| Basic Information | |
|---|---|
| Family ID | F045952 |
| Family Type | Metagenome |
| Number of Sequences | 152 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MPTAARLMVSDEPPALMNGSVMPVTGMSATTTPMLMNAWMQSQAV |
| Number of Associated Samples | 145 |
| Number of Associated Scaffolds | 152 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 63.82 % |
| % of genes near scaffold ends (potentially truncated) | 94.08 % |
| % of genes from short scaffolds (< 2000 bps) | 96.05 % |
| Associated GOLD sequencing projects | 141 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.28 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.342 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (17.763 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.632 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (36.842 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 17.81% β-sheet: 0.00% Coil/Unstructured: 82.19% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.28 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 152 Family Scaffolds |
|---|---|---|
| PF03033 | Glyco_transf_28 | 82.24 |
| PF04101 | Glyco_tran_28_C | 13.82 |
| PF08478 | POTRA_1 | 0.66 |
| PF01565 | FAD_binding_4 | 0.66 |
| PF01098 | FTSW_RODA_SPOVE | 0.66 |
| PF01820 | Dala_Dala_lig_N | 0.66 |
| PF13472 | Lipase_GDSL_2 | 0.66 |
| COG ID | Name | Functional Category | % Frequency in 152 Family Scaffolds |
|---|---|---|---|
| COG0772 | Peptodoglycan polymerase FtsW/RodA/SpoVE | Cell cycle control, cell division, chromosome partitioning [D] | 0.66 |
| COG1181 | D-alanine-D-alanine ligase or related ATP-grasp enzyme | Cell wall/membrane/envelope biogenesis [M] | 0.66 |
| COG1589 | Cell division septal protein FtsQ | Cell cycle control, cell division, chromosome partitioning [D] | 0.66 |
| COG4775 | Outer membrane protein assembly factor BamA | Cell wall/membrane/envelope biogenesis [M] | 0.66 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.34 % |
| Unclassified | root | N/A | 0.66 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908016|OU_2_1_1_newblercontig97955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 626 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_100339402 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1387 | Open in IMG/M |
| 3300003991|Ga0055461_10212454 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 526 | Open in IMG/M |
| 3300003996|Ga0055467_10171724 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 658 | Open in IMG/M |
| 3300004003|Ga0055445_10316724 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 542 | Open in IMG/M |
| 3300004156|Ga0062589_101540175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 656 | Open in IMG/M |
| 3300004463|Ga0063356_105122820 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 563 | Open in IMG/M |
| 3300004643|Ga0062591_102396863 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300004779|Ga0062380_10391493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 603 | Open in IMG/M |
| 3300005093|Ga0062594_100886932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 840 | Open in IMG/M |
| 3300005164|Ga0066815_10124262 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 504 | Open in IMG/M |
| 3300005336|Ga0070680_101865575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 521 | Open in IMG/M |
| 3300005468|Ga0070707_100199407 | All Organisms → cellular organisms → Bacteria | 1951 | Open in IMG/M |
| 3300005535|Ga0070684_101595614 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 615 | Open in IMG/M |
| 3300005536|Ga0070697_101015225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 738 | Open in IMG/M |
| 3300005549|Ga0070704_101149189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 707 | Open in IMG/M |
| 3300005578|Ga0068854_102212589 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300005719|Ga0068861_102482491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 522 | Open in IMG/M |
| 3300005841|Ga0068863_102368321 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 541 | Open in IMG/M |
| 3300005842|Ga0068858_101389667 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300005843|Ga0068860_100392453 | All Organisms → cellular organisms → Bacteria | 1372 | Open in IMG/M |
| 3300006046|Ga0066652_100848605 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300006173|Ga0070716_100828456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 719 | Open in IMG/M |
| 3300006358|Ga0068871_101880669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 569 | Open in IMG/M |
| 3300006796|Ga0066665_11517101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 524 | Open in IMG/M |
| 3300006854|Ga0075425_100779566 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1096 | Open in IMG/M |
| 3300006864|Ga0066797_1195131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 707 | Open in IMG/M |
| 3300007004|Ga0079218_13465006 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300009093|Ga0105240_11551651 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 694 | Open in IMG/M |
| 3300009111|Ga0115026_11149354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 629 | Open in IMG/M |
| 3300009131|Ga0115027_11641952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 532 | Open in IMG/M |
| 3300009177|Ga0105248_12324911 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 610 | Open in IMG/M |
| 3300009649|Ga0105855_1276753 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 527 | Open in IMG/M |
| 3300009700|Ga0116217_10412666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 856 | Open in IMG/M |
| 3300010044|Ga0126310_10552028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 851 | Open in IMG/M |
| 3300010047|Ga0126382_11126594 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 697 | Open in IMG/M |
| 3300010401|Ga0134121_10634407 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1004 | Open in IMG/M |
| 3300010403|Ga0134123_11437945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 731 | Open in IMG/M |
| 3300011414|Ga0137442_1049462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 845 | Open in IMG/M |
| 3300011432|Ga0137428_1128110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 736 | Open in IMG/M |
| 3300012004|Ga0120134_1117503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 504 | Open in IMG/M |
| 3300012041|Ga0137430_1246770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 509 | Open in IMG/M |
| 3300012091|Ga0136625_1243142 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 609 | Open in IMG/M |
| 3300012199|Ga0137383_11093329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 577 | Open in IMG/M |
| 3300012208|Ga0137376_10068843 | All Organisms → cellular organisms → Bacteria | 2939 | Open in IMG/M |
| 3300012351|Ga0137386_11263582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 514 | Open in IMG/M |
| 3300012362|Ga0137361_10553833 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1055 | Open in IMG/M |
| 3300012681|Ga0136613_10712325 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 536 | Open in IMG/M |
| 3300012684|Ga0136614_10944552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 595 | Open in IMG/M |
| 3300012986|Ga0164304_11416974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 571 | Open in IMG/M |
| 3300012989|Ga0164305_11856603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 546 | Open in IMG/M |
| 3300014315|Ga0075350_1102115 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 680 | Open in IMG/M |
| 3300014490|Ga0182010_10027854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2605 | Open in IMG/M |
| 3300014494|Ga0182017_10028809 | All Organisms → cellular organisms → Bacteria | 3787 | Open in IMG/M |
| 3300014496|Ga0182011_10039704 | All Organisms → cellular organisms → Bacteria | 3358 | Open in IMG/M |
| 3300014498|Ga0182019_11104547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 579 | Open in IMG/M |
| 3300015371|Ga0132258_12947942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1181 | Open in IMG/M |
| 3300017789|Ga0136617_11008895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 631 | Open in IMG/M |
| 3300017944|Ga0187786_10336791 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 633 | Open in IMG/M |
| 3300018058|Ga0187766_11390274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 515 | Open in IMG/M |
| 3300018060|Ga0187765_11280537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 518 | Open in IMG/M |
| 3300018071|Ga0184618_10407387 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 575 | Open in IMG/M |
| 3300018075|Ga0184632_10253459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 768 | Open in IMG/M |
| 3300018429|Ga0190272_10958107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 811 | Open in IMG/M |
| 3300018432|Ga0190275_10692419 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1075 | Open in IMG/M |
| 3300018465|Ga0190269_11155873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 603 | Open in IMG/M |
| 3300018466|Ga0190268_10218043 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1061 | Open in IMG/M |
| 3300018466|Ga0190268_11846441 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 547 | Open in IMG/M |
| 3300018469|Ga0190270_12829249 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 548 | Open in IMG/M |
| 3300018920|Ga0190273_12226200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 516 | Open in IMG/M |
| 3300019377|Ga0190264_10420036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 877 | Open in IMG/M |
| 3300019377|Ga0190264_10974263 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 674 | Open in IMG/M |
| 3300019785|Ga0182022_1146625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 741 | Open in IMG/M |
| 3300019785|Ga0182022_1174902 | Not Available | 1728 | Open in IMG/M |
| 3300020006|Ga0193735_1165735 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 558 | Open in IMG/M |
| 3300021344|Ga0193719_10367965 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 596 | Open in IMG/M |
| 3300022534|Ga0224452_1131410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 770 | Open in IMG/M |
| 3300022694|Ga0222623_10022460 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2364 | Open in IMG/M |
| 3300022756|Ga0222622_11457107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 504 | Open in IMG/M |
| 3300022898|Ga0247745_1098803 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 503 | Open in IMG/M |
| 3300025155|Ga0209320_10181805 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 921 | Open in IMG/M |
| 3300025165|Ga0209108_10382981 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 692 | Open in IMG/M |
| 3300025846|Ga0209538_1270592 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 608 | Open in IMG/M |
| 3300025865|Ga0209226_10367952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 589 | Open in IMG/M |
| 3300025885|Ga0207653_10027626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1822 | Open in IMG/M |
| 3300025913|Ga0207695_11735313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 505 | Open in IMG/M |
| 3300025916|Ga0207663_11357996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 572 | Open in IMG/M |
| 3300025918|Ga0207662_10060468 | All Organisms → cellular organisms → Bacteria | 2273 | Open in IMG/M |
| 3300025920|Ga0207649_11336780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 567 | Open in IMG/M |
| 3300025932|Ga0207690_10993046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 698 | Open in IMG/M |
| 3300025932|Ga0207690_11242252 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 622 | Open in IMG/M |
| 3300025934|Ga0207686_11536102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 549 | Open in IMG/M |
| 3300025944|Ga0207661_12010233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 524 | Open in IMG/M |
| 3300026062|Ga0208654_1013584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1024 | Open in IMG/M |
| 3300026089|Ga0207648_12008599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 539 | Open in IMG/M |
| 3300026118|Ga0207675_102364211 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 544 | Open in IMG/M |
| 3300026342|Ga0209057_1247815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 507 | Open in IMG/M |
| 3300027877|Ga0209293_10090282 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10 | 1364 | Open in IMG/M |
| 3300028003|Ga0247707_1022863 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 592 | Open in IMG/M |
| 3300028381|Ga0268264_12706073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 500 | Open in IMG/M |
| 3300028556|Ga0265337_1146160 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 640 | Open in IMG/M |
| 3300028587|Ga0247828_10404623 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 787 | Open in IMG/M |
| 3300028710|Ga0307322_10102806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 736 | Open in IMG/M |
| 3300028712|Ga0307285_10049017 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1050 | Open in IMG/M |
| 3300028719|Ga0307301_10323050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 507 | Open in IMG/M |
| 3300028770|Ga0302258_1099755 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 703 | Open in IMG/M |
| 3300028799|Ga0307284_10120253 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 996 | Open in IMG/M |
| 3300028807|Ga0307305_10523047 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 531 | Open in IMG/M |
| 3300028828|Ga0307312_10375182 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 932 | Open in IMG/M |
| 3300028861|Ga0302259_1051605 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 972 | Open in IMG/M |
| 3300028865|Ga0302291_10103344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 949 | Open in IMG/M |
| 3300028872|Ga0307314_10192719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 610 | Open in IMG/M |
| 3300028876|Ga0307286_10424938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 500 | Open in IMG/M |
| 3300028878|Ga0307278_10317263 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 688 | Open in IMG/M |
| 3300028880|Ga0307300_10258931 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 579 | Open in IMG/M |
| 3300028881|Ga0307277_10187972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 903 | Open in IMG/M |
| 3300029804|Ga0247696_104286 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 868 | Open in IMG/M |
| 3300029957|Ga0265324_10246503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 607 | Open in IMG/M |
| 3300030000|Ga0311337_11594479 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 573 | Open in IMG/M |
| 3300030002|Ga0311350_11332911 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 638 | Open in IMG/M |
| 3300030006|Ga0299907_10779217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 723 | Open in IMG/M |
| 3300030010|Ga0302299_10617771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 536 | Open in IMG/M |
| 3300030014|Ga0302175_10175899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 513 | Open in IMG/M |
| 3300030050|Ga0302255_1066035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 720 | Open in IMG/M |
| 3300030673|Ga0302287_10216247 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 559 | Open in IMG/M |
| (restricted) 3300031248|Ga0255312_1072051 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 834 | Open in IMG/M |
| 3300031521|Ga0311364_11525447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 660 | Open in IMG/M |
| 3300031726|Ga0302321_100985952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 959 | Open in IMG/M |
| 3300031736|Ga0318501_10517104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 652 | Open in IMG/M |
| 3300031824|Ga0307413_10202789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1434 | Open in IMG/M |
| 3300031902|Ga0302322_102116946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 692 | Open in IMG/M |
| 3300031903|Ga0307407_10262830 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1188 | Open in IMG/M |
| 3300031903|Ga0307407_10921620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 671 | Open in IMG/M |
| 3300031908|Ga0310900_10262551 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1250 | Open in IMG/M |
| 3300031913|Ga0310891_10307613 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 560 | Open in IMG/M |
| 3300031918|Ga0311367_10832877 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 932 | Open in IMG/M |
| 3300031918|Ga0311367_11992897 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 560 | Open in IMG/M |
| 3300031949|Ga0214473_11780518 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 609 | Open in IMG/M |
| 3300032002|Ga0307416_101018850 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 931 | Open in IMG/M |
| 3300032002|Ga0307416_103592351 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 519 | Open in IMG/M |
| 3300032004|Ga0307414_10852214 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 833 | Open in IMG/M |
| 3300032163|Ga0315281_12067685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 542 | Open in IMG/M |
| 3300032401|Ga0315275_11911792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 627 | Open in IMG/M |
| 3300032828|Ga0335080_11359861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 707 | Open in IMG/M |
| 3300032897|Ga0335071_10519695 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1143 | Open in IMG/M |
| 3300033488|Ga0316621_11588183 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 504 | Open in IMG/M |
| 3300033550|Ga0247829_11455260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 566 | Open in IMG/M |
| 3300033743|Ga0334844_072803 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 667 | Open in IMG/M |
| 3300034164|Ga0364940_0078452 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 914 | Open in IMG/M |
| 3300034177|Ga0364932_0061977 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1410 | Open in IMG/M |
| 3300034178|Ga0364934_0233420 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 697 | Open in IMG/M |
| 3300034414|Ga0373905_068517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 566 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 17.76% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 9.21% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 3.95% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.95% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.95% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 3.95% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 2.63% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.63% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 1.97% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.97% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.97% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.97% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.97% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.97% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.97% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.97% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.97% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.32% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.32% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.32% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.32% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.32% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.32% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.32% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.66% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.66% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.66% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.66% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.66% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.66% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.66% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.66% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.66% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.66% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.66% |
| Environmental → Unclassified → Unclassified → Unclassified → Unclassified → | 0.66% | |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.66% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.66% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.66% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.66% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.66% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.66% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.66% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.66% |
| Sediment Slurry | Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry | 0.66% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908016 | Sample 642 | Environmental | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300003991 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqB_D1 | Environmental | Open in IMG/M |
| 3300003996 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 | Environmental | Open in IMG/M |
| 3300004003 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWA_D1 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300004779 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005164 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006864 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
| 3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009649 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-059 | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011414 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT266_2 | Environmental | Open in IMG/M |
| 3300011432 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT718_2 | Environmental | Open in IMG/M |
| 3300012004 | Permafrost microbial communities from Nunavut, Canada - A30_5cm_6M | Environmental | Open in IMG/M |
| 3300012041 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT754_2 | Environmental | Open in IMG/M |
| 3300012091 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ483 (23.06) | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012681 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ272 (21.06) | Environmental | Open in IMG/M |
| 3300012684 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06) | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300014315 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014490 | Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaG | Environmental | Open in IMG/M |
| 3300014494 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaG | Environmental | Open in IMG/M |
| 3300014496 | Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaG | Environmental | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300017789 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06) | Environmental | Open in IMG/M |
| 3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300019785 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300022898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S109-311C-5 | Environmental | Open in IMG/M |
| 3300025155 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 4 | Environmental | Open in IMG/M |
| 3300025165 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1 | Environmental | Open in IMG/M |
| 3300025846 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-211 (SPAdes) | Environmental | Open in IMG/M |
| 3300025865 | Arctic peat soil from Barrow, Alaska, USA - Barrow Graham LP Ref core NGADG0011-212 (SPAdes) | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026062 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300027877 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028003 | Soil microbial communities from hillslope of Landscape Evolution Observatory, University of Arizona, Oracle, AZ, United States - 2-2-E_N | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Host-Associated | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028710 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380 | Environmental | Open in IMG/M |
| 3300028712 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139 | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028770 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N2_4 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028861 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N3_4 | Environmental | Open in IMG/M |
| 3300028865 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N1_4 | Environmental | Open in IMG/M |
| 3300028872 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300029804 | Soil microbial communities from hillslope of Landscape Evolution Observatory, University of Arizona, Oracle, AZ, United States - 4-4-W_N | Environmental | Open in IMG/M |
| 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Host-Associated | Open in IMG/M |
| 3300030000 | I_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300030002 | II_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300030010 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_4 | Environmental | Open in IMG/M |
| 3300030014 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N3_3 | Environmental | Open in IMG/M |
| 3300030050 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E2_4 | Environmental | Open in IMG/M |
| 3300030673 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E2_4 | Environmental | Open in IMG/M |
| 3300031248 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5 | Environmental | Open in IMG/M |
| 3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031913 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4 | Environmental | Open in IMG/M |
| 3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300033488 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300033743 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 E1 5-9 | Environmental | Open in IMG/M |
| 3300034164 | Sediment microbial communities from East River floodplain, Colorado, United States - 14_s17 | Environmental | Open in IMG/M |
| 3300034177 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17 | Environmental | Open in IMG/M |
| 3300034178 | Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17 | Environmental | Open in IMG/M |
| 3300034414 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - B1A4.3 | Engineered | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| OU_01649950 | 2124908016 | MPTAARLMVSDEPPALMNGSVMPVTGMSVTTTPMLMNAWMHSQAVIP | |
| JGIcombinedJ13530_1003394021 | 3300001213 | Wetland | MSDEPPAETNGRVIPVTGRSVTTTPTFTSAWMQSIAVIPAARSAPKVSGA |
| Ga0055461_102124542 | 3300003991 | Natural And Restored Wetlands | MPIAAKLMTRLDPPAETNGSGMPVTGMRLTTTPMLMNAWRQIQAVM |
| Ga0055467_101717242 | 3300003996 | Natural And Restored Wetlands | MESRMPAAAKLTSSDEPPALMNGSVMPVTGSSATTTAMLMNA* |
| Ga0055445_103167242 | 3300004003 | Natural And Restored Wetlands | MISDEPPAETNGSGIPVTGIKPTTTATLMNAWMQIQEVMPAASRAPKVSG |
| Ga0062589_1015401752 | 3300004156 | Soil | MAAKLMISDEPPALRKGSVMPVIGTSVTTTAMLMNAWMHSQ |
| Ga0063356_1051228201 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MPTAARLIVSDEPPALMNGSVTPVTGMRVTTTPMLMNAWMHSQPVIPAARR |
| Ga0062591_1023968632 | 3300004643 | Soil | MRDEPPALMNGSVIPVIGSSATTTPMLMNAWRHSQAVIPA |
| Ga0062380_103914931 | 3300004779 | Wetland Sediment | MMSDEPPALMNGRVIPVTGRSATTTPMLMNAWRQSQAVIPTASRDPNVSG |
| Ga0062594_1008869321 | 3300005093 | Soil | MPTAAKLMMSDEPPALMNGSVMPVIGTRVTTTPMLMNAWR |
| Ga0066815_101242621 | 3300005164 | Soil | MPTAARLMVSDDPPALMNGRVMPVTGMSATTTPMLMKAWMHS |
| Ga0070680_1018655751 | 3300005336 | Corn Rhizosphere | MPTAARLMVSDEPPALMNGSVTPVTGMSVTTTPMLMKAWMQSQPVIPAASSAP |
| Ga0070707_1001994071 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MPTAAKLTTSDEPPALMNGRVMPVTGTSATTTAMLMNACRQSQAVIP |
| Ga0070684_1015956142 | 3300005535 | Corn Rhizosphere | MPTEAKLTRSDEFPELTKGSVMPVSGSSWSTTPMLMNAWKAMHAEM |
| Ga0070697_1010152251 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MMSDEPPALMNSSVIPVIGSRATTTPILRNAWRHSQAVIP |
| Ga0070704_1011491891 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MDSSTPAAAKLTRSDEPPALMNGSVMPVTGSSATTTATLMNAWKHSQAV |
| Ga0068854_1022125892 | 3300005578 | Corn Rhizosphere | MPTAARLMVSDDPPALMNGRVMPVTGMSATTTPMLMNAWMQSQAVMPAA |
| Ga0068861_1024824912 | 3300005719 | Switchgrass Rhizosphere | MVSDEPPALMNGNVMPVTGIRATTTPMLMNAWMHSQAVMPAASS |
| Ga0068863_1023683211 | 3300005841 | Switchgrass Rhizosphere | MPIAAKLITSDEPPADTNGSGMPVTGISPTTTAMLMNA* |
| Ga0068858_1013896671 | 3300005842 | Switchgrass Rhizosphere | MPTAARLMSSDEPPALMNGSVMPVTGMSTTTTPMLMNAWMQSQ |
| Ga0068860_1003924532 | 3300005843 | Switchgrass Rhizosphere | MPTAARLMVSDEPPALMNGRVMPVTGMSATTTPMLMNAWMQSQAVIPA |
| Ga0066652_1008486051 | 3300006046 | Soil | MPTAARLMVSDEPPALMNGSVMPVTGMSATTTPMLMNAWMQSQAVIPAA |
| Ga0070716_1008284561 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MPTAARLMVSDEPPALMNGSVMPVTGMSATTTPMLMKA |
| Ga0068871_1018806692 | 3300006358 | Miscanthus Rhizosphere | MMSDDPPALMNGSVIPVIGSRATTTPMLMNAWRHSQA |
| Ga0066665_115171012 | 3300006796 | Soil | MISDEPPALMNGNVMPVIGSRATTTPTLMNACTHSHVV |
| Ga0075425_1007795662 | 3300006854 | Populus Rhizosphere | MPTAVSVIASDDPPALTNGSVIPVTGTRPTTTPMLMKAWMQ |
| Ga0066797_11951311 | 3300006864 | Soil | MPTAARLTMSDEPPAETNGSVIPVTGSSVTTTPMLTNAWTHR* |
| Ga0079218_134650062 | 3300007004 | Agricultural Soil | VSDEPPALTNGSVIPVTGMSATTTPMLMNAWMQSQAVIPAASSAPNVSG |
| Ga0105240_115516512 | 3300009093 | Corn Rhizosphere | MDSSTPAAAKLTRSDEPPALMNGSVMPVTGSSATTTATLMNAWKHSQAVMPAA |
| Ga0115026_111493541 | 3300009111 | Wetland | MPTATKLTTSDEPPALTNGSVIPVTGMRETTTPMLMKAWTQIQVVM |
| Ga0115027_116419521 | 3300009131 | Wetland | MPTAAKLMISDDPPAETNGSGMPVTGISPTTTAMLMNAWMQIQAVMPAASRA |
| Ga0105248_123249112 | 3300009177 | Switchgrass Rhizosphere | MISDDPPAEMKGSVMPVIGTTATTTPMLMKACTHSQVV |
| Ga0105855_12767531 | 3300009649 | Permafrost Soil | MESRIPTAAKLTTSDEPPALTNGSVMPVMGSRFTTTP |
| Ga0116217_104126662 | 3300009700 | Peatlands Soil | MPTAAKLIVSDEPPALTNGSVMPVIGSRATTTPMLMNAWTQSQVVMPAASKA |
| Ga0126310_105520282 | 3300010044 | Serpentine Soil | MARSTPTAAKLTTSDEPPALMNGSVIPVTGTSATTTPMLTKAWMHS |
| Ga0126382_111265941 | 3300010047 | Tropical Forest Soil | MPMAAKLITSDEPPADTNGSGIPVTGISPTTTAMLMNAWR |
| Ga0134121_106344071 | 3300010401 | Terrestrial Soil | MDSSTPAAAKLTRSEEPPALMNGSVMPVTGSSATTTATLMNAWKHSQAVMPAASR |
| Ga0134123_114379452 | 3300010403 | Terrestrial Soil | MDKSTPAAAKLTSSEEPPALMNGSVMPVTGSRATTTAMLM |
| Ga0137442_10494621 | 3300011414 | Soil | MSDEPPAETNGSVIPVTGSRVTTTPMLMKAWMHRYAVSPAASSAPK |
| Ga0137428_11281102 | 3300011432 | Soil | MTSDDPPALMNGSVMPVTGISTTTTPMLMKAWMQSQAVIPAASSAP |
| Ga0120134_11175031 | 3300012004 | Permafrost | MMSDEPPALMNGRVIPVIGRSATTTPMFTNAWMHSQAVIPAASR |
| Ga0137430_12467701 | 3300012041 | Soil | MTSDDPPALMNGSVMPVTGISTTTTPMLMNAWMQSHAVIPAASSAPK |
| Ga0136625_12431421 | 3300012091 | Polar Desert Sand | MPTATRLMVNAEPPALTNGRGMPVTGMSAVTTIML |
| Ga0137383_110933292 | 3300012199 | Vadose Zone Soil | MDSRIPAAARLIERLDPPANTNGSVMPVIGTSATTTAMLMNAWMHN |
| Ga0137376_100688431 | 3300012208 | Vadose Zone Soil | MDSRIPAAAKLTRSEEPPALMNGSVIPVTGSRASTTAMLMNAWKHSQAVIPAA |
| Ga0137386_112635822 | 3300012351 | Vadose Zone Soil | MPTAARLMVSDDPPALMNGRVMPVTGMSATTTPMLMNAWMHSQ |
| Ga0137361_105538332 | 3300012362 | Vadose Zone Soil | MPTAARLMVSDDPPALMNGSVMPVTGMSATTTPMLMNAWMQSQAVIP |
| Ga0136613_107123251 | 3300012681 | Polar Desert Sand | MPTAARLMVSADPPALMNGSGMPVTGMSAVTTIMLMSAWTTSQVVMPQ |
| Ga0136614_109445521 | 3300012684 | Polar Desert Sand | MVSAEPPALMNGSGMPVTGRSAVTTIMLTRAWTTSQ |
| Ga0164304_114169742 | 3300012986 | Soil | MPTAARLMVSDEPPALMNGSVMPVTGMSVTTTPMLMNAWMHSQAVIPAA |
| Ga0164305_118566031 | 3300012989 | Soil | MDSSTPAAAKLTRSDEPPALMNGSVMPVTGSSATTTATLM |
| Ga0075350_11021152 | 3300014315 | Natural And Restored Wetlands | MPTAAKLMISDDPPAETNGSGMPVTGISPTTTAMLMNAWMQIQAVMPAAS |
| Ga0182010_100278541 | 3300014490 | Fen | MESRIPTAARLTVSDEPPADTNGSVMPVTGTTVTTTP |
| Ga0182017_100288091 | 3300014494 | Fen | MERRIPMAARLTVNDEPPAETKGSVMPVTGTTATTTP |
| Ga0182011_100397044 | 3300014496 | Fen | MPAATRLTMSDEPPAETNGNVIPVTGSSATTTPMLTKAWTHRYAVIPAASSAP |
| Ga0182019_111045472 | 3300014498 | Fen | MESKIPTAARLTVSDEPPADTNGSVMPVTGTTATTTPMLINA* |
| Ga0132258_129479421 | 3300015371 | Arabidopsis Rhizosphere | MPTAARLMVSDEPPALMNGSVMPVTGMSATTTPMLMKAWMQSQAVI |
| Ga0136617_110088951 | 3300017789 | Polar Desert Sand | MMSDEPPALMNGRVMPVTGRMATTTATLMKAWMQSQAVIPAARSAP |
| Ga0187786_103367912 | 3300017944 | Tropical Peatland | MPTAAKLIVSDDPPALMNGSVMPVIGRSATTTPMLMSAWNVSQAVMPA |
| Ga0187766_113902742 | 3300018058 | Tropical Peatland | MDSRTPTAAKLTTSDEPPWDTNGSVMPVTGSSARTTA |
| Ga0187765_112805371 | 3300018060 | Tropical Peatland | MTSDEPPAETNGSGMPVTGIRPTTTPMLMNAWRQIQPVTPAASSAPK |
| Ga0184618_104073872 | 3300018071 | Groundwater Sediment | MPTAARLMVSDEPPALMNGSVMPVTGMSATTTPILMNAWMQSQAVMPAAS |
| Ga0184632_102534592 | 3300018075 | Groundwater Sediment | MPIAAKLTMSDEPPALMNGRVMPVTGRSATTTAILITAWTVSQPVI |
| Ga0190272_109581072 | 3300018429 | Soil | MMSDEPPALMNGSVIPVIGRSATTTPMLRNACRQSQAVIPAASSPPNVSGA |
| Ga0190275_106924191 | 3300018432 | Soil | MPIAARLMVSADPPALMNGSGMPVTGSSAVTTIMLMQACTTSQ |
| Ga0190269_111558731 | 3300018465 | Soil | MPTAAKLMIRLDPPAETNGSGMPVTGMRPTTTPMLMKAW |
| Ga0190268_102180431 | 3300018466 | Soil | MPTAARLMVSAEPPALMNGSGMPVTGRSAVTTIMLMRACTASHVVMPQAS |
| Ga0190268_118464411 | 3300018466 | Soil | MPAAAKLTTSDTPPALTNGSVIPVTGTSATTTAML |
| Ga0190270_128292491 | 3300018469 | Soil | MMRDEPPALMNGNVIPVIGSSATTTPMLMNACRHSHAVIP |
| Ga0190273_122262001 | 3300018920 | Soil | MPTAARLMVSDEPPALMNGSVMPVTGMSATTTPMLMNAWMQSQAV |
| Ga0190264_104200361 | 3300019377 | Soil | MVSAEPPALMNGSGMPVTGRSAVTTIMLMRECMASQVV |
| Ga0190264_109742631 | 3300019377 | Soil | MMSEEPPALMNGRVMPVTGSRATTTAMLMNAWMHSQAVMPAASSAPNV |
| Ga0182022_11466252 | 3300019785 | Fen | MPTAARLTMSDEPPAETNGSVIPVTGSSVTTTPMFTNAWTQR |
| Ga0182022_11749022 | 3300019785 | Fen | MAARLTVNDEPPAETKGSVMPVTGTTATTTPILISA |
| Ga0193735_11657352 | 3300020006 | Soil | MPTAARLMVSDDPPALMNGSVMPVTGMRVTTTPMLMNAWMHSQAVIPAARSAPN |
| Ga0193719_103679652 | 3300021344 | Soil | MPTAVSVIASDEPPALTNGSVMPVTGTRPTTTPMLM |
| Ga0224452_11314101 | 3300022534 | Groundwater Sediment | MPTAARLMVSDEPPALMNGSVMPVTGIRATTTPMLMKAWMQSHAVIP |
| Ga0222623_100224603 | 3300022694 | Groundwater Sediment | MPTAARLMVSDEPPALMNGRVMPVTGMSVTTTPILMNAW |
| Ga0222622_114571071 | 3300022756 | Groundwater Sediment | MPTAARLMVSDDPPALMNGNVMPVTGISATTTPMLMNAWMHSQAVIPAA |
| Ga0247745_10988031 | 3300022898 | Soil | MPTAARLISSDEPPALMNGSVMPVTGISTTTTPMLMNAWMQSQ |
| Ga0209320_101818051 | 3300025155 | Soil | MPTAARLTVSEEPPALTNGNVIPVTGSSETTTPMLTNAWTVMKT |
| Ga0209108_103829811 | 3300025165 | Soil | MISDDPPALMNGSVIPVTGRRATTTPRLMNAWMHSQ |
| Ga0209538_12705921 | 3300025846 | Arctic Peat Soil | MAAKLTTSDEPPAETNGRVMPVTGTTASTTPMLMRAWKMIQAVI |
| Ga0209226_103679522 | 3300025865 | Arctic Peat Soil | MAAKLTTSDEPPAETNGRVMPVTGTTASTTPMLMRAWKMIQAVIPAAVK |
| Ga0207653_100276261 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MDSSTPAAAKLTRSDEPPALMNGSVMPVTGSSATTTAMLTNAWKHSHA |
| Ga0207695_117353131 | 3300025913 | Corn Rhizosphere | MPAAAKLTSRDEPPALMNGSVMPVTGSRATTTAMLMNAWKHSQAVIPVA |
| Ga0207663_113579961 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MISDDPPAEMKGSVMPVIGTTATTTPMLMNACTHSQVVIPAASS |
| Ga0207662_100604681 | 3300025918 | Switchgrass Rhizosphere | MPTAARLMVSDEPPALMNGRVMPVTGMRATTTPMLMNA |
| Ga0207649_113367801 | 3300025920 | Corn Rhizosphere | MPTAAKLMMSDEPPALMNGSVMPVIGTRVTTTPMLMNAWRHS |
| Ga0207690_109930462 | 3300025932 | Corn Rhizosphere | MDSSTPAAAKLTSSEEPPALMNGSVMPVTGSRATTTATLMKAWKQSQAV |
| Ga0207690_112422521 | 3300025932 | Corn Rhizosphere | MMSDDPPALMNGSVIPVIGSSATTTPMLMKAWRHSQAVIP |
| Ga0207686_115361022 | 3300025934 | Miscanthus Rhizosphere | MMRDEPPALMNGSVIPVIGSRATTTPMLMKAWRHSQAVIPAA |
| Ga0207661_120102332 | 3300025944 | Corn Rhizosphere | MESRIPAAAKLTSSDEPPALMNGSVMPVTGSSATTTAMLMNA |
| Ga0208654_10135841 | 3300026062 | Natural And Restored Wetlands | MPTAAKLMMSDEPPALMNGNVMPVIGMRVTTTPMLMNACRHSQPVIPAAS |
| Ga0207648_120085992 | 3300026089 | Miscanthus Rhizosphere | MMSDDPPALMNGRVIPVIGSSATTTPMLMNAWRQSQAVMPAANSA |
| Ga0207675_1023642111 | 3300026118 | Switchgrass Rhizosphere | MPTAAKLMMSDEPPALMNGSVIPVIGTRVTTTPMLMNACRHSQPVIP |
| Ga0209057_12478151 | 3300026342 | Soil | MPTAARLMVSDDPPALMNGRVMPVTGMSATTTPMLMNAWMHSQAVI |
| Ga0209293_100902821 | 3300027877 | Wetland | MPTATKLTTSDEPPALTNGSVIPVTGMRETTTPMLMKAW |
| Ga0247707_10228632 | 3300028003 | Soil | MPTAARLMVSAEPPALMNGSGMPVTGMSAVTTMMLTNACPTSHVVMP |
| Ga0268264_127060732 | 3300028381 | Switchgrass Rhizosphere | MPTAAKLTTSDEPPALMNGSVMPVTGSSATTTAMLMKACRKSQAVIPAARSA |
| Ga0265337_11461601 | 3300028556 | Rhizosphere | MESRIPTAARLTVNDEPPAETNGSVIPVTGTTATTTPTLISAWKH |
| Ga0247828_104046231 | 3300028587 | Soil | MPTAAKLTSSDEFPELTNGSVMPVSGTSCSTTAMLM |
| Ga0307322_101028061 | 3300028710 | Soil | MPTAARLIVSDDPPALMNGNVMPVTGISVTTTPMLMNAWM |
| Ga0307285_100490171 | 3300028712 | Soil | MMSDDPPALMNGSVMPVIGSRATTTPMLMNAWRHSQAVIPAASSAPNVS |
| Ga0307301_103230501 | 3300028719 | Soil | VSVIASDDPPALTNGSVIPVTGSNATTTPMLMNACTQIQAVIPA |
| Ga0302258_10997551 | 3300028770 | Fen | MMSDEPPALMNGRVIPVIGRIVTTTPMLMIACRHSQAVIPAAMSAP |
| Ga0307284_101202532 | 3300028799 | Soil | MPTAARLMVSDDPPALMNGSVIPVTGMSVTTTPMLMNAWM |
| Ga0307305_105230471 | 3300028807 | Soil | MPTAARLMVSDDPPALMNGSVMPVTGMSATTTPMLMNAWMHSQAVMPAASSAPN |
| Ga0307312_103751821 | 3300028828 | Soil | MPTAARLMVSDEPPALMNGSVMPVTGIRATTTPMLMKAWMQSHAVMPAASSA |
| Ga0302259_10516051 | 3300028861 | Fen | MPTAAKLMMSDDPPAETNGSGMPVTGISPTTTDML |
| Ga0302291_101033442 | 3300028865 | Fen | MMSDEPPALMNGRVIPVIGRIVTTTPMLMIACRHSQA |
| Ga0307314_101927191 | 3300028872 | Soil | MPTAARLMVSDDPPALMNGSVMPVTGMRVTTTPMLMNAWMHSQAV |
| Ga0307286_104249382 | 3300028876 | Soil | MPTAARLMVSDEPPALMNGRVMPVTGMSVTTTPILMNAWMHSQAVIPAARS |
| Ga0307278_103172632 | 3300028878 | Soil | MMSDEPPALMNGSVIPVTGRSAATTPTLTNACRHSQAVMPAARSAPNVSGA |
| Ga0307300_102589311 | 3300028880 | Soil | MPTAARLMVSDEPPALMNGSVMPVTGIRATTTPMLMKAWMQSHAVMPAASNAPN |
| Ga0307277_101879722 | 3300028881 | Soil | MESRIPTAAKLTTSDEPPALMNGSVMPVTGSSATTTAMLTN |
| Ga0247696_1042861 | 3300029804 | Soil | MKLTTSDEPPALTNGRVMPVIGSRTTTTPMLMKACSTSQAVMPAASRAPK |
| Ga0265324_102465032 | 3300029957 | Rhizosphere | MDNRIPTAARLIESDEPPALMNGRVIPVIGIRATTTPM |
| Ga0311337_115944791 | 3300030000 | Fen | VIASDDPPALTNGRVIPVTGTSATTTPMLMNAWIQIQAVMPAA |
| Ga0311350_113329111 | 3300030002 | Fen | MPTAARLTMSDEPPAETNGSVIPVTGSRVTTTPMFTNACTHR |
| Ga0299907_107792172 | 3300030006 | Soil | MVSAEPPALMNGRGMPVTGRSAVTTIMLMQAWTTSQVVMP |
| Ga0302299_106177712 | 3300030010 | Fen | MAAKLTMSDEPPAETNGKVIPVTGTTLTTTPMLMRA |
| Ga0302175_101758991 | 3300030014 | Fen | VPPAETNGSVIPVTGTIATTTPMLINAWKHIQAVMPAATR |
| Ga0302255_10660351 | 3300030050 | Fen | MPTAAKLMIRLDPPAETNGSGMPVTGMSPTTTAMLMNAWRQIQA |
| Ga0302287_102162472 | 3300030673 | Fen | MPTAARVTVSDDPPADTNGSVMPVTGTTATTTPMLMSAWKHIQAVMP |
| (restricted) Ga0255312_10720512 | 3300031248 | Sandy Soil | MMSDEPPALMNGSVIPVIGSRATTTPMLRKACRHSQ |
| Ga0311364_115254472 | 3300031521 | Fen | MAAKLTTSDEPPAETNGKVIPVTGTTASTTPMLMRAWKMIQAVIPAAIN |
| Ga0302321_1009859521 | 3300031726 | Fen | MDSKIPIAAKLTMSDEPPAETNGSVIPVTGTTLTTTPMLMRAWKAIQAV |
| Ga0318501_105171042 | 3300031736 | Soil | VRVIASDDPPALTNGSVMPVTGTRATTTPMLMKAWMQIQAVMPA |
| Ga0307413_102027891 | 3300031824 | Rhizosphere | VSDEPPALTNGSVIPVTGMSATTTPMLMNAWMQSQAVIPA |
| Ga0302322_1021169462 | 3300031902 | Fen | MSDEPPAETKGSVIPVTGSSATTTPMLMNAWTHSQAVTPAAR |
| Ga0307407_102628302 | 3300031903 | Rhizosphere | MPIAARLMVSADPPALMNGRGMPVTGMSAVTTIMFTHAWTTSQVVMPQ |
| Ga0307407_109216202 | 3300031903 | Rhizosphere | MPTAAKLMMSDEPPALMNGKVMPVIGMRVTTTPMLMNACRHSQPV |
| Ga0310900_102625511 | 3300031908 | Soil | MVSAEPPALMNGSGMPVTGMSAVTTIMLMNAWATSQVVMPHATSP |
| Ga0310891_103076131 | 3300031913 | Soil | MVSAEPPALMNGSGMPVTGMSAVTTIMLMNAWATSQVV |
| Ga0311367_108328771 | 3300031918 | Fen | MMRDDPPALMNGSVIPVIGRSATTTPMLMNAWRQIQAVIPAASS |
| Ga0311367_119928972 | 3300031918 | Fen | MPTATKLTTSDEPPALTNGSVIPVTGMSETTTPMLMNAWTH |
| Ga0214473_117805181 | 3300031949 | Soil | MMSDEPPALMNGSVIPVIGRSPTTTPMLRNACRQSQAVMPAASN |
| Ga0307416_1010188502 | 3300032002 | Rhizosphere | MMSDEPPALMNGSVIPVIGSSATTTPMLRNACRQSQAVIPAASNAPKVSGAA |
| Ga0307416_1035923511 | 3300032002 | Rhizosphere | MPTAAKLMMSDEPPALMNGNVMPVIGMRVTTTPMLMNACR |
| Ga0307414_108522141 | 3300032004 | Rhizosphere | MPTAAKLMMSDEPPALMNGNVMPVIGMRVTTTPMLMNACRHSQPVIP |
| Ga0315281_120676851 | 3300032163 | Sediment | MMRDEPPALMNGSVIPVIGRSATTTPMLMNAWKHSQVVIPAASSAP |
| Ga0315275_119117921 | 3300032401 | Sediment | MMRDEPPALMNGSVIPVIGRSATTTPMLMNAWKHSQAVIPAASS |
| Ga0335080_113598611 | 3300032828 | Soil | MERRTPTAARLTVSDEPPAETNGSVIPVTGMTATTTPMLMNAWKQIHV |
| Ga0335071_105196952 | 3300032897 | Soil | MDRSIPTAARLTVREDPPADTNGSVMPVTGTRATTTPMLMSAWKHI |
| Ga0316621_115881832 | 3300033488 | Soil | MPTATKLTTSDEPPALTNGSVIPVTGMRETTTPMLMKAWTQIQVV |
| Ga0247829_114552602 | 3300033550 | Soil | MPTAAKLMMSDEPPALMNGSVIPVIGTRVTTTPILM |
| Ga0334844_072803_47_175 | 3300033743 | Soil | MERRIPMAARLTVNDEPPAETKGSVMPVTGTTATTTPILISA |
| Ga0364940_0078452_795_914 | 3300034164 | Sediment | MPTAARLMVRDEPPALMNGRVMPVTGMSATTTPMLMNAWM |
| Ga0364932_0061977_1_111 | 3300034177 | Sediment | MPTAAKLMMSDDPPALMNGSVIPVTGRSDTTTPMLTN |
| Ga0364934_0233420_1_150 | 3300034178 | Sediment | MMSDEPPALMNGRVIPVTGRSATTTPMLTNAWRQSQAVIPTASRAPNVSG |
| Ga0373905_068517_2_127 | 3300034414 | Sediment Slurry | MPTAAKLMMSDEPPALMNGSVIPVTGRSETTTPMLMNAWRLI |
| ⦗Top⦘ |