| Basic Information | |
|---|---|
| Family ID | F045792 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 152 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MENAKIFAENVIRNRKEAINLRRFGVKMGALAAKLESAHRTQ |
| Number of Associated Samples | 124 |
| Number of Associated Scaffolds | 152 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Eukaryota |
| % of genes with valid RBS motifs | 38.93 % |
| % of genes near scaffold ends (potentially truncated) | 16.45 % |
| % of genes from short scaffolds (< 2000 bps) | 86.18 % |
| Associated GOLD sequencing projects | 116 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Eukaryota (72.368 % of family members) |
| NCBI Taxonomy ID | 2759 |
| Taxonomy | All Organisms → cellular organisms → Eukaryota |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine (22.368 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.526 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (50.658 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 57.14% β-sheet: 0.00% Coil/Unstructured: 42.86% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 72.37 % |
| Unclassified | root | N/A | 27.63 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002305|B570J29619_1009124 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 763 | Open in IMG/M |
| 3300002835|B570J40625_100942957 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Gastropoda → Patellogastropoda → Lottioidea → Lottiidae → Lottia → Lottia gigantea | 743 | Open in IMG/M |
| 3300005069|Ga0071350_1109374 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 869 | Open in IMG/M |
| 3300005516|Ga0066831_10090670 | Not Available | 827 | Open in IMG/M |
| 3300005516|Ga0066831_10112953 | Not Available | 737 | Open in IMG/M |
| 3300005662|Ga0078894_10436579 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 1180 | Open in IMG/M |
| 3300005662|Ga0078894_10472709 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 1128 | Open in IMG/M |
| 3300005662|Ga0078894_11017207 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 712 | Open in IMG/M |
| 3300005662|Ga0078894_11202439 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 642 | Open in IMG/M |
| 3300005662|Ga0078894_11237173 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 631 | Open in IMG/M |
| 3300005662|Ga0078894_11789223 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 501 | Open in IMG/M |
| 3300005941|Ga0070743_10200761 | Not Available | 655 | Open in IMG/M |
| 3300005987|Ga0075158_10074914 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 1967 | Open in IMG/M |
| 3300005987|Ga0075158_10629089 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 586 | Open in IMG/M |
| 3300005988|Ga0075160_10711614 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 533 | Open in IMG/M |
| 3300006355|Ga0075501_1251150 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 646 | Open in IMG/M |
| 3300006415|Ga0099654_10604988 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 666 | Open in IMG/M |
| 3300006803|Ga0075467_10267779 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 920 | Open in IMG/M |
| 3300006803|Ga0075467_10470872 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 648 | Open in IMG/M |
| 3300006803|Ga0075467_10483669 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 638 | Open in IMG/M |
| 3300006875|Ga0075473_10313007 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 635 | Open in IMG/M |
| 3300007516|Ga0105050_10798364 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 538 | Open in IMG/M |
| 3300007559|Ga0102828_1174038 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 546 | Open in IMG/M |
| 3300007593|Ga0102918_1253600 | Not Available | 539 | Open in IMG/M |
| 3300007860|Ga0105735_1053828 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 798 | Open in IMG/M |
| 3300007861|Ga0105736_1107255 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 611 | Open in IMG/M |
| 3300008116|Ga0114350_1163324 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 600 | Open in IMG/M |
| 3300008934|Ga0103737_1046456 | Not Available | 556 | Open in IMG/M |
| 3300009001|Ga0102963_1325335 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 604 | Open in IMG/M |
| 3300009142|Ga0102885_1139727 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 590 | Open in IMG/M |
| 3300009180|Ga0114979_10710663 | Not Available | 568 | Open in IMG/M |
| 3300009216|Ga0103842_1038279 | Not Available | 563 | Open in IMG/M |
| 3300009265|Ga0103873_1121023 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 536 | Open in IMG/M |
| 3300009269|Ga0103876_1058856 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 561 | Open in IMG/M |
| 3300009279|Ga0103880_10060067 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 566 | Open in IMG/M |
| 3300009432|Ga0115005_11698505 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 519 | Open in IMG/M |
| 3300009436|Ga0115008_10663821 | Not Available | 755 | Open in IMG/M |
| 3300009436|Ga0115008_11459401 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 528 | Open in IMG/M |
| 3300009441|Ga0115007_10307744 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 1029 | Open in IMG/M |
| 3300009599|Ga0115103_1854375 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 655 | Open in IMG/M |
| 3300009606|Ga0115102_10797892 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 513 | Open in IMG/M |
| 3300009677|Ga0115104_11090774 | Not Available | 638 | Open in IMG/M |
| 3300010299|Ga0129342_1306827 | Not Available | 545 | Open in IMG/M |
| 3300010334|Ga0136644_10366969 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 822 | Open in IMG/M |
| 3300010388|Ga0136551_1095500 | Not Available | 519 | Open in IMG/M |
| 3300012780|Ga0138271_1134125 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 584 | Open in IMG/M |
| 3300013004|Ga0164293_10461286 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 845 | Open in IMG/M |
| 3300013004|Ga0164293_10844724 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 578 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10352981 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 847 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10311057 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae | 1011 | Open in IMG/M |
| 3300014493|Ga0182016_10321323 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 939 | Open in IMG/M |
| 3300016882|Ga0186577_107596 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 711 | Open in IMG/M |
| 3300017107|Ga0186524_113679 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 775 | Open in IMG/M |
| 3300017166|Ga0186523_111263 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 815 | Open in IMG/M |
| 3300017782|Ga0181380_1125102 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 883 | Open in IMG/M |
| 3300018657|Ga0192889_1056787 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 533 | Open in IMG/M |
| 3300018692|Ga0192944_1057206 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | 548 | Open in IMG/M |
| 3300018813|Ga0192872_1089078 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 523 | Open in IMG/M |
| 3300018838|Ga0193302_1067839 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 594 | Open in IMG/M |
| 3300018873|Ga0193553_1138383 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 570 | Open in IMG/M |
| 3300018947|Ga0193066_10228853 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 523 | Open in IMG/M |
| 3300018961|Ga0193531_10245659 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 648 | Open in IMG/M |
| 3300018989|Ga0193030_10286974 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 535 | Open in IMG/M |
| 3300018995|Ga0193430_10090088 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 725 | Open in IMG/M |
| 3300018996|Ga0192916_10172915 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 639 | Open in IMG/M |
| 3300018996|Ga0192916_10209274 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 565 | Open in IMG/M |
| 3300018999|Ga0193514_10268486 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 591 | Open in IMG/M |
| 3300018999|Ga0193514_10319191 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 523 | Open in IMG/M |
| 3300019022|Ga0192951_10334869 | Not Available | 574 | Open in IMG/M |
| 3300019048|Ga0192981_10212735 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 751 | Open in IMG/M |
| 3300019048|Ga0192981_10372497 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 514 | Open in IMG/M |
| 3300019085|Ga0188830_1023197 | Not Available | 511 | Open in IMG/M |
| 3300019149|Ga0188870_10135175 | Not Available | 569 | Open in IMG/M |
| 3300019150|Ga0194244_10071962 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 611 | Open in IMG/M |
| 3300020147|Ga0196976_1130901 | Not Available | 539 | Open in IMG/M |
| 3300020161|Ga0211726_10634584 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 595 | Open in IMG/M |
| 3300020179|Ga0194134_10220200 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 799 | Open in IMG/M |
| 3300020202|Ga0196964_10108274 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 1229 | Open in IMG/M |
| 3300020222|Ga0194125_10450522 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 800 | Open in IMG/M |
| 3300020725|Ga0214200_1033350 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 844 | Open in IMG/M |
| 3300021091|Ga0194133_10378320 | Not Available | 800 | Open in IMG/M |
| 3300021376|Ga0194130_10350611 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 800 | Open in IMG/M |
| 3300021376|Ga0194130_10494917 | Not Available | 627 | Open in IMG/M |
| 3300021424|Ga0194117_10316172 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 733 | Open in IMG/M |
| 3300021927|Ga0063103_1092105 | Not Available | 505 | Open in IMG/M |
| 3300021940|Ga0063108_1065591 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 536 | Open in IMG/M |
| 3300025138|Ga0209634_1293460 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 563 | Open in IMG/M |
| 3300025887|Ga0208544_10215412 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 786 | Open in IMG/M |
| 3300025887|Ga0208544_10221564 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 771 | Open in IMG/M |
| 3300025887|Ga0208544_10307746 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 615 | Open in IMG/M |
| 3300025896|Ga0208916_10243395 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 781 | Open in IMG/M |
| 3300026182|Ga0208275_1110601 | Not Available | 517 | Open in IMG/M |
| 3300027188|Ga0208921_1068868 | Not Available | 509 | Open in IMG/M |
| 3300027197|Ga0208922_1043636 | Not Available | 769 | Open in IMG/M |
| 3300027245|Ga0208445_1011216 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 909 | Open in IMG/M |
| 3300027754|Ga0209596_1354597 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 564 | Open in IMG/M |
| 3300027769|Ga0209770_10219424 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 745 | Open in IMG/M |
| 3300027781|Ga0209175_10163652 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 954 | Open in IMG/M |
| 3300027784|Ga0207421_10262531 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 736 | Open in IMG/M |
| 3300027789|Ga0209174_10409569 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 580 | Open in IMG/M |
| 3300027885|Ga0209450_10485227 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 904 | Open in IMG/M |
| 3300029908|Ga0311341_10400650 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 794 | Open in IMG/M |
| 3300030539|Ga0210281_1055714 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 572 | Open in IMG/M |
| 3300030545|Ga0210271_10552740 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 529 | Open in IMG/M |
| 3300030549|Ga0210257_10200610 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 547 | Open in IMG/M |
| 3300030572|Ga0210258_10718813 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 507 | Open in IMG/M |
| 3300030597|Ga0210286_1248575 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 563 | Open in IMG/M |
| 3300030603|Ga0210253_10524120 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 513 | Open in IMG/M |
| 3300030624|Ga0210251_11002202 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 619 | Open in IMG/M |
| 3300030625|Ga0210259_10403643 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 534 | Open in IMG/M |
| 3300030626|Ga0210291_10430909 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 616 | Open in IMG/M |
| 3300030632|Ga0210250_11541005 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 505 | Open in IMG/M |
| 3300030741|Ga0265459_13438205 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 555 | Open in IMG/M |
| 3300030971|Ga0075375_11001503 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 619 | Open in IMG/M |
| 3300031231|Ga0170824_120033331 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 523 | Open in IMG/M |
| 3300031469|Ga0170819_16173617 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 528 | Open in IMG/M |
| 3300031474|Ga0170818_111743045 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 530 | Open in IMG/M |
| 3300031524|Ga0302320_11705109 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 607 | Open in IMG/M |
| 3300031569|Ga0307489_10425428 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 889 | Open in IMG/M |
| 3300031602|Ga0307993_1138647 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 611 | Open in IMG/M |
| 3300031722|Ga0311351_11425657 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 533 | Open in IMG/M |
| 3300031784|Ga0315899_10861060 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 822 | Open in IMG/M |
| 3300031784|Ga0315899_10948352 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 770 | Open in IMG/M |
| 3300031788|Ga0302319_11131189 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 731 | Open in IMG/M |
| 3300032092|Ga0315905_10812200 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 812 | Open in IMG/M |
| 3300032092|Ga0315905_11439255 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 545 | Open in IMG/M |
| 3300032756|Ga0315742_12222210 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 618 | Open in IMG/M |
| 3300032756|Ga0315742_13099527 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 536 | Open in IMG/M |
| 3300034073|Ga0310130_0140746 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 736 | Open in IMG/M |
| 3300034355|Ga0335039_0596192 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 542 | Open in IMG/M |
| 3300034355|Ga0335039_0639790 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida | 518 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 22.37% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.55% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 6.58% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 6.58% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 5.92% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.95% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.95% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 3.95% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.29% |
| Wastewater Effluent | Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent | 3.29% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.63% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 2.63% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 2.63% |
| Surface Ocean Water | Environmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water | 2.63% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.97% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.97% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.32% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 1.32% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.66% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.66% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.66% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 0.66% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.66% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.66% |
| River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 0.66% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.66% |
| Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 0.66% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.66% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.66% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.66% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.66% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.66% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 0.66% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.66% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.66% |
| Alkaline Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Alkaline → Sediment → Alkaline Sediment | 0.66% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.66% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.66% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.66% |
| Ice Edge, Mcmurdo Sound, Antarctica | Environmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica | 0.66% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002305 | Freshwater microbial communities from Lake Mendota, WI - 03OCT2011 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
| 3300005069 | Metagenomes from Harmful Algal Blooms in Lake Erie, HABS-E2014-0024 | Environmental | Open in IMG/M |
| 3300005516 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49B | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
| 3300005987 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 B DNA | Engineered | Open in IMG/M |
| 3300005988 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 C2 DNA | Engineered | Open in IMG/M |
| 3300006355 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006415 | Algae and Fungi communities from freshwater lake (pre-blooming) in Auvergne, France - collected by filtering lake water, a 'reference genome' of the lake community | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007516 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300007593 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-3 | Environmental | Open in IMG/M |
| 3300007860 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1372A_3um | Environmental | Open in IMG/M |
| 3300007861 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1372B_3um | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008934 | Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 2C | Environmental | Open in IMG/M |
| 3300008998 | Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_A100000548 | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009142 | Estuarine microbial communities from the Columbia River estuary - metaG 1550B-3 | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009216 | Microbial communities of water from the North Atlantic ocean - ACM47 | Environmental | Open in IMG/M |
| 3300009265 | Eukaryotic communities of water from the North Atlantic ocean - ACM8 | Environmental | Open in IMG/M |
| 3300009269 | Eukaryotic communities of water from the North Atlantic ocean - ACM28 | Environmental | Open in IMG/M |
| 3300009279 | Eukaryotic communities of water from the North Atlantic ocean - ACM42 | Environmental | Open in IMG/M |
| 3300009432 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome | Environmental | Open in IMG/M |
| 3300009436 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome | Environmental | Open in IMG/M |
| 3300009441 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome | Environmental | Open in IMG/M |
| 3300009599 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009606 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009677 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300010388 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV, may 2015 | Environmental | Open in IMG/M |
| 3300012780 | Freshwater microbial communities from Lake Croche, Canada - C_130625_M_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300016882 | Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in f/2 medium with 33 psu seawater, 19 C, 33 psu salinity and 331 ?mol photons light - Strombidium rassoulzadegani ras09 (MMETSP0449_2) | Host-Associated | Open in IMG/M |
| 3300017107 | Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in f/20 medium, no silicate, 19 C, 30 psu salinity and 446 ?mol photons light - Strombidinopsis sp. SopsisLIS2011 (MMETSP0463) | Host-Associated | Open in IMG/M |
| 3300017166 | Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in filtered seawater, 15 C, 29.4 psu salinity and 162 ?mol photons light - Favella taraikaensis Fe Narragansett Bay (MMETSP0436) | Host-Associated | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300018657 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000705 (ERX1789382-ERR1719418) | Environmental | Open in IMG/M |
| 3300018666 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000398 (ERX1782307-ERR1712184) | Environmental | Open in IMG/M |
| 3300018692 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153) | Environmental | Open in IMG/M |
| 3300018706 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002813 (ERX1789488-ERR1719151) | Environmental | Open in IMG/M |
| 3300018769 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002195 (ERX1789526-ERR1719205) | Environmental | Open in IMG/M |
| 3300018813 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000809 (ERX1782297-ERR1712172) | Environmental | Open in IMG/M |
| 3300018838 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001646 (ERX1789439-ERR1719515) | Environmental | Open in IMG/M |
| 3300018873 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001098 | Environmental | Open in IMG/M |
| 3300018947 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003102 (ERX1782406-ERR1712029) | Environmental | Open in IMG/M |
| 3300018961 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002783 (ERX1789414-ERR1719458) | Environmental | Open in IMG/M |
| 3300018974 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000809 (ERX1782160-ERR1711971) | Environmental | Open in IMG/M |
| 3300018989 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934) | Environmental | Open in IMG/M |
| 3300018995 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002299 (ERX1782426-ERR1711902) | Environmental | Open in IMG/M |
| 3300018996 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000839 (ERX1782178-ERR1712156) | Environmental | Open in IMG/M |
| 3300018997 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001303 (ERX1789387-ERR1719468) | Environmental | Open in IMG/M |
| 3300018999 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003100 (ERX1782275-ERR1712038) | Environmental | Open in IMG/M |
| 3300019011 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000871 (ERX1782184-ERR1712079) | Environmental | Open in IMG/M |
| 3300019022 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194) | Environmental | Open in IMG/M |
| 3300019048 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166) | Environmental | Open in IMG/M |
| 3300019085 | Metatranscriptome of marine microbial communities from Baltic Sea - GS670_3p0_dT | Environmental | Open in IMG/M |
| 3300019134 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003100 (ERX1782286-ERR1712165) | Environmental | Open in IMG/M |
| 3300019136 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_004 - TARA_X000000325 (ERX1782382-ERR1712004) | Environmental | Open in IMG/M |
| 3300019149 | Metatranscriptome of marine microbial communities from Baltic Sea - GS695_3p0_dT | Environmental | Open in IMG/M |
| 3300019150 | Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000616 (ERX1782105-ERR1711908) | Environmental | Open in IMG/M |
| 3300020147 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_5-13C | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020179 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0m | Environmental | Open in IMG/M |
| 3300020202 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_10 | Environmental | Open in IMG/M |
| 3300020222 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015034 Kigoma Deep Cast 250m | Environmental | Open in IMG/M |
| 3300020725 | Freshwater microbial communities from Trout Bog Lake, WI - 23OCT2008 epilimnion | Environmental | Open in IMG/M |
| 3300021091 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015055 Kigoma Offshore 40m | Environmental | Open in IMG/M |
| 3300021376 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surface | Environmental | Open in IMG/M |
| 3300021424 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015009 Mahale N1 surface | Environmental | Open in IMG/M |
| 3300021927 | Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-122M (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021940 | Marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-149 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025887 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300026182 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49B (SPAdes) | Environmental | Open in IMG/M |
| 3300027188 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709 (SPAdes) | Environmental | Open in IMG/M |
| 3300027197 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.743 (SPAdes) | Environmental | Open in IMG/M |
| 3300027245 | Estuarine microbial communities from the Columbia River estuary - metaG 1556B-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027781 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 C2 DNA (SPAdes) | Engineered | Open in IMG/M |
| 3300027784 | Alkaline sediment microbial communities from Lake Tanatar, Kulunda Steppe, Russia - 8KL_010_SED (SPAdes) | Environmental | Open in IMG/M |
| 3300027789 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 B DNA (SPAdes) | Engineered | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027885 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes) | Environmental | Open in IMG/M |
| 3300028335 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 14R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029908 | II_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300030539 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO151-VCO111SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030545 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO142-VCO033SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030549 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO137-ANR102SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030572 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO137-ANR103SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030577 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO131-ARE010SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030597 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO747-VDE046SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030603 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR017SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030624 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO132-ANR005SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030625 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO122-ANR120SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030626 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO410-VDE110SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030632 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO132-ANR004SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030741 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assembly | Environmental | Open in IMG/M |
| 3300030971 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031216 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #1060 | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
| 3300031569 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2 | Environmental | Open in IMG/M |
| 3300031602 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #260 | Environmental | Open in IMG/M |
| 3300031722 | II_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300032756 | Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined Assembly | Environmental | Open in IMG/M |
| 3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
| 3300034355 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Oct2015-rr0135 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J29619_10091242 | 3300002305 | Freshwater | MENAKVYAENVIRNRKEALGLRRFGVKMGALSAKLESAHRTQQVS* |
| B570J40625_1009429571 | 3300002835 | Freshwater | MENAKVYAENVIRNRKEAINLRRFGVKMGALASKIESAARTQDISNTIAQSVPLL* |
| Ga0065166_104071262 | 3300004112 | Freshwater Lake | GNLDNAKIFAETVIRNRKEALNVKRFGVKMGALSAKIESAARTQNISETISKTIPML* |
| Ga0071350_11093742 | 3300005069 | Freshwater | MENAKIFAENIIRNRKEAINLRRFGVKMGALAAKLESAHRTQEIS* |
| Ga0066831_100906703 | 3300005516 | Marine | MKKGDTDTARLYAENAIRTKKESLNVRKFGCKMGALSQKIESAYRT* |
| Ga0066831_101129531 | 3300005516 | Marine | MDNAKVYAETVIRNRKEAINVRRFGVKMAALSSKIEGAARTQQMS* |
| Ga0078894_104365792 | 3300005662 | Freshwater Lake | MESAKVFAETVIRNRKEALNMKRFGVKMGALAAKLESAYRTQ* |
| Ga0078894_104727092 | 3300005662 | Freshwater Lake | LDNAKIFAETVIRNRKEALNVKRFGVKMGALSAKIESAARTQNISETISKTIPML* |
| Ga0078894_110172072 | 3300005662 | Freshwater Lake | MESAKVFAETVIRNRKEALNLKRFGVKMGALAAKLESAHRT* |
| Ga0078894_112024391 | 3300005662 | Freshwater Lake | MDSAKVFAETVIRNRKEALNLKRFGVKMGALAAKLESAYRT* |
| Ga0078894_112371731 | 3300005662 | Freshwater Lake | MENAKVFAENVIRNRKEAINLRRFGVKMGALASKLESAYRT* |
| Ga0078894_117892231 | 3300005662 | Freshwater Lake | MDNAKIFAETVIRNRKEALNLKRFGVKMGALAAKLESAHRTQNIS* |
| Ga0070743_102007612 | 3300005941 | Estuarine | MEKGQMENAKIYAETVIRQRKEAINVRRFGVKMGALAAKIEGAART* |
| Ga0075158_100749141 | 3300005987 | Wastewater Effluent | MESAKIFAENVIRNRKEALNLKRFGVKMGALASKLESAYRTQQISETISKTVPML* |
| Ga0075158_106290892 | 3300005987 | Wastewater Effluent | MNKGNMDSARIFAENVIRNKKEALNLKRFGIKMGALASKLESAYRTQ* |
| Ga0075160_107116141 | 3300005988 | Wastewater Effluent | MENAKVFAENVIRNRKEAINLRRFGVKMGALAAKIESAART* |
| Ga0075501_12511502 | 3300006355 | Aqueous | MENAKVFAENVIRNRKEAIALRRFGVKMGALAAKIESAARTQDMANTIS* |
| Ga0099654_106049882 | 3300006415 | Lake | MENAKIYAENVIRNRKEALNLRRFGVKMGALSAKLESAHRTQEVSK* |
| Ga0075467_102677793 | 3300006803 | Aqueous | MENAKVYAENVIRNRKEAINLRRFGVKMGALSAKLESAHRT* |
| Ga0075467_104708721 | 3300006803 | Aqueous | MENAKIYAENVIRNRKEAINLRRFGVKMGALSAKLESAHRT* |
| Ga0075467_104836691 | 3300006803 | Aqueous | MENAKVYAENVIRNRKEAINLRRFGVKMGALASKLEGAYRTQ* |
| Ga0075473_103130071 | 3300006875 | Aqueous | LLTSGQALDKGQMENAKIYAENVIRNRKEALNLRRFGVKMGALSAKLESAYRT* |
| Ga0105050_107983641 | 3300007516 | Freshwater | MDSAKVFAETVIRNRKEALNLKRFGVKMGALAAKLESAYRTQ* |
| Ga0102828_11740382 | 3300007559 | Estuarine | ENAKVFAENVIRNRREAISLRRFGVKMGALAAKIESAARTNELSNTIASTVPLL* |
| Ga0102918_12536001 | 3300007593 | Estuarine | MENAKVYAENVIRNRKEAINLRRFGVKMGALASKIESAARTQDI |
| Ga0105735_10538282 | 3300007860 | Estuary Water | MENAKVFAENVIRNRREAISLRRFGVKMGALAAKIESAARTNELSNTIASTVPLL* |
| Ga0105736_11072551 | 3300007861 | Estuary Water | MENAKIYAENVIRNRKEALNLRRFGVKMGALSAKLESAHRT* |
| Ga0114350_11633242 | 3300008116 | Freshwater, Plankton | MENAKVYAENVIRNRKEAINLRRFGVKMGALASKLESAYRTQEISNTIA* |
| Ga0103737_10464562 | 3300008934 | Ice Edge, Mcmurdo Sound, Antarctica | ALQKNQVDNAKIFAENVIRQRKEAINTRRFGVKMSALATKVEGAARTQEMSR* |
| Ga0103502_101836161 | 3300008998 | Marine | MNKIKAALDKNQMENAKMFAENVIRNRKEAINLRRFGIKMGALSAKLESAHRT* |
| Ga0102963_13253352 | 3300009001 | Pond Water | MENAKIYAENVIRNRKEALNLRRFGVKMGALSSKLESAYRTQEISNTIA* |
| Ga0102885_11397271 | 3300009142 | Estuarine | MENAKIFAENVIRNRKEALNLRRFGVKMGALAAKLESAHRTQEISTQI* |
| Ga0114979_107106631 | 3300009180 | Freshwater Lake | MESAKVFAENVIRSKKEALHVRRFGVKMQALAQKVESAARTQ* |
| Ga0103842_10382791 | 3300009216 | River Water | MDQAKIHAETVIRERKEALNIRRFGVKMGALSSKLESAHRTQEMSA* |
| Ga0103873_10610722 | 3300009265 | Surface Ocean Water | MEKAERKKIMDALQKNQMENAKVFAENVIRNRKEAINLRRFGVKMGALASKIESAART* |
| Ga0103873_11210232 | 3300009265 | Surface Ocean Water | NQMENAKVFAENVIRNRKEALNLRRFGVKMGALAAKLESAHRT* |
| Ga0103876_10588561 | 3300009269 | Surface Ocean Water | MAKIKAALDKNQMENAKVFAENVIRNRKEALNLRRFGVKMGALAAKLESAYRT* |
| Ga0103880_100600672 | 3300009279 | Surface Ocean Water | MENAKVFAENVIRNRKEALNLRRFGVKMGALAAKLESAYRT* |
| Ga0115005_116985051 | 3300009432 | Marine | MDQAKIHAETVIRERKEALNLRRFGVKMGALSSKLESAHRTQEMSAQIQKSVPLL* |
| Ga0115008_106638211 | 3300009436 | Marine | MDTAKMYAESAIRAKKEALNVRRFGVKMGALAGKVESAART* |
| Ga0115008_114594012 | 3300009436 | Marine | MENAKIYAENIIRNRKESINLRRFGVKMGALAAKLESAHRTQ* |
| Ga0115007_103077441 | 3300009441 | Marine | MENAKMFAENVIRNRKEAINLRRFGIKMGALSAKLESAHRTNEIS* |
| Ga0115103_18543752 | 3300009599 | Marine | MNKGQMDNAKIYAETVIRQKKEAQNVRRFGVKMGALAQKIEGAART* |
| Ga0115103_18988191 | 3300009599 | Marine | MEKAERKKIIDALNKNQMENAKVYAENVIRNRKEAINLRRFGVKMGALSSKIESAART* |
| Ga0115102_107978921 | 3300009606 | Marine | MARIKAALDKNQMENAKIYAENVIRNRKEAINLRRFGVKMGALSAKLESAHRTQ* |
| Ga0115104_110907742 | 3300009677 | Marine | MDTAKIHAETIIRNKKEALNLRRYGVKMGALASKLESAHRT* |
| Ga0129342_13068271 | 3300010299 | Freshwater To Marine Saline Gradient | MDEAKIYAETVIRTRKEAINVRRFGVKMAALSQKIESAARTQQMS* |
| Ga0136644_103669693 | 3300010334 | Freshwater Lake | MENAKVFAENVIRNRKEAINLRRFGVKMGALASKLESAYRTQEISNTIAQSVPLL* |
| Ga0136551_10955002 | 3300010388 | Pond Fresh Water | LNKGNLENAKIFAETVIRNRKEALNVKRFGVKMGALASKIESAART* |
| Ga0138271_11341252 | 3300012780 | Freshwater Lake | MENAKVYAENVIRNRKEAINLRRFGVKMGALASKLESAYRT* |
| Ga0164293_104612862 | 3300013004 | Freshwater | LENAKIFAETVIRNRKEAINLKKFGVKMGALASKIESAART* |
| Ga0164293_108447242 | 3300013004 | Freshwater | MENAKVYAENVIRNRKEAINLRRFGVKMGALASKLESAYRTHEISNTIA* |
| (restricted) Ga0172367_103529812 | 3300013126 | Freshwater | MDSAKVFAETVIRNRKEALNLKRFGVKMGALASKLESAYRT* |
| (restricted) Ga0172373_103110572 | 3300013131 | Freshwater | MEFAKVYAENAIRIRKEALQIQRFSAKMAAVGAKLESAYRTQQISQQIKQTVPKLQ* |
| Ga0182016_103213231 | 3300014493 | Bog | MDSAKIFAENVIRNKKEALNLKRFGVKMGALSAKLESAYRT* |
| Ga0186577_1075962 | 3300016882 | Host-Associated | MDNAKIYAETVIRNKREALNVRRFGVKMTALSAKIESAARTQQMS |
| Ga0186524_1136792 | 3300017107 | Host-Associated | MDNAKIFAEDLIRNRKEALNLRRFGVKMGALSSKLESAYRTQ |
| Ga0186524_1145701 | 3300017107 | Host-Associated | MGEAAQKKKVKDALDKGQMDNAKIFAEDLIRNRKEALNLRRFGVKMGALSSKLESAYRTQ |
| Ga0186523_1112631 | 3300017166 | Host-Associated | MENAKIYAENVIRNRKEAINLRRFGVKMGALSAKLESAHRTQQIST |
| Ga0181380_11251021 | 3300017782 | Seawater | MENAKVFAENVIRNRKEALNLRRFGVKMGALGAKLESAHRT |
| Ga0192889_10567872 | 3300018657 | Marine | MENAKVFAENVIRNRKEAINLRRFGVKMGALSAKLESAHRTQEMSKQIS |
| Ga0193159_10295652 | 3300018666 | Marine | MKKIRDALNKGQMDNAKVFAENVIRNRKEAINLRRFGVKMGALSAKLESAHRTQEMSQ |
| Ga0192944_10572062 | 3300018692 | Marine | MNKGQMENAKVFAETIIRQKKEALNVRRFGVKMAALSQKIESAYRTQ |
| Ga0193539_10385952 | 3300018706 | Marine | MNKIKAALDKNQMENAKMFAENVIRNRKEAINLRRFGIKMGALSAKLESAHRT |
| Ga0193478_10436983 | 3300018769 | Marine | MTKIKAALDKNQMENAKIFAENVIRNRKEAINLRRFGVKMGALSAKLESAHRT |
| Ga0193478_10480171 | 3300018769 | Marine | MNKIKQALDKNQMENAKIFAENIIRNRKEAINLRRFGVKMGALSAKLESAHRTQ |
| Ga0192872_10890781 | 3300018813 | Marine | IKAALDKNQMENAKIFAENVIRNRKEAINLRRFGVKMGALAAKLESAHRT |
| Ga0193302_10678392 | 3300018838 | Marine | MENAKIFAENVIRNRKEAINLRRFGVKMGALAAKLESAHRTQ |
| Ga0193553_11383831 | 3300018873 | Marine | MENAKVFAENVIRNRKEALNLRRFGVKMGALAAKLESAYRT |
| Ga0193066_102288531 | 3300018947 | Marine | MENAKVFAENVIRNRKEAINLRRFGVKMGALSAKLELSHRTQEMSKQIS |
| Ga0193531_102456592 | 3300018961 | Marine | MTKIKAALDKNQMENAKIFAENVIRNRKEAINLRRFGVKMGALSAKLESAHRTQ |
| Ga0192873_101749281 | 3300018974 | Marine | MTKIKAALDKNQMENAKIFAENVIRNRKEAINLRRFGVKMGALAAKLESAHRT |
| Ga0192873_103868033 | 3300018974 | Marine | MQKEGAERKKILDAMSKGRTDEAKIYAETVIRNRKEAINVRRFGVKMGALASKIEGAART |
| Ga0193030_102869743 | 3300018989 | Marine | DKNQMENAKVFAENVIRNRKEAINLRRFGVKMGALSAKLESAHRTQEMS |
| Ga0193430_100900882 | 3300018995 | Marine | MNKIKQALDKNQMENAKIFAENVIRNRKEAINLRRFGVKMGALAAKLESAHRT |
| Ga0192916_101729151 | 3300018996 | Marine | MENAKIFAENVIRNRKEAINLRRFGVKMGALAAKLESAHRT |
| Ga0192916_102092741 | 3300018996 | Marine | LDKNQMENAKVFAENVIRNRKEALNLRRFGVKMGALAAKLESAYRTQEIS |
| Ga0193257_101790302 | 3300018997 | Marine | MKLEGSEKNEMKKIKDALDKNQMENAKVFAENVIRNRKEALNLRRFGVKMGALAAKLESAYRT |
| Ga0193514_101940432 | 3300018999 | Marine | MKKIKDALDKNQMENAKVFAENVIRNRKEAINLRRFGVKMGALSAKLESAHRT |
| Ga0193514_102684861 | 3300018999 | Marine | KIFAENVIRNRKEAINLRRFGVKMGALAAKLESAHRT |
| Ga0193514_103191911 | 3300018999 | Marine | NQMENAKVFAENVIRNRKEAINLRRFGVKMGALSAKLESAHRT |
| Ga0192926_103625002 | 3300019011 | Marine | EMAKIKAALDKNQMENAKMFAENVIRNRKEAINLRRFGIKMGALSNKLESAHRTQEISSTIQ |
| Ga0192951_103348693 | 3300019022 | Marine | METAKIHAETVIRNKKEAISIRRYGVKLGALASKLESAYRT |
| Ga0192981_102127351 | 3300019048 | Marine | MENAKVFAENVIRNRKEAINLRRFGVKMGALASKIDSAARTQ |
| Ga0192981_103724972 | 3300019048 | Marine | MENAKVYAEDVIRNRKEALNLRRFSVKMGALASKLEGAYRTQQVSETIANSVPML |
| Ga0188830_10231972 | 3300019085 | Freshwater Lake | MENAKIYAETVIRQRKEAINVRRFGVKMGALAAKIEGAART |
| Ga0193515_10575954 | 3300019134 | Marine | QGEKAEINKIKAALDKNQMDNAKMFAENVIRNRKEAINLRRFGIKMGALSAKLESAHRT |
| Ga0193112_10870161 | 3300019136 | Marine | MKKIKDALDKNQMENAKVFAENVIRNRKEAINLRRFGVKMGALSAKLESAHRTQEMS |
| Ga0193112_10996851 | 3300019136 | Marine | MAKIKAALDKNQMENAKVFAENVIRNRKEALNLRRFGVKMGALAAKLESAYRT |
| Ga0188870_101351751 | 3300019149 | Freshwater Lake | MDTAKMYAESAIRAKKEALNVRRFGVKMGALAGKVESAART |
| Ga0194244_100719623 | 3300019150 | Marine | MENAKVFAENVIRNRKEALNLRRFGVKMGALAAKLESAYRTQEIS |
| Ga0196976_11309011 | 3300020147 | Soil | MENAKIYAENVIRNRKEALNMKRFSVKMGALSAKLESAYRTQ |
| Ga0211726_106345841 | 3300020161 | Freshwater | MENAKIFAENIIRNRKEAINLRRFGVKMGALAAKLESAHRTQEISQTI |
| Ga0194134_102202002 | 3300020179 | Freshwater Lake | MENAKIYAENVIRNRKEALSLRRFGVKMGALSAKLESAYRTQEVSK |
| Ga0196964_101082742 | 3300020202 | Soil | MENAKIYAENVIRNRKEALNLKRFSVKMGALAAKLESAYRT |
| Ga0194125_104505221 | 3300020222 | Freshwater Lake | MENAKVFAENVIRNRKEAINLRRFGVKMGALASKLESAYRT |
| Ga0214200_10333502 | 3300020725 | Freshwater | MDNAKVFAETVIRNRKEALNLKRFGVKMGALAAKLESAYRTQNISETISKTVPML |
| Ga0194133_103783202 | 3300021091 | Freshwater Lake | MENAKIYAENVIRNRKEALSLRRFGVKMGALSSKLESAYRTQEVSK |
| Ga0194130_103506111 | 3300021376 | Freshwater Lake | MENAKVFAENVIRNRKEAINLRRFGVKMGALASKLESAYRTQEISNTIA |
| Ga0194130_104949171 | 3300021376 | Freshwater Lake | MENAKVYAENVIRNRKEAINLRRFGVKMGALASKIESAART |
| Ga0194117_103161722 | 3300021424 | Freshwater Lake | MENAKVFAENVIRNRKEAISLRRFGVKMGALSSKIESAARTQDLSNTI |
| Ga0063103_10921051 | 3300021927 | Marine | DCLSKNQMDQAKIHAETVIRERKEAMNIRRFGVKMGALSSKLESAHRTQEMSA |
| Ga0063108_10655911 | 3300021940 | Marine | MENAKMFAENVIRNRKEAINLRRFGIKMGALSAKLESAHRTNEIS |
| Ga0209634_12934602 | 3300025138 | Marine | MENAKVYAEDVIRNRKEAINMRRFGVKMGALASKLEGAYRTQ |
| Ga0208544_102154123 | 3300025887 | Aqueous | MENAKVYAENVIRNRKEAINLRRFGVKMGALSAKLESAHRT |
| Ga0208544_102215641 | 3300025887 | Aqueous | MENAKIYAENVIRNRKEAINLRRFGVKMGALSAKLESAHRT |
| Ga0208544_103077461 | 3300025887 | Aqueous | MENAKVYAENVIRNRKEAINLRRFGVKMGALASKLEGAYRTQ |
| Ga0208916_102433952 | 3300025896 | Aqueous | MENAKVFAENVIRNRREAISLRRFGVKMGALAAKIESAARTNELSNTIASTVPLL |
| Ga0208275_11106011 | 3300026182 | Marine | MDNAKVYAETVIRNRKEAINVRRFGVKMAALSSKIEGAARTQQMS |
| Ga0208921_10688681 | 3300027188 | Estuarine | MEKGQMENAKIYAETVIRQRKEAINVRRFGVKMGALAAKIEGAART |
| Ga0208922_10436362 | 3300027197 | Estuarine | MEKGQMENAKIYAETVIRQRKEAINVRRFGVKMGALTAKIEGAART |
| Ga0208445_10112162 | 3300027245 | Estuarine | MENAKIFAENVIRNRKEALNLRRFGVKMGALAAKLESAHRTQEISTQI |
| Ga0209596_13545971 | 3300027754 | Freshwater Lake | LNKGNMDNAKIFAETVIRNRKEALNLKRFGVKMGALAAKLESAHRTQNVS |
| Ga0209770_102194241 | 3300027769 | Freshwater Lake | MESAKVFAETVIRNRKEALNMKRFGVKMGALAAKLESAYRTQ |
| Ga0209175_101636521 | 3300027781 | Wastewater Effluent | MESAKIFAENVIRNRKEALNLKRFGVKMGALASKLESAYRTQQISETISKTVPML |
| Ga0207421_102625312 | 3300027784 | Alkaline Sediment | MESAKIFAENVIRNKKEALNLKRFGVKMGALASKLESAYRTQ |
| Ga0209174_104095691 | 3300027789 | Wastewater Effluent | MNKGNMDSARIFAENVIRNKKEALNLKRFGIKMGALASKLESAYRTQ |
| Ga0209229_104124481 | 3300027805 | Freshwater And Sediment | LNKGNLDNAKIFAETVIRNRKEALNVKRFGVKMGALSAKIESAARTQNISETISKTIPML |
| Ga0209450_104852271 | 3300027885 | Freshwater Lake Sediment | MENAKIFAENIIRNRKEAINLRRFGVKMGALAAKLESAHRTQEIS |
| Ga0247566_10867381 | 3300028335 | Seawater | MEKAERKKIIDALNKNQMENAKVYAENVIRNRKEAINLRRFGVKMGALSSKIESAART |
| Ga0311341_104006501 | 3300029908 | Bog | MENAKIYAENVIRNRKEALNLKRFGVKMGALAAKLESAYRT |
| Ga0210281_10557141 | 3300030539 | Soil | KIYAENVIRNRKEALNLKRFSVKMGALAGKLESAYRT |
| Ga0210271_105527401 | 3300030545 | Soil | LQKGQMDNAKIYAENVIRNRKEALNLKRFSVKMGALAAKLESAYRT |
| Ga0210257_102006102 | 3300030549 | Soil | ENAKIYAENVIRNRKEALNLKRFSVKMGALASKLESAYRT |
| Ga0210258_107188132 | 3300030572 | Soil | KGQMENAKIYAENVIRNRKEALNLKRFSVKMGALAAKLESAYRTQ |
| Ga0210260_102130232 | 3300030577 | Soil | MEQLEKNERKKIVDAMNKGQMENAKIYAENVIRNRKEALNLKRFSVKMGALAGKLESAYR |
| Ga0210286_12485752 | 3300030597 | Soil | MNKGQMENAKIYAENVIRNRKEALNLKRFSVKMGALASKLESAYRT |
| Ga0210253_105241201 | 3300030603 | Soil | KIIDAMNKGQMENAKIYAENVIRNRKEALNLKRFSVKMGALASKLESAYRT |
| Ga0210251_110022021 | 3300030624 | Soil | MENAKIYAENVIRNRKEALNLKRFSVKMGALAAKLESAYRTQ |
| Ga0210259_104036431 | 3300030625 | Soil | ALNKGQMDNAKIYAENVIRNRKEALNLKRFSVKMGALAAKIESAYRTQ |
| Ga0210291_104309091 | 3300030626 | Soil | MDNAKIYAENVIRNRKEALNLKRFSVKMGALASKLESAYRT |
| Ga0210250_115410052 | 3300030632 | Soil | QMENAKIYAENVIRNRKEALNLKRFSVKMGALAAKLESAYRTQQISETIS |
| Ga0265459_134382051 | 3300030741 | Soil | KIVDALAKNQMDNAKIYAENVIRNRKEALNLKRFSVKMGALAAKLESAYRT |
| Ga0075375_110015031 | 3300030971 | Soil | MESAKIFAENVIRNRKEALNMKRFGVKMGALASKLESAYRT |
| Ga0307980_10928591 | 3300031216 | Saline Water | MEKNERKKILDALNKNQTENAKIYAETVIRQRKECINVRRFGVKMGALAQKIEGAARTQ |
| Ga0170824_1200333312 | 3300031231 | Forest Soil | MDNAKVYAENVIRNRKEALNLKRFSVKMGALAAKLESAYRT |
| Ga0170819_161736172 | 3300031469 | Forest Soil | QMENAKIYAENVIRNRKEALNLKRFSVKMGALASKLESAYRTQ |
| Ga0170818_1117430452 | 3300031474 | Forest Soil | VVDALNKGQMENAKIYAENVIRNRKEALNLKRFSIKMSALSSKLESAYRT |
| Ga0302320_117051091 | 3300031524 | Bog | NMDSAKIFAENVIRNKKEALNLKRFGVKMGALSAKLESAYRT |
| Ga0307489_104254282 | 3300031569 | Sackhole Brine | MENAKVFAENIIRNRKEAINLRRFGVKMGALAAKLESAHRTQEISSQI |
| Ga0307993_11386472 | 3300031602 | Marine | MDQAKIHAETVIRERKEALNLRRFGVKMGALSSKLESAHRTQEMSAQIQKSVPLL |
| Ga0311351_114256571 | 3300031722 | Fen | MNKNNMDSAKIFAENVIRNKKEALNLKRFGVKMGALAAKLESAYRTQ |
| Ga0315899_108610602 | 3300031784 | Freshwater | MENAKVYAENVIRNRKEAINLRRFGVKMGALASKLESAYRTQEISNTIA |
| Ga0315899_109483521 | 3300031784 | Freshwater | MENAKVYAENVIRNRKEAINLRRFGVKMGALASKIESAARTQDISNTIAQSVPLL |
| Ga0302319_111311891 | 3300031788 | Bog | MDSAKIFAENVIRNKKEALNLKRFGVKMGALSAKLESAYRT |
| Ga0315905_108122002 | 3300032092 | Freshwater | MENAKVYAENVIRNRKEAINLRRFGVKMGALASKLESAYRT |
| Ga0315905_114392552 | 3300032092 | Freshwater | MENAKVYAENVIRNRKEAINLRRFGVKMGALASKLESAYRTQEISDTIA |
| Ga0315742_122222101 | 3300032756 | Forest Soil | MENAKIYAENVIRNKKEALNLKRFSVKMGALAAKLESAYRT |
| Ga0315742_130995272 | 3300032756 | Forest Soil | GQMENAKIYAENVIRNRKEALNLKRFAVKMGALAGKLESAYRT |
| Ga0310130_0140746_384_533 | 3300034073 | Fracking Water | MENAKVFAENVIRNRKEAIALRRFGVKMGALAAKIESAARTQDMANTIS |
| Ga0335039_0596192_346_489 | 3300034355 | Freshwater | MNKGNMDSARIFAENVIRNRKEALNLKRFGIKMGALAAKLESAYRTQ |
| Ga0335039_0639790_234_374 | 3300034355 | Freshwater | MENAKIYAENVIRNRKEALNLRRFGVKMGALSAKLESAYRTQEVSK |
| ⦗Top⦘ |