Basic Information | |
---|---|
Family ID | F046034 |
Family Type | Metagenome |
Number of Sequences | 152 |
Average Sequence Length | 44 residues |
Representative Sequence | ERDPARLHEQALIPFGIEDMSMLVVSVGRDPPVPAYASVTHAA |
Number of Associated Samples | 132 |
Number of Associated Scaffolds | 152 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 0.66 % |
% of genes near scaffold ends (potentially truncated) | 98.03 % |
% of genes from short scaffolds (< 2000 bps) | 92.76 % |
Associated GOLD sequencing projects | 123 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.25 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (52.632 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (21.710 % of family members) |
Environment Ontology (ENVO) | Unclassified (31.579 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (52.632 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 16.90% β-sheet: 0.00% Coil/Unstructured: 83.10% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.25 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 152 Family Scaffolds |
---|---|---|
PF01152 | Bac_globin | 11.18 |
PF04226 | Transgly_assoc | 6.58 |
PF11752 | DUF3309 | 3.29 |
PF08448 | PAS_4 | 1.97 |
PF08734 | GYD | 1.97 |
PF13545 | HTH_Crp_2 | 1.32 |
PF00563 | EAL | 1.32 |
PF03330 | DPBB_1 | 1.32 |
PF02482 | Ribosomal_S30AE | 1.32 |
PF02653 | BPD_transp_2 | 0.66 |
PF07311 | Dodecin | 0.66 |
PF11272 | DUF3072 | 0.66 |
PF12706 | Lactamase_B_2 | 0.66 |
PF13581 | HATPase_c_2 | 0.66 |
PF07045 | DUF1330 | 0.66 |
PF13565 | HTH_32 | 0.66 |
PF00043 | GST_C | 0.66 |
PF00034 | Cytochrom_C | 0.66 |
PF06325 | PrmA | 0.66 |
PF05532 | CsbD | 0.66 |
COG ID | Name | Functional Category | % Frequency in 152 Family Scaffolds |
---|---|---|---|
COG2346 | Truncated hemoglobin YjbI | Inorganic ion transport and metabolism [P] | 11.18 |
COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 6.58 |
COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 1.97 |
COG1544 | Ribosome-associated translation inhibitor RaiA | Translation, ribosomal structure and biogenesis [J] | 1.32 |
COG2200 | EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant) | Signal transduction mechanisms [T] | 1.32 |
COG3434 | c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domains | Signal transduction mechanisms [T] | 1.32 |
COG4943 | Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domains | Signal transduction mechanisms [T] | 1.32 |
COG5001 | Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain | Signal transduction mechanisms [T] | 1.32 |
COG0435 | Glutathionyl-hydroquinone reductase | Energy production and conversion [C] | 0.66 |
COG0625 | Glutathione S-transferase | Posttranslational modification, protein turnover, chaperones [O] | 0.66 |
COG2264 | Ribosomal protein L11 methylase PrmA | Translation, ribosomal structure and biogenesis [J] | 0.66 |
COG2890 | Methylase of polypeptide chain release factors | Translation, ribosomal structure and biogenesis [J] | 0.66 |
COG3237 | Uncharacterized conserved protein YjbJ, UPF0337 family | Function unknown [S] | 0.66 |
COG3360 | Flavin-binding protein dodecin | General function prediction only [R] | 0.66 |
COG3897 | Protein N-terminal and lysine N-methylase, NNT1/EFM7 family | Posttranslational modification, protein turnover, chaperones [O] | 0.66 |
COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.66 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 52.63 % |
All Organisms | root | All Organisms | 47.37 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000044|ARSoilOldRDRAFT_c013744 | Not Available | 686 | Open in IMG/M |
3300000891|JGI10214J12806_10910509 | Not Available | 590 | Open in IMG/M |
3300000955|JGI1027J12803_100946611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. SRL28 | 1434 | Open in IMG/M |
3300001139|JGI10220J13317_10488347 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 632 | Open in IMG/M |
3300002128|JGI24036J26619_10064185 | Not Available | 725 | Open in IMG/M |
3300004156|Ga0062589_101448288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 672 | Open in IMG/M |
3300004463|Ga0063356_104675390 | Not Available | 588 | Open in IMG/M |
3300004463|Ga0063356_106220525 | Not Available | 512 | Open in IMG/M |
3300005164|Ga0066815_10022358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 894 | Open in IMG/M |
3300005169|Ga0066810_10053388 | Not Available | 796 | Open in IMG/M |
3300005289|Ga0065704_10271555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 942 | Open in IMG/M |
3300005293|Ga0065715_10150766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium sangaii | 1710 | Open in IMG/M |
3300005329|Ga0070683_101702422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 606 | Open in IMG/M |
3300005336|Ga0070680_101974655 | Not Available | 506 | Open in IMG/M |
3300005338|Ga0068868_100032953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3990 | Open in IMG/M |
3300005340|Ga0070689_101765243 | Not Available | 564 | Open in IMG/M |
3300005354|Ga0070675_101380665 | Not Available | 649 | Open in IMG/M |
3300005354|Ga0070675_101504610 | Not Available | 621 | Open in IMG/M |
3300005458|Ga0070681_11874122 | Not Available | 527 | Open in IMG/M |
3300005539|Ga0068853_100235056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1678 | Open in IMG/M |
3300005539|Ga0068853_102216474 | Not Available | 533 | Open in IMG/M |
3300005547|Ga0070693_100345662 | Not Available | 1016 | Open in IMG/M |
3300005549|Ga0070704_100009665 | All Organisms → cellular organisms → Bacteria | 5842 | Open in IMG/M |
3300005564|Ga0070664_100151646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2046 | Open in IMG/M |
3300005719|Ga0068861_100766424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → Myxococcus → unclassified Myxococcus → Myxococcus sp. RHSTA-1-4 | 903 | Open in IMG/M |
3300005841|Ga0068863_100788327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium sangaii | 947 | Open in IMG/M |
3300005841|Ga0068863_102022721 | Not Available | 586 | Open in IMG/M |
3300005842|Ga0068858_100568169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium sangaii | 1098 | Open in IMG/M |
3300006163|Ga0070715_10740171 | Not Available | 591 | Open in IMG/M |
3300006172|Ga0075018_10279925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 816 | Open in IMG/M |
3300006174|Ga0075014_100253980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 909 | Open in IMG/M |
3300006194|Ga0075427_10018256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1099 | Open in IMG/M |
3300006755|Ga0079222_11599548 | Not Available | 618 | Open in IMG/M |
3300006852|Ga0075433_10394449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1221 | Open in IMG/M |
3300006854|Ga0075425_100556719 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 1320 | Open in IMG/M |
3300006871|Ga0075434_100694481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1035 | Open in IMG/M |
3300006904|Ga0075424_101442906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 731 | Open in IMG/M |
3300007076|Ga0075435_101423692 | Not Available | 607 | Open in IMG/M |
3300009036|Ga0105244_10458978 | Not Available | 586 | Open in IMG/M |
3300009098|Ga0105245_10636941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → Myxococcus → unclassified Myxococcus → Myxococcus sp. RHSTA-1-4 | 1095 | Open in IMG/M |
3300009098|Ga0105245_11824623 | Not Available | 661 | Open in IMG/M |
3300009100|Ga0075418_12380751 | Not Available | 578 | Open in IMG/M |
3300009148|Ga0105243_13130077 | Not Available | 501 | Open in IMG/M |
3300009156|Ga0111538_11515939 | Not Available | 845 | Open in IMG/M |
3300009156|Ga0111538_12010701 | Not Available | 727 | Open in IMG/M |
3300009174|Ga0105241_11330442 | Not Available | 685 | Open in IMG/M |
3300009177|Ga0105248_11847577 | Not Available | 685 | Open in IMG/M |
3300009545|Ga0105237_10208682 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1953 | Open in IMG/M |
3300009551|Ga0105238_12536836 | Not Available | 549 | Open in IMG/M |
3300009553|Ga0105249_11764997 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 691 | Open in IMG/M |
3300010373|Ga0134128_13102572 | Not Available | 511 | Open in IMG/M |
3300010403|Ga0134123_10538862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1108 | Open in IMG/M |
3300012475|Ga0157317_1030425 | Not Available | 524 | Open in IMG/M |
3300012884|Ga0157300_1093223 | Not Available | 545 | Open in IMG/M |
3300012891|Ga0157305_10100069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 713 | Open in IMG/M |
3300012893|Ga0157284_10083537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 802 | Open in IMG/M |
3300012899|Ga0157299_10003093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2429 | Open in IMG/M |
3300012903|Ga0157289_10315483 | Not Available | 558 | Open in IMG/M |
3300012911|Ga0157301_10035028 | Not Available | 1211 | Open in IMG/M |
3300012915|Ga0157302_10184346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 737 | Open in IMG/M |
3300012916|Ga0157310_10039332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium sangaii | 1324 | Open in IMG/M |
3300012941|Ga0162652_100077192 | Not Available | 575 | Open in IMG/M |
3300012951|Ga0164300_10398734 | Not Available | 755 | Open in IMG/M |
3300012955|Ga0164298_10095614 | Not Available | 1561 | Open in IMG/M |
3300012955|Ga0164298_10281459 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium sangaii | 1020 | Open in IMG/M |
3300012957|Ga0164303_10586287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 731 | Open in IMG/M |
3300012958|Ga0164299_11427958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 536 | Open in IMG/M |
3300012985|Ga0164308_11933320 | Not Available | 550 | Open in IMG/M |
3300012988|Ga0164306_10376850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium sangaii | 1059 | Open in IMG/M |
3300012989|Ga0164305_10780200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 790 | Open in IMG/M |
3300012989|Ga0164305_11810289 | Not Available | 552 | Open in IMG/M |
3300013306|Ga0163162_10710326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium sangaii | 1126 | Open in IMG/M |
3300013307|Ga0157372_10933449 | Not Available | 1006 | Open in IMG/M |
3300014325|Ga0163163_10277463 | Not Available | 1727 | Open in IMG/M |
3300014969|Ga0157376_12001489 | Not Available | 617 | Open in IMG/M |
3300015371|Ga0132258_13202053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium sangaii | 1129 | Open in IMG/M |
3300015372|Ga0132256_100199398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2047 | Open in IMG/M |
3300015372|Ga0132256_103504496 | Not Available | 527 | Open in IMG/M |
3300015373|Ga0132257_100966716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium sangaii | 1070 | Open in IMG/M |
3300015373|Ga0132257_101669622 | Not Available | 816 | Open in IMG/M |
3300015373|Ga0132257_101741161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 800 | Open in IMG/M |
3300015373|Ga0132257_101930284 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Amaricoccus → unclassified Amaricoccus → Amaricoccus sp. HAR-UPW-R2A-40 | 760 | Open in IMG/M |
3300015374|Ga0132255_104337888 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 601 | Open in IMG/M |
3300015374|Ga0132255_104684736 | Not Available | 579 | Open in IMG/M |
3300017792|Ga0163161_11224624 | Not Available | 650 | Open in IMG/M |
3300018072|Ga0184635_10389268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 529 | Open in IMG/M |
3300018073|Ga0184624_10406358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 603 | Open in IMG/M |
3300018075|Ga0184632_10186498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris | 914 | Open in IMG/M |
3300019356|Ga0173481_10403290 | Not Available | 669 | Open in IMG/M |
3300019879|Ga0193723_1071276 | Not Available | 1002 | Open in IMG/M |
3300022694|Ga0222623_10298783 | Not Available | 618 | Open in IMG/M |
3300022901|Ga0247788_1066945 | Not Available | 682 | Open in IMG/M |
3300023072|Ga0247799_1088399 | Not Available | 548 | Open in IMG/M |
3300025901|Ga0207688_10708998 | Not Available | 636 | Open in IMG/M |
3300025904|Ga0207647_10769826 | Not Available | 520 | Open in IMG/M |
3300025912|Ga0207707_10439463 | Not Available | 1117 | Open in IMG/M |
3300025916|Ga0207663_10448814 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 994 | Open in IMG/M |
3300025917|Ga0207660_10520362 | Not Available | 966 | Open in IMG/M |
3300025917|Ga0207660_11257065 | Not Available | 602 | Open in IMG/M |
3300025920|Ga0207649_10973209 | Not Available | 667 | Open in IMG/M |
3300025925|Ga0207650_10441031 | Not Available | 1082 | Open in IMG/M |
3300025926|Ga0207659_11036594 | Not Available | 706 | Open in IMG/M |
3300025929|Ga0207664_10150443 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1977 | Open in IMG/M |
3300025929|Ga0207664_10613172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium sangaii | 977 | Open in IMG/M |
3300025930|Ga0207701_10765746 | Not Available | 815 | Open in IMG/M |
3300025932|Ga0207690_11565559 | Not Available | 551 | Open in IMG/M |
3300025941|Ga0207711_10066227 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3124 | Open in IMG/M |
3300025944|Ga0207661_12105583 | Not Available | 510 | Open in IMG/M |
3300025961|Ga0207712_10855931 | Not Available | 802 | Open in IMG/M |
3300026089|Ga0207648_10266760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 1529 | Open in IMG/M |
3300026089|Ga0207648_10622276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium sangaii | 996 | Open in IMG/M |
3300026095|Ga0207676_12325064 | Not Available | 533 | Open in IMG/M |
3300026116|Ga0207674_10203569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1929 | Open in IMG/M |
3300026116|Ga0207674_12092220 | Not Available | 530 | Open in IMG/M |
3300026658|Ga0207573_100908 | Not Available | 537 | Open in IMG/M |
3300027252|Ga0209973_1016906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 934 | Open in IMG/M |
3300027326|Ga0209731_1035999 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
3300027403|Ga0207609_102039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 701 | Open in IMG/M |
3300027617|Ga0210002_1004162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2144 | Open in IMG/M |
3300027821|Ga0209811_10126038 | Not Available | 936 | Open in IMG/M |
3300027915|Ga0209069_10129714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1238 | Open in IMG/M |
3300028379|Ga0268266_11522062 | Not Available | 644 | Open in IMG/M |
3300028711|Ga0307293_10170322 | Not Available | 693 | Open in IMG/M |
3300028787|Ga0307323_10104411 | Not Available | 1017 | Open in IMG/M |
3300028793|Ga0307299_10268031 | Not Available | 641 | Open in IMG/M |
3300028799|Ga0307284_10100545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1081 | Open in IMG/M |
3300028824|Ga0307310_10174117 | Not Available | 1005 | Open in IMG/M |
3300028828|Ga0307312_10509567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 794 | Open in IMG/M |
3300028878|Ga0307278_10236645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris | 811 | Open in IMG/M |
3300028884|Ga0307308_10064689 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1725 | Open in IMG/M |
3300028885|Ga0307304_10201045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 852 | Open in IMG/M |
(restricted) 3300031150|Ga0255311_1040292 | Not Available | 980 | Open in IMG/M |
3300031198|Ga0307500_10068443 | Not Available | 896 | Open in IMG/M |
3300031198|Ga0307500_10302412 | Not Available | 508 | Open in IMG/M |
3300031226|Ga0307497_10507348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 596 | Open in IMG/M |
3300031226|Ga0307497_10669465 | Not Available | 532 | Open in IMG/M |
3300031359|Ga0307426_1027750 | All Organisms → cellular organisms → Bacteria | 2551 | Open in IMG/M |
3300031360|Ga0307444_1035629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1699 | Open in IMG/M |
3300031446|Ga0170820_17144660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1857 | Open in IMG/M |
3300031562|Ga0310886_10809706 | Not Available | 590 | Open in IMG/M |
3300031913|Ga0310891_10129623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Amaricoccus → unclassified Amaricoccus → Amaricoccus sp. HAR-UPW-R2A-40 | 802 | Open in IMG/M |
3300032000|Ga0310903_10008016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → Beijerinckia indica → Beijerinckia indica subsp. indica → Beijerinckia indica subsp. indica ATCC 9039 | 3133 | Open in IMG/M |
3300032003|Ga0310897_10180769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 907 | Open in IMG/M |
3300032012|Ga0310902_11353625 | Not Available | 505 | Open in IMG/M |
3300032061|Ga0315540_10035859 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2422 | Open in IMG/M |
3300032061|Ga0315540_10060068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1801 | Open in IMG/M |
3300032075|Ga0310890_11669984 | Not Available | 528 | Open in IMG/M |
3300032144|Ga0315910_10953314 | Not Available | 669 | Open in IMG/M |
3300033433|Ga0326726_11586428 | Not Available | 637 | Open in IMG/M |
3300034090|Ga0326723_0121830 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1136 | Open in IMG/M |
3300034819|Ga0373958_0197069 | Not Available | 526 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 21.71% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.61% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 4.61% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 4.61% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.29% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.29% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.63% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 2.63% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.63% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.63% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.97% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.97% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.97% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.97% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.97% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.97% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.97% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.97% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.97% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.32% |
Salt Marsh Sediment | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment | 1.32% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.32% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.32% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.32% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 1.32% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.32% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.32% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.32% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.32% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.66% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.66% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.66% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.66% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.66% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.66% |
Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.66% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.66% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.66% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.66% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.66% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.66% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.66% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.66% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.66% |
Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.66% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis soil old | Host-Associated | Open in IMG/M |
3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001139 | Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soil | Environmental | Open in IMG/M |
3300002128 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300005164 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC | Environmental | Open in IMG/M |
3300005169 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA | Environmental | Open in IMG/M |
3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006194 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Host-Associated | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300012475 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 | Host-Associated | Open in IMG/M |
3300012884 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 | Environmental | Open in IMG/M |
3300012891 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2 | Environmental | Open in IMG/M |
3300012893 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1 | Environmental | Open in IMG/M |
3300012899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2 | Environmental | Open in IMG/M |
3300012903 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1 | Environmental | Open in IMG/M |
3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
3300012916 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2 | Environmental | Open in IMG/M |
3300012941 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015 | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
3300022901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S156-409C-4 | Environmental | Open in IMG/M |
3300023072 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S151-409C-6 | Environmental | Open in IMG/M |
3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026658 | Soil microbial communities from Kellog Biological Station, Michigan, USA - Nitrogen cycling UWRJ-G09K4-12 (SPAdes) | Environmental | Open in IMG/M |
3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) | Host-Associated | Open in IMG/M |
3300027326 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027403 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10A5-11 (SPAdes) | Environmental | Open in IMG/M |
3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) | Host-Associated | Open in IMG/M |
3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
3300031150 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH4_T0_E4 | Environmental | Open in IMG/M |
3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031359 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-40 | Environmental | Open in IMG/M |
3300031360 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - SW1603-40 | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
3300031913 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4 | Environmental | Open in IMG/M |
3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
3300032061 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-10 | Environmental | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
ARSoilOldRDRAFT_0137441 | 3300000044 | Arabidopsis Rhizosphere | PGRLHEQALIPFGIEDMSVLVVSVGRDPPVPTYASVTLQPA* |
JGI10214J12806_109105092 | 3300000891 | Soil | RLHEQALIPFGIEDMSVLVFSVGPKPPVPAYASVTQTA* |
JGI1027J12803_1009466111 | 3300000955 | Soil | EQAIIIFAIEDTSMPLISVGDPPIPAYASVTHAA* |
JGI10220J13317_104883473 | 3300001139 | Soil | QALKAFVIDHMSMLVVGVGRDLPVPAYAPIAHAA* |
JGI24036J26619_100641851 | 3300002128 | Corn, Switchgrass And Miscanthus Rhizosphere | PARLHEQALIPFGIEDMSMLVVSVGRDPPVPAYASVTHAA* |
Ga0062589_1014482881 | 3300004156 | Soil | DPIRLHEKALVPFGIADRSMLVVVGVGFDPQVSSYASVTHAA* |
Ga0063356_1046753901 | 3300004463 | Arabidopsis Thaliana Rhizosphere | IIQAAKTGERDPARLYEQALKTFRIEDMSMLVVSVGSDLPVPAYASVTQAA* |
Ga0063356_1062205251 | 3300004463 | Arabidopsis Thaliana Rhizosphere | HLHQQALLALGIEETSMLVNSVGSDPPVPACASVTLQPA* |
Ga0066815_100223581 | 3300005164 | Soil | PARLHEQALIPFGIEDMSMLVVSVGDPPIPAYAPVTHAA* |
Ga0066810_100533882 | 3300005169 | Soil | MAAAENGERDPARLYEQALKTFGIGDTSMLFVSVGDHPLPAFASVTPAT* |
Ga0065704_102715551 | 3300005289 | Switchgrass Rhizosphere | ARDGERDAARLYEQALKAFVIDHMSMLVVGVGRDLPVPAYAPIAHAA* |
Ga0065715_101507664 | 3300005293 | Miscanthus Rhizosphere | PARLCEQALIPFGIEDMSVLVVSVGRNLSVPAYASVAHAA* |
Ga0070683_1017024223 | 3300005329 | Corn Rhizosphere | ERDAALLYEQALKAFVIDHMSMLVVGVGRDLPVPAYAPIAHAA* |
Ga0070680_1019746552 | 3300005336 | Corn Rhizosphere | DGERDAARLYEQALQAFGIEDKSMLVVNVGRDIPDPAYASVAHAA* |
Ga0068868_1000329539 | 3300005338 | Miscanthus Rhizosphere | IIAERIIAAAKNGERDSDSLYEQALKAFAIVDASMLFVSVGDPPVPAYASVAHAA* |
Ga0070689_1017652431 | 3300005340 | Switchgrass Rhizosphere | ARLHEQALIPFGIEDMSVLVFSVGPKPPVPAYASVTQTA* |
Ga0070675_1013806652 | 3300005354 | Miscanthus Rhizosphere | SDRLYEQALKAFAIVDASMLFVSVGDPPVPAYASVAHAA* |
Ga0070675_1015046101 | 3300005354 | Miscanthus Rhizosphere | ADRIIAFAKNGERDPARLYEQALLIFGIEDASMPFVSVGRDPVPSANASVAHAA* |
Ga0070681_118741221 | 3300005458 | Corn Rhizosphere | NGERDPGRLHEQALIPFGIEDMSMLVDSVGRDLPVRAYASITQAA* |
Ga0068853_1002350561 | 3300005539 | Corn Rhizosphere | IAAARDGERDAARLYEQALKAFVIDHMSMLVVGVGRDLPVPAYAPIAHAA* |
Ga0068853_1022164743 | 3300005539 | Corn Rhizosphere | DSDSLYEQALKAFAIVDASMLFVSVGDPPVPAYASVAHAA* |
Ga0070693_1003456622 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | KNGERDVARLYEQALKAFLQDKSMLVVGRDIPDPAYASVAQAA* |
Ga0070704_1000096651 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | VRDPARLCEQALIPFGIEDMSVLVVSVGRNLSVPAYASVAHAA* |
Ga0070664_1001516465 | 3300005564 | Corn Rhizosphere | ALIPFGIEDMSMLVVSVGRDLPVPAYASVTLQPA* |
Ga0068861_1007664241 | 3300005719 | Switchgrass Rhizosphere | RLYEHVLNAFGIEDVSMLVVSVGPNPPVPAYASVAHAA* |
Ga0068863_1007883272 | 3300005841 | Switchgrass Rhizosphere | LYEQALKAFAIVDASMLFVSVGDPPVPAYASVAHAA* |
Ga0068863_1020227212 | 3300005841 | Switchgrass Rhizosphere | AAAKNGVRDPARLCEQALIPFGIEDMSVLVVSVGRDLSVPAYASVAHAA* |
Ga0068858_1005681693 | 3300005842 | Switchgrass Rhizosphere | AAAKNGERDSDRLYEQALKAFAIVDASMLFVSVGDPPVPAYASVAHAA* |
Ga0070715_107401711 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | ERDPARLYEQALKTFGIEDMSMLVVSVGRKPPVPAYASVTQAA* |
Ga0075018_102799251 | 3300006172 | Watersheds | KNGERDPARLYEQALKVFGIGDTSMLFVSVGDHPLPAFAPVTHAA* |
Ga0075014_1002539801 | 3300006174 | Watersheds | AAKNGERDPARLCQQALIPFGIEDMSMLVVSVGRDPPVRTYASVAHAA* |
Ga0075427_100182561 | 3300006194 | Populus Rhizosphere | IAAAKNGERDPGRLYEQVLKAYGIDDMSMLLVSVGRDLPVPAYASVTQAA* |
Ga0079222_115995482 | 3300006755 | Agricultural Soil | IAAAKVGERDADRLYEQALEVFDIDDTLFVSVGRDPPVPTYASVTQAA* |
Ga0075433_103944491 | 3300006852 | Populus Rhizosphere | ILIIAAARDGERDAARLYEQALKAFVIDHMSMLVVGVGRDLPVPAYAPIAHAA* |
Ga0075425_1005567191 | 3300006854 | Populus Rhizosphere | DRIIDAARNGERDPARLYEQALKAFGIGDTSMLFVSVGDHPLPAFASVTPAA* |
Ga0075434_1006944814 | 3300006871 | Populus Rhizosphere | RLYEQALKAFVIDHMSMLVVGVGRDLPVPAYAPIAHAA* |
Ga0075424_1014429061 | 3300006904 | Populus Rhizosphere | NGERDPARLYEQALKAFGIGDTSMLFVSVGDHPLPAFASVTPAA* |
Ga0075435_1014236922 | 3300007076 | Populus Rhizosphere | IQAAKSGERDPARLYGQALKAFRIEDMSIPVVSVGSDLPVPAYASVTQAA* |
Ga0105244_104589783 | 3300009036 | Miscanthus Rhizosphere | ARLRDQALLALGIEETSMLVVSVGRDPPVPAYASVTLQPA* |
Ga0105245_106369413 | 3300009098 | Miscanthus Rhizosphere | RLYEQALKTFGIEDMSMLVVSVGRKPPVPVYASVTQAA* |
Ga0105245_118246231 | 3300009098 | Miscanthus Rhizosphere | GERDSDRLYEQALKAFAIVDASMLFVSVGLDPVPSANASVAHAA* |
Ga0075418_123807513 | 3300009100 | Populus Rhizosphere | KAGERDPARLYAQALKTFGIEDMSMLVVSVGRKPPVPAYASVTQAA* |
Ga0105243_131300771 | 3300009148 | Miscanthus Rhizosphere | LYEQALKAFAIVDASMLFVSVGDPPVPSYASVAHAA* |
Ga0111538_115159391 | 3300009156 | Populus Rhizosphere | NGERDPARLHEQALIPFGIEDMSMLVVSVGRDPPVPAYASVTHAA* |
Ga0111538_120107011 | 3300009156 | Populus Rhizosphere | DRLYEQALKAFAIVDASMLFVSVGDPPVPAYASVAHAA* |
Ga0105241_113304421 | 3300009174 | Corn Rhizosphere | ERDPARLHEQALIPFGIEDMSMLVVSVGRDPPVPAYASVTHAA* |
Ga0105248_118475772 | 3300009177 | Switchgrass Rhizosphere | ERIIAAAKNGERHSDRLYEQALKAFAIVDASMLFVSVGDPPVPSYASVAHAA* |
Ga0105237_102086824 | 3300009545 | Corn Rhizosphere | ERIIAAAKNGERDSDSLYEQALKAFAIVDASMLFVSVGDPPVPAYASVAHAA* |
Ga0105238_125368362 | 3300009551 | Corn Rhizosphere | YEHVLNAFGIEDVSMLVVSIGPNPPVPAYASVTLQPA* |
Ga0105249_117649972 | 3300009553 | Switchgrass Rhizosphere | RLYEQALKAFGIGDTSMLFVSVGDHPLPAFASVTPAA* |
Ga0134128_131025721 | 3300010373 | Terrestrial Soil | YEQALKAFAIVDASMLFVSVGLDPVPSANASVAHAA* |
Ga0134123_105388621 | 3300010403 | Terrestrial Soil | ERDAARLYEQALKAFVIDHMSMLVVGVGRDLPVPAYAPIAHAA* |
Ga0157317_10304251 | 3300012475 | Arabidopsis Rhizosphere | PTIIAERIIAAAKNGERDSDSLYEQALKAFAIVDASMLFVSVGDPPVPAYASVAHTA* |
Ga0157300_10932231 | 3300012884 | Soil | LHEQALIPFGIEDMSVLVFSVGPKPPVPAYASVTQTA* |
Ga0157305_101000691 | 3300012891 | Soil | GERDAALLYEQALKAFVIDHMSMLVVGVGRDLPVPAYAPIAHAA* |
Ga0157284_100835373 | 3300012893 | Soil | AARDGERDAALLYEQALKAFVIDHMSMLVVGVGRDLPVPAYAPIAHAA* |
Ga0157299_100030937 | 3300012899 | Soil | YEQVLRAFGIEEKPMAFVSVGSDLPVLAYASVTPKA* |
Ga0157289_103154831 | 3300012903 | Soil | QQALIPFGIEDMSMLVVSVGRDPPVPAYASVTLQPA* |
Ga0157301_100350284 | 3300012911 | Soil | ERDPAHHHQQALLALGIEETSMLVVSVGRDPPVPAYASVTLQPA* |
Ga0157302_101843461 | 3300012915 | Soil | LYEQALKAFVIDHMSMLVVGVGRDLPVPAYAPIAHAA* |
Ga0157310_100393324 | 3300012916 | Soil | ARLCEQALIPFGIEDMSVLVVSVGRDLSVPAYASVAHAA* |
Ga0162652_1000771923 | 3300012941 | Soil | QRDPVRLYEQALKAFGIDDTSMLFVSIGHDAPVPTYASVPHAA* |
Ga0164300_103987343 | 3300012951 | Soil | IIDVAKNGERDPARLYEQALKAFGIGDTSMLFVSVGDHPLPAFASVTPAA* |
Ga0164298_100956141 | 3300012955 | Soil | IIAEQIIAAAKNGERDSDRLYEQALKAFAIVDASMLFVSVGLDPVPSANASVAHAA* |
Ga0164298_102814591 | 3300012955 | Soil | KNGERDSDRLYEQALKAFAIVDASMLFVSVGDPPIPSYASVAHAA* |
Ga0164303_105862872 | 3300012957 | Soil | DPGSLYEHVLEAYAIEDTSMPLVSVGDPPVPVYA* |
Ga0164299_114279582 | 3300012958 | Soil | GERDPARLYEQAIIIFAIEDTSMPLISVGDPPIPAYASVTHAA* |
Ga0164308_119333202 | 3300012985 | Soil | IEAAENGERDPARLHEQALIPFGIEDMSVLVFSVGPKPPVPAYASVTQTA* |
Ga0164306_103768502 | 3300012988 | Soil | SDSLYEQALKAFAIVDASMLFVSVGDPLVPAYASVAHAA* |
Ga0164305_107802001 | 3300012989 | Soil | LYEQALKAFGIGDTSMLFVSVGDHPLPAFASVTPAA* |
Ga0164305_118102891 | 3300012989 | Soil | AAKNGERDSDCLYEQALKAFAIVDASMLFVSVGLDPVPSANASVAHAA* |
Ga0163162_107103261 | 3300013306 | Switchgrass Rhizosphere | IAAAKNGERDSDSLYEQALKAFAIVDASMLFVSVGDPPVPAYASVAHAA* |
Ga0157372_109334492 | 3300013307 | Corn Rhizosphere | IAAARNGERDPARLCDQALIPFGIEDMSMLVISVGRDFPVPAHASVAHAA* |
Ga0163163_102774631 | 3300014325 | Switchgrass Rhizosphere | YAQILKPYGIDETSMLFVSVGRDLPVPAYASVTQAA* |
Ga0157376_120014891 | 3300014969 | Miscanthus Rhizosphere | RLYAQALKTFGIEDMSMLVVSVGRKPPVPAYASVTQAA* |
Ga0132258_132020532 | 3300015371 | Arabidopsis Rhizosphere | IAAAKNGERDSDRLYEQALKAFAIVDASMLFVSVGDPPVPAYASVAHAA* |
Ga0132256_1001993981 | 3300015372 | Arabidopsis Rhizosphere | IIEAAKDGERDPARLYEQTLIIFGIIDSRWISVGPKPPVPTYALVTHAA* |
Ga0132256_1035044961 | 3300015372 | Arabidopsis Rhizosphere | GQVLKTYGIHDTSMLLVSVGSDLPVPAYALITQAA* |
Ga0132257_1009667161 | 3300015373 | Arabidopsis Rhizosphere | RLYEQALKAFAIVDASMLFVSVGDPPVPAYASVAHAA* |
Ga0132257_1016696221 | 3300015373 | Arabidopsis Rhizosphere | EQALIPFGIEDMSMLVVSVGRDPPVPAYASVTHAA* |
Ga0132257_1017411612 | 3300015373 | Arabidopsis Rhizosphere | HEQALIPFGIEDMSMLVVSVGRDPPVPSYAPGTQAA* |
Ga0132257_1019302842 | 3300015373 | Arabidopsis Rhizosphere | LYEQALKAFAIVDASMLFVSVGLDPVPSANASVAHAV* |
Ga0132255_1043378881 | 3300015374 | Arabidopsis Rhizosphere | PGRLYEQVLKAYGIDDTSMLLVSAHANPPIPAYASVTRAA* |
Ga0132255_1046847362 | 3300015374 | Arabidopsis Rhizosphere | DRISAAAKNGERDPARLYEQALKDYSIDDISMLVVSVGSDHPVPAYASVAHAA* |
Ga0163161_112246241 | 3300017792 | Switchgrass Rhizosphere | FAKNGERDPARLYEQALIIFGIEDASMPFVSVGRDPVPSANASVAHAA |
Ga0184635_103892681 | 3300018072 | Groundwater Sediment | KNGERDPARLYEQAIIIFAIEDTSMPLISVGNPPIPAYASVTHAA |
Ga0184624_104063581 | 3300018073 | Groundwater Sediment | TGERDPARLYEQVLNAFSIEDMSMPVVSVGSDLPVPAYAAVPLAGGRLLN |
Ga0184632_101864983 | 3300018075 | Groundwater Sediment | DPARLYEQVLKAYGIDDTSMLLFSVGRDLPVPAYASVTHAA |
Ga0173481_104032902 | 3300019356 | Soil | PARLYEQALKAFGIEEKPMVFVSVGGDLPVPAYASVTHAA |
Ga0193723_10712761 | 3300019879 | Soil | DRIIDVAKNGERDPARLYEQALKAFGIGDTSMLFVNVGDHPLPAFASVTPAA |
Ga0222623_102987831 | 3300022694 | Groundwater Sediment | RDPARLYEQVLNAFSIEDMSMPVVSVGSDLPVPAYASVTQAA |
Ga0247788_10669451 | 3300022901 | Soil | GERDPARLHEQALIPFGIEDMSVLVFSVGPKPPVPAYASVTQTA |
Ga0247799_10883991 | 3300023072 | Soil | EQALIPFGIEDMSVLVFSVGPKPPVPAYASVTQTA |
Ga0207688_107089981 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | ERDPARLHEQALIPFGIEDMSVLVFSVGPKPPVPAYASVTQTA |
Ga0207647_107698261 | 3300025904 | Corn Rhizosphere | AAKNGERDPDRLCQQALIPFGIEDMSMLVVSVGPKPPVPAYASVTQTA |
Ga0207707_104394633 | 3300025912 | Corn Rhizosphere | LHEQALIPFGIEDMSMLVVSVGSDLPDPAYASVTLQPA |
Ga0207663_104488141 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | RNGEHDPVRLCDQALIPFGIEDMSMLVISVGRDFPVPAHASVAHAA |
Ga0207660_105203623 | 3300025917 | Corn Rhizosphere | RNGERDPARLHEQALIPFGIEDMSMLVVSVGSDLPDPAYASVTLQPA |
Ga0207660_112570651 | 3300025917 | Corn Rhizosphere | QALIPFGIEDMSMLVVSVGRDPPVPAYAAVTLQPA |
Ga0207649_109732092 | 3300025920 | Corn Rhizosphere | GERDPARLYEQALLIFGIEDASMPFVSVGRDPVPSANASVAHAA |
Ga0207650_104410312 | 3300025925 | Switchgrass Rhizosphere | IAAAKNGERDVARLYEQALKAFLQDKSMLVVGRDIPDPAYASVAQAA |
Ga0207659_110365942 | 3300025926 | Miscanthus Rhizosphere | LIIATAKDGERDAARLYEQALQAFGIEDKSMLVVNVGRDIPDPAYASVAHAA |
Ga0207664_101504431 | 3300025929 | Agricultural Soil | AAARNGEHDPIRLCEQALIPFGIEDTSMPVISVGRDFPVPAYASVAHAA |
Ga0207664_106131722 | 3300025929 | Agricultural Soil | LRPTIIAERIIAAAKNGERDSDSLYEQALKAFAIVDASMLFVSVGDPPVPSYASVAHAA |
Ga0207701_107657461 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | ERDPARLHEQALIPFGIEDMSMLVVSVGRDPPVPAYASVTHAA |
Ga0207690_115655591 | 3300025932 | Corn Rhizosphere | HEQALIPFGIEDMSMLVVSVGRDPPVPTYAPVTQAA |
Ga0207711_100662271 | 3300025941 | Switchgrass Rhizosphere | AKNGERHSDRLYEQALKAFAIVDASMLFVSVGDPPVPAYASVAHAA |
Ga0207661_121055831 | 3300025944 | Corn Rhizosphere | EAAENGERDPARLHEQALIPFGFEDMSILVFSVGRDPPVPAYASVTLQPA |
Ga0207712_108559311 | 3300025961 | Switchgrass Rhizosphere | NGERDPARLRDQALLALGIEETSMLVVSVGRDPPVPAYASVTLQPA |
Ga0207648_102667602 | 3300026089 | Miscanthus Rhizosphere | VPTIIAERIIAAAKNGERHSDRLYEQALKAFAIVDASMLFVSVGDPPVPAYASVAHAA |
Ga0207648_106222763 | 3300026089 | Miscanthus Rhizosphere | NGERDTIHLHQQALLALGIEETSMLVNSVGSDPPVPACASVTLQPA |
Ga0207676_123250642 | 3300026095 | Switchgrass Rhizosphere | AAAKNGERHSDRLYEQALKAFAIVDASMLFVSVGDPPVPSYASVAHAA |
Ga0207674_102035691 | 3300026116 | Corn Rhizosphere | RDPARLCEQALIPFGIEDMSVLVVSVGRNLSVPAYASVAHAA |
Ga0207674_120922201 | 3300026116 | Corn Rhizosphere | LCRADIIAERIIAAAKNGERDSDRLYEQALKAFAIVDASMLFVSVGDPPVPAYASVAHAA |
Ga0207573_1009081 | 3300026658 | Soil | LCEQALIPFGIEDMSVLVVSVGRNLSVPAYASVAHAA |
Ga0209973_10169061 | 3300027252 | Arabidopsis Thaliana Rhizosphere | EQVLRAFGIEEKPMAFVSVGSDLPVLAYASVTPKA |
Ga0209731_10359991 | 3300027326 | Forest Soil | DLIIQAAKTGERDPGRLYEQVLKAYGIDDASTPLVSVGRDLPVPAYAAVTQAA |
Ga0207609_1020393 | 3300027403 | Soil | LYEQALKAFVIDHMSMLVVGVGRDLPVPAYAPIAHAA |
Ga0210002_10041621 | 3300027617 | Arabidopsis Thaliana Rhizosphere | QALIPFGIEDMSMLVVSVGRDPPVSAYASVTLQPA |
Ga0209811_101260382 | 3300027821 | Surface Soil | RDPGRLYEQVLKAYGIDDTSMLLVSVGRDLPVPAYASVTHAA |
Ga0209069_101297141 | 3300027915 | Watersheds | YEQALKAFGIDDTSMLFVSVGSERPVPAYASITEAA |
Ga0268266_115220621 | 3300028379 | Switchgrass Rhizosphere | RLYEQALKAFAIVDASMLFVSVGDPPVPSYASVAHAA |
Ga0307293_101703222 | 3300028711 | Soil | AAKTGERDPARLYEQVLNAFSIEDMSMPVVSVGSDLPVPAYASVTQAA |
Ga0307323_101044111 | 3300028787 | Soil | YEQVLKAYGIDDTSMLVVSVSRDHPVPAYASVTHAA |
Ga0307299_102680311 | 3300028793 | Soil | DPARLYEQVLNAFSIEDMSMPLVSVGRDLPVPAYASVTQAA |
Ga0307284_101005451 | 3300028799 | Soil | AAKTGERDPARLYEQVLNAFSIEDMSMPVVSVGSDLPVPAYAAVPLAGGRLLN |
Ga0307310_101741171 | 3300028824 | Soil | LVSAIPPRLYEQVLNAFRIEDMSMPVVSVGSDLPVPAYASVTQAA |
Ga0307312_105095673 | 3300028828 | Soil | ERDPARLYEQVLNAFSIEDMSMPVVSVGSDLPVPAYAAVPLAGRRLLN |
Ga0307278_102366451 | 3300028878 | Soil | LYEQVLNAFRIEDMSMPVVSVGSDLPVPAYASVTHAA |
Ga0307308_100646894 | 3300028884 | Soil | GERDPARMYEQVLNAFSIEDMSMPVVSVGSDLPVPAYASVTQLA |
Ga0307304_102010453 | 3300028885 | Soil | DPARLFEQVLNAFSIEDMSMPVVSVGSDLPVPAYASVTQLA |
(restricted) Ga0255311_10402922 | 3300031150 | Sandy Soil | ARLHAQALIPFGIEDMSVLVVSVGRDPVPAAYASVTHAA |
Ga0307500_100684431 | 3300031198 | Soil | NGERDPDRLYAQILKAYGIDDTSMLFVSVGRDLPVPAYASVTQAA |
Ga0307500_103024121 | 3300031198 | Soil | ERDPARLYEQALKAFGIGDTSMLFVSVGDHPFPAFASVTPAA |
Ga0307497_105073482 | 3300031226 | Soil | IKASKTGERDPARLYEQVLNAFSIEDMSMPVVSVGRDLPVPAYASVTQTA |
Ga0307497_106694652 | 3300031226 | Soil | IADLIITAAKDGERDPARLYEQAIIIFAIEDTSMPLISVGDPPIPAYASVTHAA |
Ga0307426_10277501 | 3300031359 | Salt Marsh | ERDPAQLYRQALKAFRIEDMSMLVVSVGRAPPSPAYASVAHAA |
Ga0307444_10356291 | 3300031360 | Salt Marsh | AAAKNDERDPARLYRQALKAFRIQDMSMLVVSVGRAPPSPAYASVAHAA |
Ga0170820_171446601 | 3300031446 | Forest Soil | LIIAAAKGGELDAARLYEQALNAFGIDDMSMLFVSVGHDAPVPTYASVTHAA |
Ga0310886_108097061 | 3300031562 | Soil | RDSDRLYEQALKAFAIVDASMLFVSVGLDPVPSANASVAHAV |
Ga0310904_107409442 | 3300031854 | Soil | AKDGERDPGCLYEHVLEAYAIEDMSMPLVSVGDPPVPVPAYA |
Ga0310891_101296231 | 3300031913 | Soil | KNGERDSDRLYEQALKAFAIVDASMLFVSVGLDPVPSANASVAHAA |
Ga0310903_100080161 | 3300032000 | Soil | ATNGERDPARLRDQALLALGIEETSMLVVSVGRDPPVPAYASVTLQPA |
Ga0310897_101807691 | 3300032003 | Soil | IAEQIIAAAKNGERDSDRLYEQALKAFAIVDASMLFVSVGLDPVPSANASVAHAA |
Ga0310902_113536251 | 3300032012 | Soil | PARLHEQALIPFGIEDMSMLVVSVGRDPPVSAYASVTLQPA |
Ga0315540_100358596 | 3300032061 | Salt Marsh Sediment | PARLCEQALIPFGIEDMSMLVISVGRDSPVSAYASVAHAA |
Ga0315540_100600681 | 3300032061 | Salt Marsh Sediment | GERDPARLCEQALIPFGIEDMSMLVISVGRDSPVPAYASVAHAA |
Ga0310890_116699841 | 3300032075 | Soil | DPDRLYAQILKAYGIDDTSMLFVSVGRDLPVPAYASVTQAA |
Ga0315910_109533141 | 3300032144 | Soil | TARLHQQALIPFGIEDMSMLVVSVGRDPPVPAYASVTLQPA |
Ga0326726_115864282 | 3300033433 | Peat Soil | ARLYEQALKTFGIEDDVSMLVVSVGSERSVPAYASVTHAA |
Ga0326723_0121830_993_1136 | 3300034090 | Peat Soil | AKNGERDPARLYEQALKVFGMDDTSMLVVSVGRDSPVPTYALVTQAA |
Ga0373958_0197069_1_111 | 3300034819 | Rhizosphere Soil | YEQALKAFAIVDASMLFVSVGLDPVPSANASVAHAV |
⦗Top⦘ |