq_3_UnCtyDRAFT_1018951 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 517 | Open in IMG/M |
| 3300001353|JGI20159J14440_10195448 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 559 | Open in IMG/M |
| 3300001820|ACM5_105940 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 905 | Open in IMG/M |
| 3300002370|B570J29631_107080 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 583 | Open in IMG/M |
| 3300003311|LKpool_1006110 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 2401 | Open in IMG/M |
| 3300003539|FS891DNA_10274534 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 617 | Open in IMG/M |
| 3300003540|FS896DNA_10401696 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 557 | Open in IMG/M |
| 3300003754|Ga0005853_1025693 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 720 | Open in IMG/M |
| 3300004786|Ga0007753_1496805 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 511 | Open in IMG/M |
| 3300004794|Ga0007751_10170287 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1439 | Open in IMG/M |
| 3300006103|Ga0007813_1109338 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 527 | Open in IMG/M |
| 3300006357|Ga0075502_1173921 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 665 | Open in IMG/M |
| 3300006384|Ga0075516_1040886 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 806 | Open in IMG/M |
| 3300006393|Ga0075517_1045058 | All Organisms → cellular organisms → Eukaryota → Sar | 1721 | Open in IMG/M |
| 3300006396|Ga0075493_1065139 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 701 | Open in IMG/M |
| 3300006405|Ga0075510_11105966 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 567 | Open in IMG/M |
| 3300006803|Ga0075467_10337791 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 794 | Open in IMG/M |
| 3300007304|Ga0102689_1118533 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1325 | Open in IMG/M |
| 3300007513|Ga0105019_1152138 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1201 | Open in IMG/M |
| 3300007519|Ga0105055_10115355 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 2779 | Open in IMG/M |
| 3300007555|Ga0102817_1061568 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 819 | Open in IMG/M |
| 3300007692|Ga0102823_1168980 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 582 | Open in IMG/M |
| 3300007958|Ga0105743_1038512 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 544 | Open in IMG/M |
| 3300007972|Ga0105745_1211762 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 613 | Open in IMG/M |
| 3300009023|Ga0103928_10372816 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 550 | Open in IMG/M |
| 3300009028|Ga0103708_100039810 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 990 | Open in IMG/M |
| 3300009071|Ga0115566_10606615 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Peridiniales → Kryptoperidiniaceae → Kryptoperidinium → Kryptoperidinium foliaceum | 612 | Open in IMG/M |
| 3300009149|Ga0114918_10251392 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1005 | Open in IMG/M |
| 3300009165|Ga0105102_10923831 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 505 | Open in IMG/M |
| 3300009221|Ga0103849_1058367 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 551 | Open in IMG/M |
| 3300009279|Ga0103880_10005459 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1042 | Open in IMG/M |
| 3300009425|Ga0114997_10158784 | All Organisms → Viruses → Predicted Viral | 1330 | Open in IMG/M |
| 3300009432|Ga0115005_10515304 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 954 | Open in IMG/M |
| 3300009432|Ga0115005_10940453 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 698 | Open in IMG/M |
| 3300009432|Ga0115005_11558286 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 542 | Open in IMG/M |
| 3300009436|Ga0115008_10152534 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1680 | Open in IMG/M |
| 3300009436|Ga0115008_10424613 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 945 | Open in IMG/M |
| 3300009441|Ga0115007_11352028 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 500 | Open in IMG/M |
| 3300009512|Ga0115003_10217862 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1143 | Open in IMG/M |
| 3300009529|Ga0114919_10497250 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 841 | Open in IMG/M |
| 3300009544|Ga0115006_11049202 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 724 | Open in IMG/M |
| 3300009550|Ga0115013_10718791 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 680 | Open in IMG/M |
| 3300009550|Ga0115013_10728823 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 676 | Open in IMG/M |
| 3300009550|Ga0115013_10958717 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 605 | Open in IMG/M |
| 3300009563|Ga0130030_1031838 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 811 | Open in IMG/M |
| 3300009593|Ga0115011_11710498 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 564 | Open in IMG/M |
| 3300009606|Ga0115102_10233726 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 529 | Open in IMG/M |
| 3300009606|Ga0115102_10991078 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1677 | Open in IMG/M |
| 3300009608|Ga0115100_10102343 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 3940 | Open in IMG/M |
| 3300009608|Ga0115100_10578028 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 674 | Open in IMG/M |
| 3300009705|Ga0115000_10522154 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 745 | Open in IMG/M |
| 3300009747|Ga0123363_1041509 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 599 | Open in IMG/M |
| 3300009756|Ga0123366_1123080 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 561 | Open in IMG/M |
| 3300009790|Ga0115012_11182859 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 642 | Open in IMG/M |
| 3300009908|Ga0132233_104289 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 501 | Open in IMG/M |
| 3300010031|Ga0126337_10539337 | Not Available | 595 | Open in IMG/M |
| 3300010160|Ga0114967_10158821 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1249 | Open in IMG/M |
| 3300010306|Ga0129322_1103472 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 511 | Open in IMG/M |
| 3300010316|Ga0136655_1102550 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 864 | Open in IMG/M |
| 3300010394|Ga0126341_1002313 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 2563 | Open in IMG/M |
| 3300012524|Ga0129331_1422098 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 700 | Open in IMG/M |
| 3300012732|Ga0157549_1237053 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 672 | Open in IMG/M |
| 3300012920|Ga0160423_11145987 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 519 | Open in IMG/M |
| 3300012953|Ga0163179_10695570 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Peridiniales → Kryptoperidiniaceae → Kryptoperidinium → Kryptoperidinium foliaceum | 862 | Open in IMG/M |
| 3300012954|Ga0163111_10237310 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1593 | Open in IMG/M |
| 3300013948|Ga0116699_1000001 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 20094 | Open in IMG/M |
| 3300017311|Ga0186119_1031374 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 744 | Open in IMG/M |
| 3300017481|Ga0186654_1041303 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 608 | Open in IMG/M |
| 3300017949|Ga0181584_10255174 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1135 | Open in IMG/M |
| 3300017990|Ga0180436_10166117 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1598 | Open in IMG/M |
| 3300018526|Ga0193100_100954 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 925 | Open in IMG/M |
| 3300018599|Ga0188834_1012731 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 871 | Open in IMG/M |
| 3300018711|Ga0193069_1038166 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 576 | Open in IMG/M |
| 3300018723|Ga0193038_1033457 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 787 | Open in IMG/M |
| 3300018791|Ga0192950_1027169 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 792 | Open in IMG/M |
| 3300018844|Ga0193312_1011236 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 987 | Open in IMG/M |
| 3300018844|Ga0193312_1028356 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 748 | Open in IMG/M |
| 3300018951|Ga0193128_10135565 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 595 | Open in IMG/M |
| 3300018969|Ga0193143_10168385 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 642 | Open in IMG/M |
| 3300019000|Ga0192953_10121490 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 643 | Open in IMG/M |
| 3300019007|Ga0193196_10306701 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 681 | Open in IMG/M |
| 3300019011|Ga0192926_10498824 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 501 | Open in IMG/M |
| 3300019012|Ga0193043_10212934 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 760 | Open in IMG/M |
| 3300019022|Ga0192951_10265934 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 643 | Open in IMG/M |
| 3300019037|Ga0192886_10183421 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 665 | Open in IMG/M |
| 3300019045|Ga0193336_10187944 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 815 | Open in IMG/M |
| 3300019048|Ga0192981_10268235 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 647 | Open in IMG/M |
| 3300019049|Ga0193082_10694201 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 574 | Open in IMG/M |
| 3300019049|Ga0193082_10818654 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 524 | Open in IMG/M |
| 3300019055|Ga0193208_10150453 | Not Available | 1118 | Open in IMG/M |
| 3300019100|Ga0193045_1059387 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 603 | Open in IMG/M |
| 3300019150|Ga0194244_10022745 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 855 | Open in IMG/M |
| 3300019738|Ga0193994_1017363 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 870 | Open in IMG/M |
| 3300020165|Ga0206125_10173573 | All Organisms → cellular organisms → Eukaryota → Sar | 853 | Open in IMG/M |
| 3300020175|Ga0206124_10380325 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 527 | Open in IMG/M |
| 3300020503|Ga0208363_1040663 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 513 | Open in IMG/M |
| 3300021089|Ga0206679_10564058 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 586 | Open in IMG/M |
| 3300021169|Ga0206687_1563613 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 511 | Open in IMG/M |
| 3300021305|Ga0210296_1080418 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 575 | Open in IMG/M |
| 3300021359|Ga0206689_10551328 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales | 879 | Open in IMG/M |
| 3300021379|Ga0213864_10517034 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 597 | Open in IMG/M |
| 3300021962|Ga0222713_10055196 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 3011 | Open in IMG/M |
| 3300022827|Ga0222647_1007773 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1811 | Open in IMG/M |
| 3300023184|Ga0214919_10308600 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1085 | Open in IMG/M |
| 3300023549|Ga0232116_103259 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 500 | Open in IMG/M |
| 3300024228|Ga0228633_1152234 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 512 | Open in IMG/M |
| (restricted) 3300024264|Ga0233444_10113933 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1382 | Open in IMG/M |
| 3300024296|Ga0228629_1079209 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 881 | Open in IMG/M |
| 3300024320|Ga0233398_1058342 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 980 | Open in IMG/M |
| 3300024326|Ga0228652_1044313 | All Organisms → cellular organisms → Eukaryota → Sar | 1176 | Open in IMG/M |
| 3300024334|Ga0228671_1122692 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 609 | Open in IMG/M |
| 3300024343|Ga0244777_10592508 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 672 | Open in IMG/M |
| 3300024420|Ga0228632_1172408 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 500 | Open in IMG/M |
| 3300025375|Ga0208259_1058496 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 517 | Open in IMG/M |
| 3300025378|Ga0207960_1000305 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 10841 | Open in IMG/M |
| 3300025701|Ga0209771_1154841 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 702 | Open in IMG/M |
| 3300025810|Ga0208543_1030809 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1349 | Open in IMG/M |
| 3300025887|Ga0208544_10133595 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1082 | Open in IMG/M |
| 3300026186|Ga0208128_1138087 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 520 | Open in IMG/M |
| 3300026202|Ga0207984_1024740 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1763 | Open in IMG/M |
| 3300026453|Ga0228644_1035913 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 973 | Open in IMG/M |
| 3300026453|Ga0228644_1097057 | Not Available | 509 | Open in IMG/M |
| 3300026471|Ga0247602_1131960 | Not Available | 604 | Open in IMG/M |
| 3300026500|Ga0247592_1124109 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 618 | Open in IMG/M |
| 3300027752|Ga0209192_10056130 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium sp. clades → Symbiodinium sp. clade D → Durusdinium sp. D1 → Durusdinium sp. D1a | 1749 | Open in IMG/M |
| 3300027788|Ga0209711_10344157 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Peridiniales → Kryptoperidiniaceae → Durinskia → Durinskia baltica | 630 | Open in IMG/M |
| 3300027788|Ga0209711_10348958 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 623 | Open in IMG/M |
| 3300027833|Ga0209092_10215779 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Peridiniales → Kryptoperidiniaceae → Kryptoperidinium → Kryptoperidinium foliaceum | 1073 | Open in IMG/M |
| 3300027833|Ga0209092_10246036 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 987 | Open in IMG/M |
| 3300027833|Ga0209092_10538832 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 592 | Open in IMG/M |
| 3300027849|Ga0209712_10811256 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 510 | Open in IMG/M |
| 3300027883|Ga0209713_10037787 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 3278 | Open in IMG/M |
| 3300027883|Ga0209713_10342319 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 992 | Open in IMG/M |
| 3300028106|Ga0247596_1149148 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 534 | Open in IMG/M |
| 3300028109|Ga0247582_1048841 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1102 | Open in IMG/M |
| 3300028134|Ga0256411_1127827 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 850 | Open in IMG/M |
| 3300028396|Ga0228643_1134158 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 564 | Open in IMG/M |
| 3300030547|Ga0247656_1008601 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 1034 | Open in IMG/M |
| 3300030670|Ga0307401_10129182 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Peridiniales → Kryptoperidiniaceae → Kryptoperidinium → Kryptoperidinium foliaceum | 1113 | Open in IMG/M |
| 3300030752|Ga0073953_11438422 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 652 | Open in IMG/M |
| 3300030868|Ga0073940_1000463 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 596 | Open in IMG/M |
| 3300031569|Ga0307489_10355698 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 963 | Open in IMG/M |
| 3300031688|Ga0308011_10125417 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 782 | Open in IMG/M |
| 3300031689|Ga0308017_1006548 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 2859 | Open in IMG/M |
| 3300034107|Ga0335037_0482277 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 664 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 21.19% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 17.22% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 10.60% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 7.28% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 2.65% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.65% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.99% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.99% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.99% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 1.99% |
| Meromictic Pond | Environmental → Aquatic → Freshwater → Pond → Unclassified → Meromictic Pond | 1.32% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 1.32% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 1.32% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.32% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.32% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.32% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.32% |
| Diffuse Hydrothermal Flow Volcanic Vent | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Flow Volcanic Vent | 1.32% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 1.32% |
| Coral | Host-Associated → Invertebrates → Cnidaria → Coral → Unclassified → Coral | 1.32% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.66% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.66% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 0.66% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.66% |
| River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 0.66% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.66% |
| Marine Plankton | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton | 0.66% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.66% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.66% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.66% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.66% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.66% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.66% |
| Enviromental | Environmental → Aquatic → Marine → Unclassified → Unclassified → Enviromental | 0.66% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.66% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 0.66% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.66% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.66% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.66% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.66% |
| Cnidaria | Host-Associated → Invertebrates → Cnidaria → Unclassified → Unclassified → Cnidaria | 0.66% |
| Coral Tissue | Host-Associated → Invertebrates → Cnidaria → Coral → Unclassified → Coral Tissue | 0.66% |
| Coastal Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Coastal Water | 0.66% |
| Surface Ocean Water | Environmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water | 0.66% |
| Ocean Water | Environmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water | 0.66% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000203 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 epilimnion | Environmental | Open in IMG/M |
| 3300000371 | Marine microbial community from Union City, CA, USA - Pond 1C Liquid 3 | Environmental | Open in IMG/M |
| 3300001353 | Pelagic Microbial community sample from North Sea - COGITO 998_met_09 | Environmental | Open in IMG/M |
| 3300001820 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM5, ROCA_DNA135_2.0um_27f | Environmental | Open in IMG/M |
| 3300002370 | Freshwater microbial communities from Lake Mendota, WI - 03MAY2011 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300003311 | Looe Key pool | Host-Associated | Open in IMG/M |
| 3300003539 | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS891_Anemone_DNA | Environmental | Open in IMG/M |
| 3300003540 | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS896_ElGuapo_DNA | Environmental | Open in IMG/M |
| 3300003754 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004786 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004794 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006103 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29Jun09 | Environmental | Open in IMG/M |
| 3300006357 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006384 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006393 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006396 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006405 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007304 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300007513 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate b | Environmental | Open in IMG/M |
| 3300007519 | Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-03 | Environmental | Open in IMG/M |
| 3300007555 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 | Environmental | Open in IMG/M |
| 3300007692 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.743 | Environmental | Open in IMG/M |
| 3300007958 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459BC_3.0um | Environmental | Open in IMG/M |
| 3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
| 3300009023 | Planktonic microbial communities from coastal waters of California, USA - Canon-29 | Environmental | Open in IMG/M |
| 3300009028 | Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S3 | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009221 | Microbial communities of water from Amazon river, Brazil - RCM2 | Environmental | Open in IMG/M |
| 3300009279 | Eukaryotic communities of water from the North Atlantic ocean - ACM42 | Environmental | Open in IMG/M |
| 3300009425 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 | Environmental | Open in IMG/M |
| 3300009432 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome | Environmental | Open in IMG/M |
| 3300009436 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome | Environmental | Open in IMG/M |
| 3300009441 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome | Environmental | Open in IMG/M |
| 3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
| 3300009529 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG | Environmental | Open in IMG/M |
| 3300009544 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M Metagenome | Environmental | Open in IMG/M |
| 3300009550 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome | Environmental | Open in IMG/M |
| 3300009563 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 5, Depth 6m; RNA IDBA-UD | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300009606 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009608 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009705 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 | Environmental | Open in IMG/M |
| 3300009747 | Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_197_2m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009756 | Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_202_18m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300009908 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 6, Depth 6m; RNA IDBA-UD | Environmental | Open in IMG/M |
| 3300010031 | Coral microbial communities from La Bocana,Puerto Morelos, Mexico - Diploria C A metagenome | Host-Associated | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010306 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010316 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010394 | Coral microbial communities from Florida Keys, Florida, USA - Orbicella T D metagenome | Host-Associated | Open in IMG/M |
| 3300012524 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012732 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES039 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
| 3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
| 3300013948 | Coral microbial communities from a home aquarium in Belgium - AM-T0-control A | Host-Associated | Open in IMG/M |
| 3300017311 | Metatranscriptome of marine eukaryotic communities from unknown location in HESNW medium w/o silica, at 18 C, 30 psu salinity and 654 ?mol photons light - Protoceratium reticulatum CCCM 535 (MMETSP0228) | Host-Associated | Open in IMG/M |
| 3300017481 | Metatranscriptome of coastal eukaryotic communities from South Pacific Ocean in L1 medium, 22 C, 20 psu salinity and 674 ?mol photons light - Karlodinium veneficum CCMP 2283 (MMETSP1017) | Host-Associated | Open in IMG/M |
| 3300017949 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017990 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_S_2 metaG | Environmental | Open in IMG/M |
| 3300018526 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_051 - TARA_N000000185 (ERX1782407-ERR1711866) | Environmental | Open in IMG/M |
| 3300018599 | Metatranscriptome of marine microbial communities from Baltic Sea - GS675_3p0_dT | Environmental | Open in IMG/M |
| 3300018711 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_143 - TARA_N000003139 (ERX1782287-ERR1712099) | Environmental | Open in IMG/M |
| 3300018723 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_046 - TARA_N000000268 (ERX1782137-ERR1712170) | Environmental | Open in IMG/M |
| 3300018791 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782108-ERR1712085) | Environmental | Open in IMG/M |
| 3300018844 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001656 (ERX1782100-ERR1711982) | Environmental | Open in IMG/M |
| 3300018951 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001338 (ERX1782096-ERR1711860) | Environmental | Open in IMG/M |
| 3300018969 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000539 (ERX1782234-ERR1712179) | Environmental | Open in IMG/M |
| 3300019000 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001394 (ERX1782320-ERR1712129) | Environmental | Open in IMG/M |
| 3300019007 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000011 (ERX1782393-ERR1712012) | Environmental | Open in IMG/M |
| 3300019011 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000871 (ERX1782184-ERR1712079) | Environmental | Open in IMG/M |
| 3300019012 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001426 (ERX1809764-ERR1740129) | Environmental | Open in IMG/M |
| 3300019022 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194) | Environmental | Open in IMG/M |
| 3300019037 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000703 (ERX1782146-ERR1712183) | Environmental | Open in IMG/M |
| 3300019045 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782348-ERR1712224) | Environmental | Open in IMG/M |
| 3300019048 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166) | Environmental | Open in IMG/M |
| 3300019049 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000531 (ERX1782179-ERR1712232) | Environmental | Open in IMG/M |
| 3300019055 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000073 (ERX1782414-ERR1711963) | Environmental | Open in IMG/M |
| 3300019100 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809468-ERR1739839) | Environmental | Open in IMG/M |
| 3300019150 | Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000616 (ERX1782105-ERR1711908) | Environmental | Open in IMG/M |
| 3300019738 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_0-1_MG | Environmental | Open in IMG/M |
| 3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
| 3300020175 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2 | Environmental | Open in IMG/M |
| 3300020503 | Freshwater microbial communities from Lake Mendota, WI - 03MAY2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021089 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 | Environmental | Open in IMG/M |
| 3300021169 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021305 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R868 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021359 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021379 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO247 | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300022827 | Saline water microbial communities from Ace Lake, Antarctica - #333 | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300023549 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 63R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024228 | Seawater microbial communities from Monterey Bay, California, United States - 41D | Environmental | Open in IMG/M |
| 3300024264 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MG | Environmental | Open in IMG/M |
| 3300024296 | Seawater microbial communities from Monterey Bay, California, United States - 36D | Environmental | Open in IMG/M |
| 3300024320 | Seawater microbial communities from Monterey Bay, California, United States - 38D | Environmental | Open in IMG/M |
| 3300024326 | Seawater microbial communities from Monterey Bay, California, United States - 64D | Environmental | Open in IMG/M |
| 3300024334 | Seawater microbial communities from Monterey Bay, California, United States - 89D | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300024420 | Seawater microbial communities from Monterey Bay, California, United States - 40D | Environmental | Open in IMG/M |
| 3300025375 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH22May08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025378 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH29May08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025570 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025701 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025887 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300026186 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF51B (SPAdes) | Environmental | Open in IMG/M |
| 3300026202 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF43B (SPAdes) | Environmental | Open in IMG/M |
| 3300026453 | Seawater microbial communities from Monterey Bay, California, United States - 56D | Environmental | Open in IMG/M |
| 3300026471 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 77R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026500 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 54R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027752 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300027788 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 (SPAdes) | Environmental | Open in IMG/M |
| 3300027833 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027849 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027883 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300028106 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 66R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028109 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 41R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028134 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_12 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028396 | Seawater microbial communities from Monterey Bay, California, United States - 55D | Environmental | Open in IMG/M |
| 3300030547 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db9 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030670 | Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-23 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030752 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E5_S_5 metaT (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030868 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E4_R_0.2 metaT (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031569 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2 | Environmental | Open in IMG/M |
| 3300031688 | Marine microbial communities from water near the shore, Antarctic Ocean - #177 | Environmental | Open in IMG/M |
| 3300031689 | Marine microbial communities from water near the shore, Antarctic Ocean - #280 | Environmental | Open in IMG/M |
| 3300034107 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Apr2017-rr0133 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2011_101044393 | 3300000115 | Marine | MNEKMSKRRIQITDLQKQEIEEKQEIRLLIRLHIFYLILLINL* |
| TB18AUG2009E_0357892 | 3300000203 | Freshwater | MNEKMSKRRIQIIDFQKQEIEEKEETTLLIRLHIFYKILTINLCFKK* |
| P_1C_Liq_3_UnCtyDRAFT_10189512 | 3300000371 | Enviromental | MNEKMSKRRIEITDLQKQEIEEKLERRLLIRLHIFDLILLINL* |
| JGI20159J14440_101954482 | 3300001353 | Pelagic Marine | MNEKMSKRRIQIIDLQKQEIEEKQEIRLLIRLHIFYLILLINL* |
| ACM5_1059403 | 3300001820 | Marine Plankton | MNEKMSKRRIQIRDLQKQEIEEKQETRLLIRLHIFYKILLINL* |
| B570J29631_1070801 | 3300002370 | Freshwater | TKSLKLEQIMNEKMSKRRIQIIVLQKQEIEEKEERRLLITHHIFYEILLINL* |
| LKpool_10061103 | 3300003311 | Cnidaria | LEKIINEKMSKRRIQIIELQKLENPQKEEKRLLIRLHIF* |
| FS891DNA_102745341 | 3300003539 | Diffuse Hydrothermal Flow Volcanic Vent | MNEKMSKRRIEITDLQKQEIEEKQEIRLLIRLHIFYLILLINL* |
| FS896DNA_104016962 | 3300003540 | Diffuse Hydrothermal Flow Volcanic Vent | MNEKMSKRRIQITDLQKQEIEEKQEIRLLIRLHIFYLILLRNL*TKNEN* |
| Ga0005853_10256932 | 3300003754 | Freshwater And Sediment | MNEKMSKRRIQIIVLQKQEIEEKEERRLLITHHIFYEILLINL* |
| Ga0007753_14968051 | 3300004786 | Freshwater Lake | MNEKMSKRRIQIIDLQKQEIEEKEETTLLIRLHIFYKILLINLCTKN* |
| Ga0007751_101702871 | 3300004794 | Freshwater Lake | MNEKMSKRRIQIKELQKLKMYEKEERRLLIRLHIFYLILLINLYTKNEN* |
| Ga0007813_11093381 | 3300006103 | Freshwater | SKRRIQIRDLQKQEIEEKQERRLLIRLHIFYLILLINL* |
| Ga0075502_11739211 | 3300006357 | Aqueous | MEKIMNEKMSKRRIQIRDLQKQEIEEKQERRLLIRLQISSVILLINL* |
| Ga0075516_10408862 | 3300006384 | Aqueous | MEKMMNEKMPKRRIQIRELQKQEIEEKQERGLLIRLQISSVILLINL* |
| Ga0075517_10450583 | 3300006393 | Aqueous | MEKMMNEKMPKRRIQIRELQKQEIEEKQERGLLIRFQISSVILLINL* |
| Ga0075493_10651391 | 3300006396 | Aqueous | MNEKMSKRRIQIRELQKQEIEEKEERRLLIMFIWILA |
| Ga0075510_111059662 | 3300006405 | Aqueous | MEKMMNEKMSKRRIQIRELQKQEIEEKQERGLLIRLQISSVILLINL* |
| Ga0075467_103377913 | 3300006803 | Aqueous | MNEKMSKRRIQIIDLQKQEIEEKEERTLLIRLHIFDKILLINLCTKN* |
| Ga0102689_11185331 | 3300007304 | Freshwater Lake | EKIMNEKMSKRRIQIRDLQKQEIEEKQERRLLIRLHIF* |
| Ga0105019_11521382 | 3300007513 | Marine | MNEKMSKRRIQITDLQKQEIEEKEERRLLIRLHIFYLILLINL* |
| Ga0105055_101153551 | 3300007519 | Freshwater | MLEQIMNERMSKRRIQIIVLQKQEIEEKEERRLLITLHIFYLILLINL* |
| Ga0102817_10615682 | 3300007555 | Estuarine | MNEKMSKRRIQITDLQKQEIEEKHERRLLIRLHIFDLILLINL* |
| Ga0102823_11689801 | 3300007692 | Estuarine | KIMNEKMSKRRIQITDLQKQEIEEKQEIRLLIRLHIFYLILLINL* |
| Ga0105743_10385122 | 3300007958 | Estuary Water | MNEKISKRRIEIRDLQKQEIEEKEERRLLINIFSFICLGMA* |
| Ga0105745_12117621 | 3300007972 | Estuary Water | SLNLEKIMNEKMSKRRIQITDLQKQEIEEKQERRLLIRLHIFYQILLINL* |
| Ga0103928_103728161 | 3300009023 | Coastal Water | MSKRRIQITDLQKQEIEEKQEIRLLIRLHIFYLILLINL* |
| Ga0103708_1000398104 | 3300009028 | Ocean Water | MNEKMPKRRIQITDLQKQEKEEKQERRLIIRLHIFYQILLINL* |
| Ga0115566_106066152 | 3300009071 | Pelagic Marine | LEKIMNEKMSKRRIQITDLQKQEIEEKRERRLLIRLHIFYRILLINL* |
| Ga0114918_102513921 | 3300009149 | Deep Subsurface | RRIEIRDLQKEEIEEKRERRLLIKVHIFYKILLINL* |
| Ga0105102_109238312 | 3300009165 | Freshwater Sediment | SLKVKKIMNEKMSKRRIQIRDLQKQEIEEKQERRLLIRLHIFYLILLINL* |
| Ga0103849_10583671 | 3300009221 | River Water | MNEKMSKRRIQIIDFQKQEIEEKEETALLIRLHVFYKILTINLCFKK* |
| Ga0103880_100054593 | 3300009279 | Surface Ocean Water | MNEKMPKRRIQIRELQKQEIEKKQERGPLIRFHIFSGILLINL* |
| Ga0114997_101587841 | 3300009425 | Marine | MEKIMNEKMSKRRIQIRDLQKQEIEEKEERRLLIRLHIFYLILLINL* |
| Ga0115005_105153042 | 3300009432 | Marine | MNEKMSKRRIKITELQKQEIEEKEERRLLIRLHIFYKILLINLCTKNE* |
| Ga0115005_109404532 | 3300009432 | Marine | EKIMNEKMSKRRIQITDLQKQEIEETQERRLLIRLHIFYQILLINL* |
| Ga0115005_115582861 | 3300009432 | Marine | KSLKLEKIMNEKMSKRRIQIRDLQKQEIEEKQERRLLIRLHIFYLILLINL* |
| Ga0115008_101525341 | 3300009436 | Marine | LEKIMNEKMSKRRIQITDLQKQEIEEKRERRLLIRLHIFYKILLINL* |
| Ga0115008_104246132 | 3300009436 | Marine | MNEKISKRRIQITDLQKQEIEEKEETNKLIRLHIFYLILLINLCVKNEK* |
| Ga0115007_113520281 | 3300009441 | Marine | MNEKMSKRRIQIRELQKQEIEEKEERRLLIRLHIFYKILLINLCTKNE* |
| Ga0115003_102178622 | 3300009512 | Marine | MNEKMSKRRIQITDLQKQEIEESQGIRLLISGIERR* |
| Ga0114919_104972502 | 3300009529 | Deep Subsurface | MNEKMSKRRIEIRDLQKEEIEEKRERRLLIKVHIFYKILLINL* |
| Ga0115006_110492021 | 3300009544 | Marine | NLEKIMNEKMSKRRIQITDLHSQEIEEKQEIRLLIRLHIFYLILLINL* |
| Ga0115013_107187911 | 3300009550 | Marine | KMSKRRIQITDLQKQEIEEKEERRLLIRLHIFYLILLINL* |
| Ga0115013_107288231 | 3300009550 | Marine | KPLNLERIMNEKMSKRRIQITDLQKQEIEESQGIRLLIRFHISLVFLLINL* |
| Ga0115013_109587171 | 3300009550 | Marine | LEKIMNEKMSKRRIQITDLQKQEIEEKQEIRLLIRLHIFYLILLINL* |
| Ga0130030_10318381 | 3300009563 | Meromictic Pond | MNEKMSKRRIQIRDLQKQEIEEKQERRLLIRLHIFYLL |
| Ga0115011_117104982 | 3300009593 | Marine | MEKIMNEKMSKRRIKIRDLQKQEIEEKEERRLLIRLHIFYFILLINL* |
| Ga0115102_102337261 | 3300009606 | Marine | MNEMMSKRRIQITDLQKQEIEEKQEIRLLIRLHIFYLILLINL* |
| Ga0115102_106981231 | 3300009606 | Marine | LADKFLNLEKIMNEKMSKRRIQIRDLQKREIEEKQERRLL |
| Ga0115102_109910781 | 3300009606 | Marine | MNEKMSKKRIQIRDLQKQEIEEKQETRLLIRLHIFYKILLINL* |
| Ga0115100_101023433 | 3300009608 | Marine | KSLNLEKIMNEKMSKRRIQIIDLQKQEIEEKQEIRLLIRLHIFYLILLINL* |
| Ga0115100_105780281 | 3300009608 | Marine | LKLKKIMNEKMSKRRIQITDLQKQEIEETQERRLLIRLHIFYQILLINL* |
| Ga0115000_105221541 | 3300009705 | Marine | NLEKIMNEKMSKRRIQIIDLQKQEIEEKEETRLLITLHIFYKILLINLCTKS* |
| Ga0123363_10415093 | 3300009747 | Marine | MKKIMNEKMSKRRIQIIDLQKQEIEEKEERTLLIRLHIFDKILLINLCTKN* |
| Ga0123366_11230802 | 3300009756 | Marine | MNEMMSKRRIQITDLQKQEIEEKEERRLLIRFQNLRKQKD* |
| Ga0115012_111828592 | 3300009790 | Marine | MEKIMNEKMSKRRIKIKDLQKQEIEEKEERRLLIRLHIIYFILLINI* |
| Ga0132233_1042892 | 3300009908 | Meromictic Pond | MNEKMSKRRIQIRDLQKQEIEEKQERRLLIRLHIFYLLIAAHIK* |
| Ga0126337_105393371 | 3300010031 | Coral | EKIINEKMSKRRIQIIELQKLENPQKEEKRLLIRLHIF* |
| Ga0114967_101588211 | 3300010160 | Freshwater Lake | IQIIDLQKQEIEEKEETTLLIRLHIFYLILLINL* |
| Ga0129322_11034722 | 3300010306 | Aqueous | MNEKMSKRRIQIIDLQKQEIEKKEERTPLIRLHIFDKILLINLCTKN* |
| Ga0136655_11025502 | 3300010316 | Freshwater To Marine Saline Gradient | DLQKQEIEEKEERTLLIRLHIFDKILLINLCTKN* |
| Ga0126341_10023131 | 3300010394 | Coral | LEKIINEKMSKRRIQIIELQKLENPQKEEKRLLIRL |
| Ga0129331_14220981 | 3300012524 | Aqueous | MNEKMSKRRIQIRDLQKQEIEEKQERRPLIRLHIFYKILLINL* |
| Ga0157549_12370531 | 3300012732 | Freshwater | MNEKMSKRRLEIRDLQKQEKEEKQERRLLIRLHIFYLILLINL* |
| Ga0160423_111459871 | 3300012920 | Surface Seawater | MNEKMSKRRIQKTDLQKQEIEESQGIRLLIRFHISLVFLLINL* |
| Ga0163179_106955701 | 3300012953 | Seawater | KIMNEKMSKRRIEITDLQKQEIEEKQEIRLLIRLHIFYFILLINL* |
| Ga0163111_102373103 | 3300012954 | Surface Seawater | EKMSKRRIQITDLQKQEIEEKQEIRLLIRLHIFYLILLINL* |
| Ga0129327_100877033 | 3300013010 | Freshwater To Marine Saline Gradient | MNEKMSKRRIQIRELQKQEIEEKEERRLLIMFIWILAIFFHNL* |
| Ga0116699_10000011 | 3300013948 | Coral Tissue | LEKIINEKMSKRRIQIIELQKQENPQKEEKRLLIRLHIF* |
| Ga0186119_10313741 | 3300017311 | Host-Associated | MSKRRIQITDLQKEEIEEKEETNKLIRLHIFYQILLINL |
| Ga0186654_10413033 | 3300017481 | Host-Associated | MNEKMSKRRIQIIDLQKQEIEEKQEIRLLIRFHIF |
| Ga0181584_102551741 | 3300017949 | Salt Marsh | MEKIMNEKMSKRRIQIRDLQKQEIEEKQERRLLIRLQISSVILLINL |
| Ga0180436_101661172 | 3300017990 | Hypersaline Lake Sediment | MNEKISKRRIQITDLQKQEIEEKEETNKLIRFHIFYLILLINL |
| Ga0193100_1009541 | 3300018526 | Marine | KSLKLEKIMNEKMPKRRIQIRELQKQEIEKKQERGPLIRFHIFYLILLINL |
| Ga0188834_10127311 | 3300018599 | Freshwater Lake | IMNEKMSKRRIQITDLQKEEIEEKEETNKLIRLHIFYQILLINL |
| Ga0193069_10381661 | 3300018711 | Marine | KSLKLEKIMNEKMPKRRIQITDLQKQEIEEKEERRLLIRLHIFYLILLINL |
| Ga0193038_10334571 | 3300018723 | Marine | MNEKIPKRRIEIRELQKQEIEKKEERGALIRFHIFYLILLINLLSKNEN |
| Ga0192950_10271691 | 3300018791 | Marine | MNEKLSKRRIQIIDLQKKEIEEKQEIRLLIRLHIF |
| Ga0193312_10112362 | 3300018844 | Marine | MLEKKMNEKIPKRRIQIIELQKKEIEKKQEIRPLIRFHIFYLILLINL |
| Ga0193312_10283562 | 3300018844 | Marine | MEKIMNEKNPKRKIEIRELQKQEIEKKEERGALIRFHIFYLILLINL |
| Ga0193128_101355651 | 3300018951 | Marine | LKLEKIMNEKMPKRRIQITELQKQEIEKTKERGPLIRFHIFSQILLINL |
| Ga0193143_101683852 | 3300018969 | Marine | SKRRIQITDLQKQEIEEKRERRLLIRLHIFYKILLINL |
| Ga0192953_101214901 | 3300019000 | Marine | MNEKISKRRIQITDLQKQEIEEKEETNKLIRIYLVFGNM |
| Ga0193196_103067012 | 3300019007 | Marine | LKLEKIMNEKMPKRRIQIIELQKQEIKKKQEIGPLIRFHIFYLILLINL |
| Ga0192926_104988241 | 3300019011 | Marine | KPLKLEKIMNEKMPKRRIQITDLQKQEKEETKERRLLIRLHIFYQILLINL |
| Ga0193043_102129341 | 3300019012 | Marine | RRIQITDLQKQEIEEKEETNKLIRLHIFYLILLINL |
| Ga0192951_102659342 | 3300019022 | Marine | LEKIMNEKMPKRRIQITDLQKQEIEEKEERRLLIRLHIFSFILLINL |
| Ga0192886_101834211 | 3300019037 | Marine | LEKIMNEKMSKRRIQITDLQKQEIEETKERRPLIRLHIFYQILLINL |
| Ga0193336_101879442 | 3300019045 | Marine | MNEKMSKRRIEIRELQKQEIEEKEERRLLIRLHIFYLILLINL |
| Ga0192981_102682352 | 3300019048 | Marine | LEKIMNEKMSKRRIQITDLQKQEIEEKEERRLLIRLHIFYLILLINL |
| Ga0193082_106942011 | 3300019049 | Marine | LNLEKIMNEKMSKRRIQITDLQKQEIEEKQERRLLIRLHIFYLILLINL |
| Ga0193082_108186541 | 3300019049 | Marine | LKLEKIMNEKMPKRRIQIRELQKQEIEKKQERGPLIRFHIFSLILLINL |
| Ga0193208_101504531 | 3300019055 | Marine | MSPEMNEKMSKRRIQITDLQKQEIEEKQERRLLIRLHIFYLILLINF |
| Ga0193045_10593872 | 3300019100 | Marine | MNEKLSKRRIQIIDLQKKEIEEKQEIRLLIRLHIFYQLFYHSLLEVI |
| Ga0194244_100227451 | 3300019150 | Marine | KSLKLEKIMNEKMPKRRIQITELQKQEIEKKQEIRPLIRLHIFYLILLINL |
| Ga0193994_10173632 | 3300019738 | Sediment | MNEKMSKRRIQIIDLQKQEIEEKEERTLLIRLHIFDKILLINLCTKN |
| Ga0206125_101735731 | 3300020165 | Seawater | RRIQITDLQKQEIEEKQEIRLLIRLHIFYLILLINL |
| Ga0206124_103803251 | 3300020175 | Seawater | MSKRRIQITDLQKQEIEEKRERRLLIRLHIFYRILLIN |
| Ga0208363_10406631 | 3300020503 | Freshwater | MNEKMSKRRIQIIVLQKQEIEEKEERRLLITHHIFYEILLINL |
| Ga0206679_105640581 | 3300021089 | Seawater | KRRIQIIDLQKQEIEEKQEIRLLIRLHIFYLILLINL |
| Ga0206687_15636131 | 3300021169 | Seawater | SKRRIQITDLQKQEIEEKQEIRLLIRLHIFYIILLINL |
| Ga0210296_10804181 | 3300021305 | Estuarine | MNEKMSKRRIQITDLQKQEIEEKEETNKLIRLHIFYLILLINLCVKNEK |
| Ga0206689_105513282 | 3300021359 | Seawater | QAKSLNLEKIMNEKMSKRRIQITDLQKQEIEEKQEIRLLIRLHIFYLILLINL |
| Ga0213864_105170342 | 3300021379 | Seawater | MNEKMSKRRIQITDLQKQEIEEKQEIRLLIRLHIFYLILLINL |
| Ga0222713_100551964 | 3300021962 | Estuarine Water | MNEKISKRRIQIRELQKLELPQKVERILLIRLHIFYLILLINLYTKNEN |
| Ga0222647_10077733 | 3300022827 | Saline Water | MNEKMSKRRIQIRELQKQEIEEKEERRLLIRLHIFYKILLINLCTKNE |
| Ga0214919_103086001 | 3300023184 | Freshwater | MNEKMSKRRIQIKELQKLKMYEKEERRLLIRLHIFYLILLINLYTKNEN |
| Ga0232116_1032592 | 3300023549 | Seawater | MEKMMNEKMPKRRIQIRELQKQEIEEKQERGLLIRFQISSVILLINL |
| Ga0228633_11522342 | 3300024228 | Seawater | MNEMMSKRRIQITDLQKQEIEEKQEIRLLIRLHIF |
| (restricted) Ga0233444_101139331 | 3300024264 | Seawater | MSKRRIQITDLQKQEIEEKQEIRLLIRLHIFYLIL |
| Ga0228629_10792091 | 3300024296 | Seawater | QSKSLKLEKIMNENMSKRRIQITDLQKQEIEEKQKRRLLIRLHIFYLILLINL |
| Ga0233398_10583422 | 3300024320 | Seawater | MKGLYVQIRDLQKQEIEDKRERRLLLRLHIFYRILLIN |
| Ga0228652_10443132 | 3300024326 | Seawater | KKIMNEMMSKRRIQITDLQKQEIEEKQEIRLLIRLHIFYLILLINL |
| Ga0228671_11226921 | 3300024334 | Seawater | IMNEKMSKRRIQITDLQKQEIEEKQEMRLLIRLHIFYLILLINL |
| Ga0244777_105925082 | 3300024343 | Estuarine | MNEKMSKRRIEITDLQKQEIEEKLERRLLIRLHIFDLILLINL |
| Ga0228632_11724082 | 3300024420 | Seawater | MSKRRIQITDLQKQEIEEKQEIRLLIRLHIFYLILLINL |
| Ga0208259_10584961 | 3300025375 | Freshwater | MNEKMSKRRIQIRDLQKQEIEEKQERRLLIRLPKDFIF |
| Ga0207960_10003052 | 3300025378 | Freshwater | MNEKMSKRRIQIRDLQKQEIEEKQERILLIRLHIFYLILLINL |
| Ga0208660_10618242 | 3300025570 | Aqueous | MNEKMSKRRIQIRELQKQEIEEKEERRLLIRLHIFYKILLINLCTKNERRDEER |
| Ga0209771_11548411 | 3300025701 | Marine | MNEKMSKRRIQIIDLQKQEIEEKEERTLLIRLHIFDKILLINLSF |
| Ga0208543_10308095 | 3300025810 | Aqueous | WKQIIDLQKQEIEEKQEIRLLIRLHIFYLILLINL |
| Ga0208544_101335951 | 3300025887 | Aqueous | MNEKMSKRRIQIIDLQKQEIEEKEERTLLIRLHIFDKILLINLCTKNSR |
| Ga0208128_11380871 | 3300026186 | Marine | KIMNEKMSKRRIQITDLQKQEIKEKQEIRLLIRLHIFYLILLINL |
| Ga0207984_10247404 | 3300026202 | Marine | MNEKMSKRRIEITDLQKQEIEEKQEIRLLIRLHIFYLILLINL |
| Ga0228644_10359131 | 3300026453 | Seawater | MNEKMSKRRIQITDLQKQEIEEKQEMRLLIRLHIFYLILLINL |
| Ga0228644_10970572 | 3300026453 | Seawater | MNEKISKRRIQITDLQKQEIEEKQEIRLLIRLHIFYNLLLINLSNKDEN |
| Ga0247602_11319602 | 3300026471 | Seawater | MNEKISKRRIQITDLQKQEIEKKQEIRPLIRLHIFYKLLLINLSNKDEN |
| Ga0247592_11241091 | 3300026500 | Seawater | MNEKIPKRRIQITELQKQEIEKKQEIRPLIRFHIFYKLLLINPSNKDED |
| Ga0209192_100561301 | 3300027752 | Marine | EKMSKRRIQITDLQKQEIEEKQEIRLLIRLHIFYLILLINL |
| Ga0209711_103441572 | 3300027788 | Marine | IMNEKMSKRRIQITDLQKQEIEEKQEIRLLIRLHIFYLILLI |
| Ga0209711_103489582 | 3300027788 | Marine | MNEKMSKRRIQITDLQKQEIEESQGIRLLISGIERR |
| Ga0209092_102157791 | 3300027833 | Marine | EKMSKRRIKIRDLQKQEIEEKEERRLLIRLHIFYFILLINL |
| Ga0209092_102460361 | 3300027833 | Marine | SLKLEKIMNEKMSKRRIQITDLQKQEIEGKQERRLLIRLHIFYLILLINL |
| Ga0209092_105388321 | 3300027833 | Marine | MEKIMNEKMSKRRIKIRDLQKQEIEEKEERRLLIRLHIFYFILLINL |
| Ga0209712_107386021 | 3300027849 | Marine | KSLNLEKIMNEKMSKRRIQITDLQKQEIEEKRERRLLIRCFFVLLVKALVMH |
| Ga0209712_108112562 | 3300027849 | Marine | MSKRRIQIRDLQKQEIEEKQEIRLLIRLHIFYLILLINL |
| Ga0209713_100377874 | 3300027883 | Marine | IMNEMMSKRRIQITDLQKQEIEEKQEIRLLIRLHIFYLILLINL |
| Ga0209713_103423194 | 3300027883 | Marine | MSKRRIQITDLQKQEIEEKQEIRLLIRLHIFYLILLI |
| Ga0247596_11491481 | 3300028106 | Seawater | MNEKMSKRRIQIRDLQKQEIEEKQERRLLIRLQISSVI |
| Ga0247582_10488413 | 3300028109 | Seawater | MNEKISKRRIQITDLQKQEIEEKQEIRLLIRLHIFYKLLLINPSNKDEN |
| Ga0256411_11278271 | 3300028134 | Seawater | MNEKISKRRIQITDLQKQEIEEKQEIRPLIRLHIFYNLL |
| Ga0228643_11341581 | 3300028396 | Seawater | EKISKRRIQITDLQKQEIEEKQEIRLLIRLHIFYNLLLINLSNKDEN |
| Ga0247656_10086011 | 3300030547 | Soil | MIMNEKIPKRRIQIIELQKEEIEKKEERRPLIRFHIFYKILLINLCTKN |
| Ga0307401_101291821 | 3300030670 | Marine | NLKKIMNEMMSKRRIQITDLQKQEIEETKERRLLIRLHIFSQILLINL |
| Ga0073953_114384221 | 3300030752 | Marine | LEKIMNEKMSKRRIQITDLQKEEIEEKQERRLLIRLHIFYLILLINL |
| Ga0073940_10004631 | 3300030868 | Marine | MNEKMSKRRIQIIDLQKQEIEEKQEIRLLIRLHIFY |
| Ga0307489_103556982 | 3300031569 | Sackhole Brine | MEKIMNEKMSKRKIQITELQKQEIEEKEERRLLIRLHIFCKLLLINLCTKNE |
| Ga0308011_101254172 | 3300031688 | Marine | QMNEMMSKRRIQITDLQKQEIEEKQEIRLLIRLHIFYLILLINL |
| Ga0308017_10065483 | 3300031689 | Marine | MNEKMSKRRIQIRDLQKQEIEEKQEIRLLIRLHIFYLILLINL |
| Ga0335037_0482277_125_256 | 3300034107 | Freshwater | MNEKMSKRRIQTIVLQRQGIEGKEEKGLLITLHIFYLILLINL |
| ⦗Top⦘ |