NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F045952

Metagenome Family F045952

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F045952
Family Type Metagenome
Number of Sequences 152
Average Sequence Length 44 residues
Representative Sequence MPTAARLMVSDEPPALMNGSVMPVTGMSATTTPMLMNAWMQSQAV
Number of Associated Samples 145
Number of Associated Scaffolds 152

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 63.82 %
% of genes near scaffold ends (potentially truncated) 94.08 %
% of genes from short scaffolds (< 2000 bps) 96.05 %
Associated GOLD sequencing projects 141
AlphaFold2 3D model prediction Yes
3D model pTM-score0.28

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.342 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(17.763 % of family members)
Environment Ontology (ENVO) Unclassified
(27.632 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(36.842 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: No Secondary Structure distribution: α-helix: 17.81%    β-sheet: 0.00%    Coil/Unstructured: 82.19%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.28
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 152 Family Scaffolds
PF03033Glyco_transf_28 82.24
PF04101Glyco_tran_28_C 13.82
PF08478POTRA_1 0.66
PF01565FAD_binding_4 0.66
PF01098FTSW_RODA_SPOVE 0.66
PF01820Dala_Dala_lig_N 0.66
PF13472Lipase_GDSL_2 0.66

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 152 Family Scaffolds
COG0772Peptodoglycan polymerase FtsW/RodA/SpoVECell cycle control, cell division, chromosome partitioning [D] 0.66
COG1181D-alanine-D-alanine ligase or related ATP-grasp enzymeCell wall/membrane/envelope biogenesis [M] 0.66
COG1589Cell division septal protein FtsQCell cycle control, cell division, chromosome partitioning [D] 0.66
COG4775Outer membrane protein assembly factor BamACell wall/membrane/envelope biogenesis [M] 0.66


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.34 %
UnclassifiedrootN/A0.66 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908016|OU_2_1_1_newblercontig97955All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium626Open in IMG/M
3300001213|JGIcombinedJ13530_100339402All Organisms → cellular organisms → Bacteria → Terrabacteria group1387Open in IMG/M
3300003991|Ga0055461_10212454All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi526Open in IMG/M
3300003996|Ga0055467_10171724All Organisms → cellular organisms → Bacteria → Terrabacteria group658Open in IMG/M
3300004003|Ga0055445_10316724All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi542Open in IMG/M
3300004156|Ga0062589_101540175All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium656Open in IMG/M
3300004463|Ga0063356_105122820All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae563Open in IMG/M
3300004643|Ga0062591_102396863All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300004779|Ga0062380_10391493All Organisms → cellular organisms → Bacteria → Terrabacteria group603Open in IMG/M
3300005093|Ga0062594_100886932All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium840Open in IMG/M
3300005164|Ga0066815_10124262All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium504Open in IMG/M
3300005336|Ga0070680_101865575All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae521Open in IMG/M
3300005468|Ga0070707_100199407All Organisms → cellular organisms → Bacteria1951Open in IMG/M
3300005535|Ga0070684_101595614All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium615Open in IMG/M
3300005536|Ga0070697_101015225All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium738Open in IMG/M
3300005549|Ga0070704_101149189All Organisms → cellular organisms → Bacteria → Terrabacteria group707Open in IMG/M
3300005578|Ga0068854_102212589All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300005719|Ga0068861_102482491All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium522Open in IMG/M
3300005841|Ga0068863_102368321All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi541Open in IMG/M
3300005842|Ga0068858_101389667All Organisms → cellular organisms → Bacteria691Open in IMG/M
3300005843|Ga0068860_100392453All Organisms → cellular organisms → Bacteria1372Open in IMG/M
3300006046|Ga0066652_100848605All Organisms → cellular organisms → Bacteria873Open in IMG/M
3300006173|Ga0070716_100828456All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium719Open in IMG/M
3300006358|Ga0068871_101880669All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium569Open in IMG/M
3300006796|Ga0066665_11517101All Organisms → cellular organisms → Bacteria → Terrabacteria group524Open in IMG/M
3300006854|Ga0075425_100779566All Organisms → cellular organisms → Bacteria → Terrabacteria group1096Open in IMG/M
3300006864|Ga0066797_1195131All Organisms → cellular organisms → Bacteria → Terrabacteria group707Open in IMG/M
3300007004|Ga0079218_13465006All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300009093|Ga0105240_11551651All Organisms → cellular organisms → Bacteria → Terrabacteria group694Open in IMG/M
3300009111|Ga0115026_11149354All Organisms → cellular organisms → Bacteria → Terrabacteria group629Open in IMG/M
3300009131|Ga0115027_11641952All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi532Open in IMG/M
3300009177|Ga0105248_12324911All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium610Open in IMG/M
3300009649|Ga0105855_1276753All Organisms → cellular organisms → Bacteria → Terrabacteria group527Open in IMG/M
3300009700|Ga0116217_10412666All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium856Open in IMG/M
3300010044|Ga0126310_10552028All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium851Open in IMG/M
3300010047|Ga0126382_11126594All Organisms → cellular organisms → Bacteria → Terrabacteria group697Open in IMG/M
3300010401|Ga0134121_10634407All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1004Open in IMG/M
3300010403|Ga0134123_11437945All Organisms → cellular organisms → Bacteria → Terrabacteria group731Open in IMG/M
3300011414|Ga0137442_1049462All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium845Open in IMG/M
3300011432|Ga0137428_1128110All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium736Open in IMG/M
3300012004|Ga0120134_1117503All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium504Open in IMG/M
3300012041|Ga0137430_1246770All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium509Open in IMG/M
3300012091|Ga0136625_1243142All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium609Open in IMG/M
3300012199|Ga0137383_11093329All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium577Open in IMG/M
3300012208|Ga0137376_10068843All Organisms → cellular organisms → Bacteria2939Open in IMG/M
3300012351|Ga0137386_11263582All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium514Open in IMG/M
3300012362|Ga0137361_10553833All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1055Open in IMG/M
3300012681|Ga0136613_10712325All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium536Open in IMG/M
3300012684|Ga0136614_10944552All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium595Open in IMG/M
3300012986|Ga0164304_11416974All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium571Open in IMG/M
3300012989|Ga0164305_11856603All Organisms → cellular organisms → Bacteria → Terrabacteria group546Open in IMG/M
3300014315|Ga0075350_1102115All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi680Open in IMG/M
3300014490|Ga0182010_10027854All Organisms → cellular organisms → Bacteria → Terrabacteria group2605Open in IMG/M
3300014494|Ga0182017_10028809All Organisms → cellular organisms → Bacteria3787Open in IMG/M
3300014496|Ga0182011_10039704All Organisms → cellular organisms → Bacteria3358Open in IMG/M
3300014498|Ga0182019_11104547All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium579Open in IMG/M
3300015371|Ga0132258_12947942All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1181Open in IMG/M
3300017789|Ga0136617_11008895All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium631Open in IMG/M
3300017944|Ga0187786_10336791All Organisms → cellular organisms → Bacteria → Terrabacteria group633Open in IMG/M
3300018058|Ga0187766_11390274All Organisms → cellular organisms → Bacteria → Terrabacteria group515Open in IMG/M
3300018060|Ga0187765_11280537All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium518Open in IMG/M
3300018071|Ga0184618_10407387All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium575Open in IMG/M
3300018075|Ga0184632_10253459All Organisms → cellular organisms → Bacteria → Terrabacteria group768Open in IMG/M
3300018429|Ga0190272_10958107All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium811Open in IMG/M
3300018432|Ga0190275_10692419All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1075Open in IMG/M
3300018465|Ga0190269_11155873All Organisms → cellular organisms → Bacteria → Terrabacteria group603Open in IMG/M
3300018466|Ga0190268_10218043All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1061Open in IMG/M
3300018466|Ga0190268_11846441All Organisms → cellular organisms → Bacteria → Terrabacteria group547Open in IMG/M
3300018469|Ga0190270_12829249All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium548Open in IMG/M
3300018920|Ga0190273_12226200All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium516Open in IMG/M
3300019377|Ga0190264_10420036All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium877Open in IMG/M
3300019377|Ga0190264_10974263All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium674Open in IMG/M
3300019785|Ga0182022_1146625All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium741Open in IMG/M
3300019785|Ga0182022_1174902Not Available1728Open in IMG/M
3300020006|Ga0193735_1165735All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium558Open in IMG/M
3300021344|Ga0193719_10367965All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium596Open in IMG/M
3300022534|Ga0224452_1131410All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium770Open in IMG/M
3300022694|Ga0222623_10022460All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi2364Open in IMG/M
3300022756|Ga0222622_11457107All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium504Open in IMG/M
3300022898|Ga0247745_1098803All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium503Open in IMG/M
3300025155|Ga0209320_10181805All Organisms → cellular organisms → Bacteria → Terrabacteria group921Open in IMG/M
3300025165|Ga0209108_10382981All Organisms → cellular organisms → Bacteria → Terrabacteria group692Open in IMG/M
3300025846|Ga0209538_1270592All Organisms → cellular organisms → Bacteria → Terrabacteria group608Open in IMG/M
3300025865|Ga0209226_10367952All Organisms → cellular organisms → Bacteria → Terrabacteria group589Open in IMG/M
3300025885|Ga0207653_10027626All Organisms → cellular organisms → Bacteria → Terrabacteria group1822Open in IMG/M
3300025913|Ga0207695_11735313All Organisms → cellular organisms → Bacteria → Terrabacteria group505Open in IMG/M
3300025916|Ga0207663_11357996All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi572Open in IMG/M
3300025918|Ga0207662_10060468All Organisms → cellular organisms → Bacteria2273Open in IMG/M
3300025920|Ga0207649_11336780All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium567Open in IMG/M
3300025932|Ga0207690_10993046All Organisms → cellular organisms → Bacteria → Terrabacteria group698Open in IMG/M
3300025932|Ga0207690_11242252All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium622Open in IMG/M
3300025934|Ga0207686_11536102All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium549Open in IMG/M
3300025944|Ga0207661_12010233All Organisms → cellular organisms → Bacteria → Terrabacteria group524Open in IMG/M
3300026062|Ga0208654_1013584All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1024Open in IMG/M
3300026089|Ga0207648_12008599All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium539Open in IMG/M
3300026118|Ga0207675_102364211All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium544Open in IMG/M
3300026342|Ga0209057_1247815All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium507Open in IMG/M
3300027877|Ga0209293_10090282All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC101364Open in IMG/M
3300028003|Ga0247707_1022863All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium592Open in IMG/M
3300028381|Ga0268264_12706073All Organisms → cellular organisms → Bacteria → Terrabacteria group500Open in IMG/M
3300028556|Ga0265337_1146160All Organisms → cellular organisms → Bacteria → Terrabacteria group640Open in IMG/M
3300028587|Ga0247828_10404623All Organisms → cellular organisms → Bacteria → Terrabacteria group787Open in IMG/M
3300028710|Ga0307322_10102806All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium736Open in IMG/M
3300028712|Ga0307285_10049017All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1050Open in IMG/M
3300028719|Ga0307301_10323050All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium507Open in IMG/M
3300028770|Ga0302258_1099755All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium703Open in IMG/M
3300028799|Ga0307284_10120253All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium996Open in IMG/M
3300028807|Ga0307305_10523047All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium531Open in IMG/M
3300028828|Ga0307312_10375182All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium932Open in IMG/M
3300028861|Ga0302259_1051605All Organisms → cellular organisms → Bacteria → Terrabacteria group972Open in IMG/M
3300028865|Ga0302291_10103344All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium949Open in IMG/M
3300028872|Ga0307314_10192719All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium610Open in IMG/M
3300028876|Ga0307286_10424938All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium500Open in IMG/M
3300028878|Ga0307278_10317263All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi688Open in IMG/M
3300028880|Ga0307300_10258931All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium579Open in IMG/M
3300028881|Ga0307277_10187972All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium903Open in IMG/M
3300029804|Ga0247696_104286All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium868Open in IMG/M
3300029957|Ga0265324_10246503All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium607Open in IMG/M
3300030000|Ga0311337_11594479All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium573Open in IMG/M
3300030002|Ga0311350_11332911All Organisms → cellular organisms → Bacteria → Terrabacteria group638Open in IMG/M
3300030006|Ga0299907_10779217All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium723Open in IMG/M
3300030010|Ga0302299_10617771All Organisms → cellular organisms → Bacteria → Terrabacteria group536Open in IMG/M
3300030014|Ga0302175_10175899All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium513Open in IMG/M
3300030050|Ga0302255_1066035All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi720Open in IMG/M
3300030673|Ga0302287_10216247All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium559Open in IMG/M
(restricted) 3300031248|Ga0255312_1072051All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium834Open in IMG/M
3300031521|Ga0311364_11525447All Organisms → cellular organisms → Bacteria → Terrabacteria group660Open in IMG/M
3300031726|Ga0302321_100985952All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium959Open in IMG/M
3300031736|Ga0318501_10517104All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium652Open in IMG/M
3300031824|Ga0307413_10202789All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1434Open in IMG/M
3300031902|Ga0302322_102116946All Organisms → cellular organisms → Bacteria → Terrabacteria group692Open in IMG/M
3300031903|Ga0307407_10262830All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1188Open in IMG/M
3300031903|Ga0307407_10921620All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium671Open in IMG/M
3300031908|Ga0310900_10262551All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1250Open in IMG/M
3300031913|Ga0310891_10307613All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium560Open in IMG/M
3300031918|Ga0311367_10832877All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium932Open in IMG/M
3300031918|Ga0311367_11992897All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium560Open in IMG/M
3300031949|Ga0214473_11780518All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi609Open in IMG/M
3300032002|Ga0307416_101018850All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium931Open in IMG/M
3300032002|Ga0307416_103592351All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium519Open in IMG/M
3300032004|Ga0307414_10852214All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium833Open in IMG/M
3300032163|Ga0315281_12067685All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium542Open in IMG/M
3300032401|Ga0315275_11911792All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium627Open in IMG/M
3300032828|Ga0335080_11359861All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium707Open in IMG/M
3300032897|Ga0335071_10519695All Organisms → cellular organisms → Bacteria → Terrabacteria group1143Open in IMG/M
3300033488|Ga0316621_11588183All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium504Open in IMG/M
3300033550|Ga0247829_11455260All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium566Open in IMG/M
3300033743|Ga0334844_072803All Organisms → cellular organisms → Bacteria → Terrabacteria group667Open in IMG/M
3300034164|Ga0364940_0078452All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium914Open in IMG/M
3300034177|Ga0364932_0061977All Organisms → cellular organisms → Bacteria → Terrabacteria group1410Open in IMG/M
3300034178|Ga0364934_0233420All Organisms → cellular organisms → Bacteria → Terrabacteria group697Open in IMG/M
3300034414|Ga0373905_068517All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium566Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil17.76%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen9.21%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen3.95%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.95%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.95%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere3.95%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand2.63%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.63%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland1.97%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.97%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.97%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.97%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.97%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.97%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.97%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment1.97%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.97%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment1.32%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.32%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.32%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil1.32%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.32%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.32%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere1.32%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.66%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.66%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.66%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.66%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.66%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.66%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.66%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.66%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.66%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.66%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.66%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.66%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.66%
Sandy SoilEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil0.66%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.66%
Environmental → Unclassified → Unclassified → Unclassified → Unclassified → 0.66%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.66%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.66%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.66%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.66%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.66%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.66%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.66%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.66%
Sediment SlurryEngineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry0.66%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908016Sample 642EnvironmentalOpen in IMG/M
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300003991Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqB_D1EnvironmentalOpen in IMG/M
3300003996Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2EnvironmentalOpen in IMG/M
3300004003Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWA_D1EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300004779Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3FreshEnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005164Soil and rhizosphere microbial communities from Laval, Canada - mgLACEnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006864Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193EnvironmentalOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009111Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1EnvironmentalOpen in IMG/M
3300009131Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1EnvironmentalOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009649Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-059EnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011414Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT266_2EnvironmentalOpen in IMG/M
3300011432Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT718_2EnvironmentalOpen in IMG/M
3300012004Permafrost microbial communities from Nunavut, Canada - A30_5cm_6MEnvironmentalOpen in IMG/M
3300012041Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT754_2EnvironmentalOpen in IMG/M
3300012091Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ483 (23.06)EnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012681Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ272 (21.06)EnvironmentalOpen in IMG/M
3300012684Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06)EnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300014315Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleC_D1EnvironmentalOpen in IMG/M
3300014490Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaGEnvironmentalOpen in IMG/M
3300014494Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaGEnvironmentalOpen in IMG/M
3300014496Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaGEnvironmentalOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300017789Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06)EnvironmentalOpen in IMG/M
3300017944Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MGEnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018075Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1EnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018920Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 ISEnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300019785Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300020006Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2EnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300022534Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1EnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300022898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S109-311C-5EnvironmentalOpen in IMG/M
3300025155Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 4EnvironmentalOpen in IMG/M
3300025165Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1EnvironmentalOpen in IMG/M
3300025846Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-211 (SPAdes)EnvironmentalOpen in IMG/M
3300025865Arctic peat soil from Barrow, Alaska, USA - Barrow Graham LP Ref core NGADG0011-212 (SPAdes)EnvironmentalOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026062Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026342Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes)EnvironmentalOpen in IMG/M
3300027877Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300028003Soil microbial communities from hillslope of Landscape Evolution Observatory, University of Arizona, Oracle, AZ, United States - 2-2-E_NEnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028556Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaGHost-AssociatedOpen in IMG/M
3300028587Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3EnvironmentalOpen in IMG/M
3300028710Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380EnvironmentalOpen in IMG/M
3300028712Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139EnvironmentalOpen in IMG/M
3300028719Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182EnvironmentalOpen in IMG/M
3300028770Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N2_4EnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028861Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N3_4EnvironmentalOpen in IMG/M
3300028865Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N1_4EnvironmentalOpen in IMG/M
3300028872Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204EnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300028880Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300029804Soil microbial communities from hillslope of Landscape Evolution Observatory, University of Arizona, Oracle, AZ, United States - 4-4-W_NEnvironmentalOpen in IMG/M
3300029957Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaGHost-AssociatedOpen in IMG/M
3300030000I_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300030002II_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300030006Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67EnvironmentalOpen in IMG/M
3300030010Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_4EnvironmentalOpen in IMG/M
3300030014Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N3_3EnvironmentalOpen in IMG/M
3300030050Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E2_4EnvironmentalOpen in IMG/M
3300030673Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E2_4EnvironmentalOpen in IMG/M
3300031248 (restricted)Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5EnvironmentalOpen in IMG/M
3300031521III_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300031726Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031824Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2Host-AssociatedOpen in IMG/M
3300031902Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2EnvironmentalOpen in IMG/M
3300031903Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1Host-AssociatedOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031913Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4EnvironmentalOpen in IMG/M
3300031918III_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300031949Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032004Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3Host-AssociatedOpen in IMG/M
3300032163Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0EnvironmentalOpen in IMG/M
3300032401Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300033488Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_CEnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M
3300033743Peat soil microbial communities from Stordalen Mire, Sweden - 714 E1 5-9EnvironmentalOpen in IMG/M
3300034164Sediment microbial communities from East River floodplain, Colorado, United States - 14_s17EnvironmentalOpen in IMG/M
3300034177Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17EnvironmentalOpen in IMG/M
3300034178Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17EnvironmentalOpen in IMG/M
3300034414Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - B1A4.3EngineeredOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
OU_016499502124908016MPTAARLMVSDEPPALMNGSVMPVTGMSVTTTPMLMNAWMHSQAVIP
JGIcombinedJ13530_10033940213300001213WetlandMSDEPPAETNGRVIPVTGRSVTTTPTFTSAWMQSIAVIPAARSAPKVSGA
Ga0055461_1021245423300003991Natural And Restored WetlandsMPIAAKLMTRLDPPAETNGSGMPVTGMRLTTTPMLMNAWRQIQAVM
Ga0055467_1017172423300003996Natural And Restored WetlandsMESRMPAAAKLTSSDEPPALMNGSVMPVTGSSATTTAMLMNA*
Ga0055445_1031672423300004003Natural And Restored WetlandsMISDEPPAETNGSGIPVTGIKPTTTATLMNAWMQIQEVMPAASRAPKVSG
Ga0062589_10154017523300004156SoilMAAKLMISDEPPALRKGSVMPVIGTSVTTTAMLMNAWMHSQ
Ga0063356_10512282013300004463Arabidopsis Thaliana RhizosphereMPTAARLIVSDEPPALMNGSVTPVTGMRVTTTPMLMNAWMHSQPVIPAARR
Ga0062591_10239686323300004643SoilMRDEPPALMNGSVIPVIGSSATTTPMLMNAWRHSQAVIPA
Ga0062380_1039149313300004779Wetland SedimentMMSDEPPALMNGRVIPVTGRSATTTPMLMNAWRQSQAVIPTASRDPNVSG
Ga0062594_10088693213300005093SoilMPTAAKLMMSDEPPALMNGSVMPVIGTRVTTTPMLMNAWR
Ga0066815_1012426213300005164SoilMPTAARLMVSDDPPALMNGRVMPVTGMSATTTPMLMKAWMHS
Ga0070680_10186557513300005336Corn RhizosphereMPTAARLMVSDEPPALMNGSVTPVTGMSVTTTPMLMKAWMQSQPVIPAASSAP
Ga0070707_10019940713300005468Corn, Switchgrass And Miscanthus RhizosphereMPTAAKLTTSDEPPALMNGRVMPVTGTSATTTAMLMNACRQSQAVIP
Ga0070684_10159561423300005535Corn RhizosphereMPTEAKLTRSDEFPELTKGSVMPVSGSSWSTTPMLMNAWKAMHAEM
Ga0070697_10101522513300005536Corn, Switchgrass And Miscanthus RhizosphereMMSDEPPALMNSSVIPVIGSRATTTPILRNAWRHSQAVIP
Ga0070704_10114918913300005549Corn, Switchgrass And Miscanthus RhizosphereMDSSTPAAAKLTRSDEPPALMNGSVMPVTGSSATTTATLMNAWKHSQAV
Ga0068854_10221258923300005578Corn RhizosphereMPTAARLMVSDDPPALMNGRVMPVTGMSATTTPMLMNAWMQSQAVMPAA
Ga0068861_10248249123300005719Switchgrass RhizosphereMVSDEPPALMNGNVMPVTGIRATTTPMLMNAWMHSQAVMPAASS
Ga0068863_10236832113300005841Switchgrass RhizosphereMPIAAKLITSDEPPADTNGSGMPVTGISPTTTAMLMNA*
Ga0068858_10138966713300005842Switchgrass RhizosphereMPTAARLMSSDEPPALMNGSVMPVTGMSTTTTPMLMNAWMQSQ
Ga0068860_10039245323300005843Switchgrass RhizosphereMPTAARLMVSDEPPALMNGRVMPVTGMSATTTPMLMNAWMQSQAVIPA
Ga0066652_10084860513300006046SoilMPTAARLMVSDEPPALMNGSVMPVTGMSATTTPMLMNAWMQSQAVIPAA
Ga0070716_10082845613300006173Corn, Switchgrass And Miscanthus RhizosphereMPTAARLMVSDEPPALMNGSVMPVTGMSATTTPMLMKA
Ga0068871_10188066923300006358Miscanthus RhizosphereMMSDDPPALMNGSVIPVIGSRATTTPMLMNAWRHSQA
Ga0066665_1151710123300006796SoilMISDEPPALMNGNVMPVIGSRATTTPTLMNACTHSHVV
Ga0075425_10077956623300006854Populus RhizosphereMPTAVSVIASDDPPALTNGSVIPVTGTRPTTTPMLMKAWMQ
Ga0066797_119513113300006864SoilMPTAARLTMSDEPPAETNGSVIPVTGSSVTTTPMLTNAWTHR*
Ga0079218_1346500623300007004Agricultural SoilVSDEPPALTNGSVIPVTGMSATTTPMLMNAWMQSQAVIPAASSAPNVSG
Ga0105240_1155165123300009093Corn RhizosphereMDSSTPAAAKLTRSDEPPALMNGSVMPVTGSSATTTATLMNAWKHSQAVMPAA
Ga0115026_1114935413300009111WetlandMPTATKLTTSDEPPALTNGSVIPVTGMRETTTPMLMKAWTQIQVVM
Ga0115027_1164195213300009131WetlandMPTAAKLMISDDPPAETNGSGMPVTGISPTTTAMLMNAWMQIQAVMPAASRA
Ga0105248_1232491123300009177Switchgrass RhizosphereMISDDPPAEMKGSVMPVIGTTATTTPMLMKACTHSQVV
Ga0105855_127675313300009649Permafrost SoilMESRIPTAAKLTTSDEPPALTNGSVMPVMGSRFTTTP
Ga0116217_1041266623300009700Peatlands SoilMPTAAKLIVSDEPPALTNGSVMPVIGSRATTTPMLMNAWTQSQVVMPAASKA
Ga0126310_1055202823300010044Serpentine SoilMARSTPTAAKLTTSDEPPALMNGSVIPVTGTSATTTPMLTKAWMHS
Ga0126382_1112659413300010047Tropical Forest SoilMPMAAKLITSDEPPADTNGSGIPVTGISPTTTAMLMNAWR
Ga0134121_1063440713300010401Terrestrial SoilMDSSTPAAAKLTRSEEPPALMNGSVMPVTGSSATTTATLMNAWKHSQAVMPAASR
Ga0134123_1143794523300010403Terrestrial SoilMDKSTPAAAKLTSSEEPPALMNGSVMPVTGSRATTTAMLM
Ga0137442_104946213300011414SoilMSDEPPAETNGSVIPVTGSRVTTTPMLMKAWMHRYAVSPAASSAPK
Ga0137428_112811023300011432SoilMTSDDPPALMNGSVMPVTGISTTTTPMLMKAWMQSQAVIPAASSAP
Ga0120134_111750313300012004PermafrostMMSDEPPALMNGRVIPVIGRSATTTPMFTNAWMHSQAVIPAASR
Ga0137430_124677013300012041SoilMTSDDPPALMNGSVMPVTGISTTTTPMLMNAWMQSHAVIPAASSAPK
Ga0136625_124314213300012091Polar Desert SandMPTATRLMVNAEPPALTNGRGMPVTGMSAVTTIML
Ga0137383_1109332923300012199Vadose Zone SoilMDSRIPAAARLIERLDPPANTNGSVMPVIGTSATTTAMLMNAWMHN
Ga0137376_1006884313300012208Vadose Zone SoilMDSRIPAAAKLTRSEEPPALMNGSVIPVTGSRASTTAMLMNAWKHSQAVIPAA
Ga0137386_1126358223300012351Vadose Zone SoilMPTAARLMVSDDPPALMNGRVMPVTGMSATTTPMLMNAWMHSQ
Ga0137361_1055383323300012362Vadose Zone SoilMPTAARLMVSDDPPALMNGSVMPVTGMSATTTPMLMNAWMQSQAVIP
Ga0136613_1071232513300012681Polar Desert SandMPTAARLMVSADPPALMNGSGMPVTGMSAVTTIMLMSAWTTSQVVMPQ
Ga0136614_1094455213300012684Polar Desert SandMVSAEPPALMNGSGMPVTGRSAVTTIMLTRAWTTSQ
Ga0164304_1141697423300012986SoilMPTAARLMVSDEPPALMNGSVMPVTGMSVTTTPMLMNAWMHSQAVIPAA
Ga0164305_1185660313300012989SoilMDSSTPAAAKLTRSDEPPALMNGSVMPVTGSSATTTATLM
Ga0075350_110211523300014315Natural And Restored WetlandsMPTAAKLMISDDPPAETNGSGMPVTGISPTTTAMLMNAWMQIQAVMPAAS
Ga0182010_1002785413300014490FenMESRIPTAARLTVSDEPPADTNGSVMPVTGTTVTTTP
Ga0182017_1002880913300014494FenMERRIPMAARLTVNDEPPAETKGSVMPVTGTTATTTP
Ga0182011_1003970443300014496FenMPAATRLTMSDEPPAETNGNVIPVTGSSATTTPMLTKAWTHRYAVIPAASSAP
Ga0182019_1110454723300014498FenMESKIPTAARLTVSDEPPADTNGSVMPVTGTTATTTPMLINA*
Ga0132258_1294794213300015371Arabidopsis RhizosphereMPTAARLMVSDEPPALMNGSVMPVTGMSATTTPMLMKAWMQSQAVI
Ga0136617_1100889513300017789Polar Desert SandMMSDEPPALMNGRVMPVTGRMATTTATLMKAWMQSQAVIPAARSAP
Ga0187786_1033679123300017944Tropical PeatlandMPTAAKLIVSDDPPALMNGSVMPVIGRSATTTPMLMSAWNVSQAVMPA
Ga0187766_1139027423300018058Tropical PeatlandMDSRTPTAAKLTTSDEPPWDTNGSVMPVTGSSARTTA
Ga0187765_1128053713300018060Tropical PeatlandMTSDEPPAETNGSGMPVTGIRPTTTPMLMNAWRQIQPVTPAASSAPK
Ga0184618_1040738723300018071Groundwater SedimentMPTAARLMVSDEPPALMNGSVMPVTGMSATTTPILMNAWMQSQAVMPAAS
Ga0184632_1025345923300018075Groundwater SedimentMPIAAKLTMSDEPPALMNGRVMPVTGRSATTTAILITAWTVSQPVI
Ga0190272_1095810723300018429SoilMMSDEPPALMNGSVIPVIGRSATTTPMLRNACRQSQAVIPAASSPPNVSGA
Ga0190275_1069241913300018432SoilMPIAARLMVSADPPALMNGSGMPVTGSSAVTTIMLMQACTTSQ
Ga0190269_1115587313300018465SoilMPTAAKLMIRLDPPAETNGSGMPVTGMRPTTTPMLMKAW
Ga0190268_1021804313300018466SoilMPTAARLMVSAEPPALMNGSGMPVTGRSAVTTIMLMRACTASHVVMPQAS
Ga0190268_1184644113300018466SoilMPAAAKLTTSDTPPALTNGSVIPVTGTSATTTAML
Ga0190270_1282924913300018469SoilMMRDEPPALMNGNVIPVIGSSATTTPMLMNACRHSHAVIP
Ga0190273_1222620013300018920SoilMPTAARLMVSDEPPALMNGSVMPVTGMSATTTPMLMNAWMQSQAV
Ga0190264_1042003613300019377SoilMVSAEPPALMNGSGMPVTGRSAVTTIMLMRECMASQVV
Ga0190264_1097426313300019377SoilMMSEEPPALMNGRVMPVTGSRATTTAMLMNAWMHSQAVMPAASSAPNV
Ga0182022_114662523300019785FenMPTAARLTMSDEPPAETNGSVIPVTGSSVTTTPMFTNAWTQR
Ga0182022_117490223300019785FenMAARLTVNDEPPAETKGSVMPVTGTTATTTPILISA
Ga0193735_116573523300020006SoilMPTAARLMVSDDPPALMNGSVMPVTGMRVTTTPMLMNAWMHSQAVIPAARSAPN
Ga0193719_1036796523300021344SoilMPTAVSVIASDEPPALTNGSVMPVTGTRPTTTPMLM
Ga0224452_113141013300022534Groundwater SedimentMPTAARLMVSDEPPALMNGSVMPVTGIRATTTPMLMKAWMQSHAVIP
Ga0222623_1002246033300022694Groundwater SedimentMPTAARLMVSDEPPALMNGRVMPVTGMSVTTTPILMNAW
Ga0222622_1145710713300022756Groundwater SedimentMPTAARLMVSDDPPALMNGNVMPVTGISATTTPMLMNAWMHSQAVIPAA
Ga0247745_109880313300022898SoilMPTAARLISSDEPPALMNGSVMPVTGISTTTTPMLMNAWMQSQ
Ga0209320_1018180513300025155SoilMPTAARLTVSEEPPALTNGNVIPVTGSSETTTPMLTNAWTVMKT
Ga0209108_1038298113300025165SoilMISDDPPALMNGSVIPVTGRRATTTPRLMNAWMHSQ
Ga0209538_127059213300025846Arctic Peat SoilMAAKLTTSDEPPAETNGRVMPVTGTTASTTPMLMRAWKMIQAVI
Ga0209226_1036795223300025865Arctic Peat SoilMAAKLTTSDEPPAETNGRVMPVTGTTASTTPMLMRAWKMIQAVIPAAVK
Ga0207653_1002762613300025885Corn, Switchgrass And Miscanthus RhizosphereMDSSTPAAAKLTRSDEPPALMNGSVMPVTGSSATTTAMLTNAWKHSHA
Ga0207695_1173531313300025913Corn RhizosphereMPAAAKLTSRDEPPALMNGSVMPVTGSRATTTAMLMNAWKHSQAVIPVA
Ga0207663_1135799613300025916Corn, Switchgrass And Miscanthus RhizosphereMISDDPPAEMKGSVMPVIGTTATTTPMLMNACTHSQVVIPAASS
Ga0207662_1006046813300025918Switchgrass RhizosphereMPTAARLMVSDEPPALMNGRVMPVTGMRATTTPMLMNA
Ga0207649_1133678013300025920Corn RhizosphereMPTAAKLMMSDEPPALMNGSVMPVIGTRVTTTPMLMNAWRHS
Ga0207690_1099304623300025932Corn RhizosphereMDSSTPAAAKLTSSEEPPALMNGSVMPVTGSRATTTATLMKAWKQSQAV
Ga0207690_1124225213300025932Corn RhizosphereMMSDDPPALMNGSVIPVIGSSATTTPMLMKAWRHSQAVIP
Ga0207686_1153610223300025934Miscanthus RhizosphereMMRDEPPALMNGSVIPVIGSRATTTPMLMKAWRHSQAVIPAA
Ga0207661_1201023323300025944Corn RhizosphereMESRIPAAAKLTSSDEPPALMNGSVMPVTGSSATTTAMLMNA
Ga0208654_101358413300026062Natural And Restored WetlandsMPTAAKLMMSDEPPALMNGNVMPVIGMRVTTTPMLMNACRHSQPVIPAAS
Ga0207648_1200859923300026089Miscanthus RhizosphereMMSDDPPALMNGRVIPVIGSSATTTPMLMNAWRQSQAVMPAANSA
Ga0207675_10236421113300026118Switchgrass RhizosphereMPTAAKLMMSDEPPALMNGSVIPVIGTRVTTTPMLMNACRHSQPVIP
Ga0209057_124781513300026342SoilMPTAARLMVSDDPPALMNGRVMPVTGMSATTTPMLMNAWMHSQAVI
Ga0209293_1009028213300027877WetlandMPTATKLTTSDEPPALTNGSVIPVTGMRETTTPMLMKAW
Ga0247707_102286323300028003SoilMPTAARLMVSAEPPALMNGSGMPVTGMSAVTTMMLTNACPTSHVVMP
Ga0268264_1270607323300028381Switchgrass RhizosphereMPTAAKLTTSDEPPALMNGSVMPVTGSSATTTAMLMKACRKSQAVIPAARSA
Ga0265337_114616013300028556RhizosphereMESRIPTAARLTVNDEPPAETNGSVIPVTGTTATTTPTLISAWKH
Ga0247828_1040462313300028587SoilMPTAAKLTSSDEFPELTNGSVMPVSGTSCSTTAMLM
Ga0307322_1010280613300028710SoilMPTAARLIVSDDPPALMNGNVMPVTGISVTTTPMLMNAWM
Ga0307285_1004901713300028712SoilMMSDDPPALMNGSVMPVIGSRATTTPMLMNAWRHSQAVIPAASSAPNVS
Ga0307301_1032305013300028719SoilVSVIASDDPPALTNGSVIPVTGSNATTTPMLMNACTQIQAVIPA
Ga0302258_109975513300028770FenMMSDEPPALMNGRVIPVIGRIVTTTPMLMIACRHSQAVIPAAMSAP
Ga0307284_1012025323300028799SoilMPTAARLMVSDDPPALMNGSVIPVTGMSVTTTPMLMNAWM
Ga0307305_1052304713300028807SoilMPTAARLMVSDDPPALMNGSVMPVTGMSATTTPMLMNAWMHSQAVMPAASSAPN
Ga0307312_1037518213300028828SoilMPTAARLMVSDEPPALMNGSVMPVTGIRATTTPMLMKAWMQSHAVMPAASSA
Ga0302259_105160513300028861FenMPTAAKLMMSDDPPAETNGSGMPVTGISPTTTDML
Ga0302291_1010334423300028865FenMMSDEPPALMNGRVIPVIGRIVTTTPMLMIACRHSQA
Ga0307314_1019271913300028872SoilMPTAARLMVSDDPPALMNGSVMPVTGMRVTTTPMLMNAWMHSQAV
Ga0307286_1042493823300028876SoilMPTAARLMVSDEPPALMNGRVMPVTGMSVTTTPILMNAWMHSQAVIPAARS
Ga0307278_1031726323300028878SoilMMSDEPPALMNGSVIPVTGRSAATTPTLTNACRHSQAVMPAARSAPNVSGA
Ga0307300_1025893113300028880SoilMPTAARLMVSDEPPALMNGSVMPVTGIRATTTPMLMKAWMQSHAVMPAASNAPN
Ga0307277_1018797223300028881SoilMESRIPTAAKLTTSDEPPALMNGSVMPVTGSSATTTAMLTN
Ga0247696_10428613300029804SoilMKLTTSDEPPALTNGRVMPVIGSRTTTTPMLMKACSTSQAVMPAASRAPK
Ga0265324_1024650323300029957RhizosphereMDNRIPTAARLIESDEPPALMNGRVIPVIGIRATTTPM
Ga0311337_1159447913300030000FenVIASDDPPALTNGRVIPVTGTSATTTPMLMNAWIQIQAVMPAA
Ga0311350_1133291113300030002FenMPTAARLTMSDEPPAETNGSVIPVTGSRVTTTPMFTNACTHR
Ga0299907_1077921723300030006SoilMVSAEPPALMNGRGMPVTGRSAVTTIMLMQAWTTSQVVMP
Ga0302299_1061777123300030010FenMAAKLTMSDEPPAETNGKVIPVTGTTLTTTPMLMRA
Ga0302175_1017589913300030014FenVPPAETNGSVIPVTGTIATTTPMLINAWKHIQAVMPAATR
Ga0302255_106603513300030050FenMPTAAKLMIRLDPPAETNGSGMPVTGMSPTTTAMLMNAWRQIQA
Ga0302287_1021624723300030673FenMPTAARVTVSDDPPADTNGSVMPVTGTTATTTPMLMSAWKHIQAVMP
(restricted) Ga0255312_107205123300031248Sandy SoilMMSDEPPALMNGSVIPVIGSRATTTPMLRKACRHSQ
Ga0311364_1152544723300031521FenMAAKLTTSDEPPAETNGKVIPVTGTTASTTPMLMRAWKMIQAVIPAAIN
Ga0302321_10098595213300031726FenMDSKIPIAAKLTMSDEPPAETNGSVIPVTGTTLTTTPMLMRAWKAIQAV
Ga0318501_1051710423300031736SoilVRVIASDDPPALTNGSVMPVTGTRATTTPMLMKAWMQIQAVMPA
Ga0307413_1020278913300031824RhizosphereVSDEPPALTNGSVIPVTGMSATTTPMLMNAWMQSQAVIPA
Ga0302322_10211694623300031902FenMSDEPPAETKGSVIPVTGSSATTTPMLMNAWTHSQAVTPAAR
Ga0307407_1026283023300031903RhizosphereMPIAARLMVSADPPALMNGRGMPVTGMSAVTTIMFTHAWTTSQVVMPQ
Ga0307407_1092162023300031903RhizosphereMPTAAKLMMSDEPPALMNGKVMPVIGMRVTTTPMLMNACRHSQPV
Ga0310900_1026255113300031908SoilMVSAEPPALMNGSGMPVTGMSAVTTIMLMNAWATSQVVMPHATSP
Ga0310891_1030761313300031913SoilMVSAEPPALMNGSGMPVTGMSAVTTIMLMNAWATSQVV
Ga0311367_1083287713300031918FenMMRDDPPALMNGSVIPVIGRSATTTPMLMNAWRQIQAVIPAASS
Ga0311367_1199289723300031918FenMPTATKLTTSDEPPALTNGSVIPVTGMSETTTPMLMNAWTH
Ga0214473_1178051813300031949SoilMMSDEPPALMNGSVIPVIGRSPTTTPMLRNACRQSQAVMPAASN
Ga0307416_10101885023300032002RhizosphereMMSDEPPALMNGSVIPVIGSSATTTPMLRNACRQSQAVIPAASNAPKVSGAA
Ga0307416_10359235113300032002RhizosphereMPTAAKLMMSDEPPALMNGNVMPVIGMRVTTTPMLMNACR
Ga0307414_1085221413300032004RhizosphereMPTAAKLMMSDEPPALMNGNVMPVIGMRVTTTPMLMNACRHSQPVIP
Ga0315281_1206768513300032163SedimentMMRDEPPALMNGSVIPVIGRSATTTPMLMNAWKHSQVVIPAASSAP
Ga0315275_1191179213300032401SedimentMMRDEPPALMNGSVIPVIGRSATTTPMLMNAWKHSQAVIPAASS
Ga0335080_1135986113300032828SoilMERRTPTAARLTVSDEPPAETNGSVIPVTGMTATTTPMLMNAWKQIHV
Ga0335071_1051969523300032897SoilMDRSIPTAARLTVREDPPADTNGSVMPVTGTRATTTPMLMSAWKHI
Ga0316621_1158818323300033488SoilMPTATKLTTSDEPPALTNGSVIPVTGMRETTTPMLMKAWTQIQVV
Ga0247829_1145526023300033550SoilMPTAAKLMMSDEPPALMNGSVIPVIGTRVTTTPILM
Ga0334844_072803_47_1753300033743SoilMERRIPMAARLTVNDEPPAETKGSVMPVTGTTATTTPILISA
Ga0364940_0078452_795_9143300034164SedimentMPTAARLMVRDEPPALMNGRVMPVTGMSATTTPMLMNAWM
Ga0364932_0061977_1_1113300034177SedimentMPTAAKLMMSDDPPALMNGSVIPVTGRSDTTTPMLTN
Ga0364934_0233420_1_1503300034178SedimentMMSDEPPALMNGRVIPVTGRSATTTPMLTNAWRQSQAVIPTASRAPNVSG
Ga0373905_068517_2_1273300034414Sediment SlurryMPTAAKLMMSDEPPALMNGSVIPVTGRSETTTPMLMNAWRLI


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.