| Basic Information | |
|---|---|
| Family ID | F043844 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 155 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MTRAPWYMRQEFWMVVGTLVVPFFWILPLSRAAYARVSVRRERRF |
| Number of Associated Samples | 127 |
| Number of Associated Scaffolds | 155 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 74.19 % |
| % of genes near scaffold ends (potentially truncated) | 24.52 % |
| % of genes from short scaffolds (< 2000 bps) | 82.58 % |
| Associated GOLD sequencing projects | 122 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (77.419 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (15.484 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.387 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (22.581 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 52.05% β-sheet: 0.00% Coil/Unstructured: 47.95% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 155 Family Scaffolds |
|---|---|---|
| PF02617 | ClpS | 34.19 |
| PF04295 | GD_AH_C | 11.61 |
| PF00441 | Acyl-CoA_dh_1 | 7.74 |
| PF02771 | Acyl-CoA_dh_N | 5.16 |
| PF02515 | CoA_transf_3 | 4.52 |
| PF02770 | Acyl-CoA_dh_M | 1.94 |
| PF08666 | SAF | 1.94 |
| PF00174 | Oxidored_molyb | 1.29 |
| PF01575 | MaoC_dehydratas | 0.65 |
| PF00486 | Trans_reg_C | 0.65 |
| PF13676 | TIR_2 | 0.65 |
| PF00561 | Abhydrolase_1 | 0.65 |
| PF05593 | RHS_repeat | 0.65 |
| PF00571 | CBS | 0.65 |
| PF01546 | Peptidase_M20 | 0.65 |
| PF02518 | HATPase_c | 0.65 |
| COG ID | Name | Functional Category | % Frequency in 155 Family Scaffolds |
|---|---|---|---|
| COG2127 | ATP-dependent Clp protease adapter protein ClpS | Posttranslational modification, protein turnover, chaperones [O] | 34.19 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 14.84 |
| COG2721 | Altronate dehydratase | Carbohydrate transport and metabolism [G] | 11.61 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 4.52 |
| COG2041 | Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductases | Energy production and conversion [C] | 1.29 |
| COG3915 | Uncharacterized conserved protein | Function unknown [S] | 1.29 |
| COG3209 | Uncharacterized conserved protein RhaS, contains 28 RHS repeats | General function prediction only [R] | 0.65 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 77.42 % |
| Unclassified | root | N/A | 22.58 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908044|A5_c1_ConsensusfromContig1912 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
| 3300000787|JGI11643J11755_11259001 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10104822 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 595 | Open in IMG/M |
| 3300000955|JGI1027J12803_107210232 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 923 | Open in IMG/M |
| 3300002120|C687J26616_10088809 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
| 3300002122|C687J26623_10007078 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2722 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101449150 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 581 | Open in IMG/M |
| 3300004009|Ga0055437_10019075 | All Organisms → cellular organisms → Bacteria | 1578 | Open in IMG/M |
| 3300004009|Ga0055437_10039003 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1225 | Open in IMG/M |
| 3300004009|Ga0055437_10157607 | Not Available | 708 | Open in IMG/M |
| 3300004024|Ga0055436_10064001 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1023 | Open in IMG/M |
| 3300004025|Ga0055433_10065255 | Not Available | 769 | Open in IMG/M |
| 3300004633|Ga0066395_10001067 | All Organisms → cellular organisms → Bacteria | 9950 | Open in IMG/M |
| 3300004633|Ga0066395_10086807 | All Organisms → cellular organisms → Bacteria | 1478 | Open in IMG/M |
| 3300005166|Ga0066674_10116431 | All Organisms → cellular organisms → Bacteria | 1248 | Open in IMG/M |
| 3300005180|Ga0066685_10222255 | All Organisms → cellular organisms → Bacteria | 1299 | Open in IMG/M |
| 3300005332|Ga0066388_100892542 | All Organisms → cellular organisms → Bacteria | 1468 | Open in IMG/M |
| 3300005340|Ga0070689_100122826 | All Organisms → cellular organisms → Bacteria | 2075 | Open in IMG/M |
| 3300005436|Ga0070713_100317861 | All Organisms → cellular organisms → Bacteria | 1437 | Open in IMG/M |
| 3300005445|Ga0070708_100131532 | All Organisms → cellular organisms → Bacteria | 2316 | Open in IMG/M |
| 3300005467|Ga0070706_100770001 | Not Available | 891 | Open in IMG/M |
| 3300005468|Ga0070707_102039368 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 541 | Open in IMG/M |
| 3300005536|Ga0070697_101358950 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 634 | Open in IMG/M |
| 3300005546|Ga0070696_101113671 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 664 | Open in IMG/M |
| 3300005829|Ga0074479_10301197 | All Organisms → cellular organisms → Bacteria | 6447 | Open in IMG/M |
| 3300005829|Ga0074479_11145619 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 819 | Open in IMG/M |
| 3300005833|Ga0074472_10547382 | All Organisms → cellular organisms → Bacteria | 2540 | Open in IMG/M |
| 3300006031|Ga0066651_10509963 | Not Available | 637 | Open in IMG/M |
| 3300006046|Ga0066652_101184509 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 723 | Open in IMG/M |
| 3300006796|Ga0066665_10912489 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 680 | Open in IMG/M |
| 3300006854|Ga0075425_100010500 | All Organisms → cellular organisms → Bacteria | 9877 | Open in IMG/M |
| 3300007255|Ga0099791_10626910 | Not Available | 527 | Open in IMG/M |
| 3300009038|Ga0099829_10071943 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2624 | Open in IMG/M |
| 3300009038|Ga0099829_10145584 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1887 | Open in IMG/M |
| 3300009089|Ga0099828_10546278 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1044 | Open in IMG/M |
| 3300009089|Ga0099828_10639565 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
| 3300009090|Ga0099827_11889907 | Not Available | 520 | Open in IMG/M |
| 3300009137|Ga0066709_100558365 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1623 | Open in IMG/M |
| 3300009777|Ga0105164_10648146 | Not Available | 521 | Open in IMG/M |
| 3300010046|Ga0126384_10119097 | All Organisms → cellular organisms → Bacteria | 1982 | Open in IMG/M |
| 3300010046|Ga0126384_10121389 | All Organisms → cellular organisms → Bacteria | 1966 | Open in IMG/M |
| 3300010047|Ga0126382_10002768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 7482 | Open in IMG/M |
| 3300010047|Ga0126382_10070246 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2143 | Open in IMG/M |
| 3300010322|Ga0134084_10293890 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 601 | Open in IMG/M |
| 3300010358|Ga0126370_10225870 | All Organisms → cellular organisms → Bacteria | 1434 | Open in IMG/M |
| 3300010358|Ga0126370_11772578 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300010359|Ga0126376_12224580 | Not Available | 593 | Open in IMG/M |
| 3300010359|Ga0126376_12975844 | Not Available | 523 | Open in IMG/M |
| 3300010391|Ga0136847_10911870 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2784 | Open in IMG/M |
| 3300010391|Ga0136847_11952788 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 713 | Open in IMG/M |
| 3300010391|Ga0136847_12102697 | Not Available | 761 | Open in IMG/M |
| 3300010398|Ga0126383_10549672 | All Organisms → cellular organisms → Bacteria | 1220 | Open in IMG/M |
| 3300011270|Ga0137391_10466021 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1073 | Open in IMG/M |
| 3300011419|Ga0137446_1061923 | Not Available | 851 | Open in IMG/M |
| 3300012035|Ga0137445_1136095 | Not Available | 503 | Open in IMG/M |
| 3300012096|Ga0137389_10235408 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1535 | Open in IMG/M |
| 3300012189|Ga0137388_10665023 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 968 | Open in IMG/M |
| 3300012201|Ga0137365_10294566 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1203 | Open in IMG/M |
| 3300012204|Ga0137374_10003771 | All Organisms → cellular organisms → Bacteria | 17977 | Open in IMG/M |
| 3300012206|Ga0137380_10645958 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 922 | Open in IMG/M |
| 3300012207|Ga0137381_10269156 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1482 | Open in IMG/M |
| 3300012209|Ga0137379_10182877 | Not Available | 2008 | Open in IMG/M |
| 3300012209|Ga0137379_10237978 | All Organisms → cellular organisms → Bacteria | 1734 | Open in IMG/M |
| 3300012673|Ga0137339_1037017 | Not Available | 547 | Open in IMG/M |
| 3300012685|Ga0137397_10039247 | All Organisms → cellular organisms → Bacteria | 3387 | Open in IMG/M |
| 3300012922|Ga0137394_11320334 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 584 | Open in IMG/M |
| 3300012925|Ga0137419_11511735 | Not Available | 569 | Open in IMG/M |
| 3300012927|Ga0137416_10247659 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1454 | Open in IMG/M |
| 3300012931|Ga0153915_10329333 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1712 | Open in IMG/M |
| 3300012931|Ga0153915_12884976 | Not Available | 561 | Open in IMG/M |
| 3300012944|Ga0137410_10836101 | Not Available | 775 | Open in IMG/M |
| 3300012944|Ga0137410_10881886 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300012948|Ga0126375_11181142 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 635 | Open in IMG/M |
| 3300012964|Ga0153916_10032990 | All Organisms → cellular organisms → Bacteria | 4522 | Open in IMG/M |
| 3300014321|Ga0075353_1113125 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 648 | Open in IMG/M |
| 3300014873|Ga0180066_1098128 | Not Available | 603 | Open in IMG/M |
| 3300014877|Ga0180074_1033992 | All Organisms → cellular organisms → Bacteria | 1043 | Open in IMG/M |
| 3300014881|Ga0180094_1007456 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1973 | Open in IMG/M |
| 3300014882|Ga0180069_1011169 | All Organisms → cellular organisms → Bacteria | 1829 | Open in IMG/M |
| 3300014884|Ga0180104_1014512 | All Organisms → cellular organisms → Bacteria | 1882 | Open in IMG/M |
| 3300015254|Ga0180089_1084134 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 656 | Open in IMG/M |
| 3300015256|Ga0180073_1028367 | All Organisms → cellular organisms → Bacteria | 1071 | Open in IMG/M |
| 3300015264|Ga0137403_10379442 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1296 | Open in IMG/M |
| 3300018052|Ga0184638_1217595 | Not Available | 668 | Open in IMG/M |
| 3300018059|Ga0184615_10054005 | All Organisms → cellular organisms → Bacteria | 2237 | Open in IMG/M |
| 3300018059|Ga0184615_10234886 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1028 | Open in IMG/M |
| 3300018059|Ga0184615_10550124 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 612 | Open in IMG/M |
| 3300018059|Ga0184615_10551507 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 611 | Open in IMG/M |
| 3300018061|Ga0184619_10043631 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1933 | Open in IMG/M |
| 3300018063|Ga0184637_10543571 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300018077|Ga0184633_10208045 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1010 | Open in IMG/M |
| 3300018078|Ga0184612_10117774 | All Organisms → cellular organisms → Bacteria | 1390 | Open in IMG/M |
| 3300018079|Ga0184627_10643049 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 527 | Open in IMG/M |
| 3300018084|Ga0184629_10442936 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 681 | Open in IMG/M |
| 3300018084|Ga0184629_10508496 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300018482|Ga0066669_12190311 | Not Available | 524 | Open in IMG/M |
| 3300019249|Ga0184648_1044599 | Not Available | 580 | Open in IMG/M |
| 3300020067|Ga0180109_1244076 | Not Available | 833 | Open in IMG/M |
| 3300021051|Ga0206224_1005399 | All Organisms → cellular organisms → Bacteria | 1338 | Open in IMG/M |
| 3300021063|Ga0206227_1025191 | Not Available | 1001 | Open in IMG/M |
| 3300021090|Ga0210377_10111178 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1821 | Open in IMG/M |
| 3300021090|Ga0210377_10484392 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 717 | Open in IMG/M |
| 3300021090|Ga0210377_10683823 | Not Available | 567 | Open in IMG/M |
| 3300021333|Ga0210324_1326172 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1849 | Open in IMG/M |
| 3300021437|Ga0213917_1012576 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
| 3300021560|Ga0126371_10356927 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1598 | Open in IMG/M |
| 3300021560|Ga0126371_11625001 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 772 | Open in IMG/M |
| 3300021560|Ga0126371_12818049 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300025002|Ga0209001_1002931 | All Organisms → cellular organisms → Bacteria | 3276 | Open in IMG/M |
| 3300025311|Ga0209343_10215243 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1417 | Open in IMG/M |
| 3300025327|Ga0209751_10595481 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300025538|Ga0210132_1029023 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 785 | Open in IMG/M |
| 3300025551|Ga0210131_1039544 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300025560|Ga0210108_1001391 | All Organisms → cellular organisms → Bacteria | 4266 | Open in IMG/M |
| 3300025569|Ga0210073_1076369 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 714 | Open in IMG/M |
| 3300025580|Ga0210138_1002353 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3415 | Open in IMG/M |
| 3300025905|Ga0207685_10692011 | Not Available | 554 | Open in IMG/M |
| 3300025922|Ga0207646_11376395 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 614 | Open in IMG/M |
| 3300025934|Ga0207686_10045264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2707 | Open in IMG/M |
| 3300026351|Ga0257170_1038609 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 654 | Open in IMG/M |
| 3300027645|Ga0209117_1051989 | Not Available | 1211 | Open in IMG/M |
| 3300027646|Ga0209466_1003650 | All Organisms → cellular organisms → Bacteria | 3198 | Open in IMG/M |
| 3300027681|Ga0208991_1174579 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 630 | Open in IMG/M |
| 3300027846|Ga0209180_10598186 | Not Available | 609 | Open in IMG/M |
| 3300028536|Ga0137415_10052488 | All Organisms → cellular organisms → Bacteria | 3949 | Open in IMG/M |
| 3300028792|Ga0307504_10008837 | All Organisms → cellular organisms → Bacteria | 2214 | Open in IMG/M |
| 3300031446|Ga0170820_11816585 | Not Available | 943 | Open in IMG/M |
| 3300031543|Ga0318516_10320331 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| 3300031720|Ga0307469_11314288 | Not Available | 687 | Open in IMG/M |
| 3300031720|Ga0307469_11422125 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 662 | Open in IMG/M |
| 3300031751|Ga0318494_10281741 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
| 3300031820|Ga0307473_10667861 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 726 | Open in IMG/M |
| 3300031834|Ga0315290_10018821 | All Organisms → cellular organisms → Bacteria | 5328 | Open in IMG/M |
| 3300031834|Ga0315290_10074771 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2808 | Open in IMG/M |
| 3300031965|Ga0326597_10001845 | All Organisms → cellular organisms → Bacteria | 32722 | Open in IMG/M |
| 3300031965|Ga0326597_10386964 | All Organisms → cellular organisms → Bacteria | 1559 | Open in IMG/M |
| 3300031965|Ga0326597_10559684 | All Organisms → cellular organisms → Bacteria | 1232 | Open in IMG/M |
| 3300031965|Ga0326597_10985408 | Not Available | 853 | Open in IMG/M |
| 3300031997|Ga0315278_10267593 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1765 | Open in IMG/M |
| 3300032143|Ga0315292_11225998 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300032163|Ga0315281_10046637 | All Organisms → cellular organisms → Bacteria | 5321 | Open in IMG/M |
| 3300032164|Ga0315283_12020048 | Not Available | 573 | Open in IMG/M |
| 3300032177|Ga0315276_11095097 | Not Available | 844 | Open in IMG/M |
| 3300032180|Ga0307471_104267989 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 505 | Open in IMG/M |
| 3300032256|Ga0315271_11760448 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300032397|Ga0315287_11342838 | Not Available | 816 | Open in IMG/M |
| 3300032829|Ga0335070_10539760 | All Organisms → cellular organisms → Bacteria | 1102 | Open in IMG/M |
| 3300033233|Ga0334722_11008398 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300033407|Ga0214472_10246111 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1715 | Open in IMG/M |
| 3300033417|Ga0214471_10321432 | All Organisms → cellular organisms → Bacteria | 1256 | Open in IMG/M |
| 3300033813|Ga0364928_0108447 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 659 | Open in IMG/M |
| 3300033814|Ga0364930_0247342 | Not Available | 603 | Open in IMG/M |
| 3300034090|Ga0326723_0041383 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1936 | Open in IMG/M |
| 3300034165|Ga0364942_0095324 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
| 3300034177|Ga0364932_0350183 | Not Available | 557 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 15.48% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.39% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 7.74% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 6.45% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 6.45% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 6.45% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.16% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.52% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 3.23% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.23% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.58% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.58% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 2.58% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 1.94% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.94% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 1.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.94% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.94% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 1.94% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.29% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.29% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 1.29% |
| Wastewater | Environmental → Aquatic → Freshwater → Drinking Water → Unchlorinated → Wastewater | 0.65% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.65% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.65% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.65% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.65% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.65% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.65% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.65% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.65% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908044 | Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Active Layer A5 | Environmental | Open in IMG/M |
| 3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002120 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 | Environmental | Open in IMG/M |
| 3300002122 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004009 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300004024 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2 | Environmental | Open in IMG/M |
| 3300004025 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D1 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005829 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC | Environmental | Open in IMG/M |
| 3300005833 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009777 | Wastewater microbial communities from Netherlands to study Microbial Dark Matter (Phase II) - VDW unchlorinated drinking water | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011419 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT357_2 | Environmental | Open in IMG/M |
| 3300012035 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT338_2 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012673 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT399_2 | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300014321 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D1 | Environmental | Open in IMG/M |
| 3300014873 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200B_16_10D | Environmental | Open in IMG/M |
| 3300014877 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT366_16_10D | Environmental | Open in IMG/M |
| 3300014881 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_1Da | Environmental | Open in IMG/M |
| 3300014882 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231B'_16_10D | Environmental | Open in IMG/M |
| 3300014884 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_1Da | Environmental | Open in IMG/M |
| 3300015254 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT860_16_10D | Environmental | Open in IMG/M |
| 3300015256 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT333_16_10D | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018059 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019249 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020067 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT47_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021051 | Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos A1 | Environmental | Open in IMG/M |
| 3300021063 | Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos D4 | Environmental | Open in IMG/M |
| 3300021090 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redo | Environmental | Open in IMG/M |
| 3300021333 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.191 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021437 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 1-17 MG | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025002 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025311 | Groundwater microbial communities from Rifle, Colorado - Rifle CSP2_plank lowO2_0.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025327 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025538 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025551 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025560 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025569 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025580 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026351 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-B | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
| 3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
| 3300033417 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155 | Environmental | Open in IMG/M |
| 3300033813 | Sediment microbial communities from East River floodplain, Colorado, United States - 30_j17 | Environmental | Open in IMG/M |
| 3300033814 | Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17 | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| 3300034165 | Sediment microbial communities from East River floodplain, Colorado, United States - 19_s17 | Environmental | Open in IMG/M |
| 3300034177 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| A5_c1_01702310 | 2124908044 | Soil | MRQEFWMVVGTLVVPFFWILPLSRAAYARVYSRRDRRF |
| JGI11643J11755_112590011 | 3300000787 | Soil | MTRPPLYMRQEFWMVMGTLFIPFFWILPLSRAAYARVSVR |
| AF_2010_repII_A001DRAFT_101048222 | 3300000793 | Forest Soil | MTRAPWYARPEFWILMGTLFVPFFWILPLSRAAYARAAIRR |
| JGI1027J12803_1072102322 | 3300000955 | Soil | MERPAWYMKPEFWMVVGTLVVPFFWLLPLSRAAYARIN |
| C687J26616_100888091 | 3300002120 | Soil | MTRAPWYMRQEFWMLVGTLVVPFFWILPLSRAAYARVSVRRDRRF* |
| C687J26623_100070783 | 3300002122 | Soil | MTRAPWYMRQEFWMLVGTLVVPFFWILPLSRAAYARVSLRRDRRF* |
| JGIcombinedJ26739_1014491502 | 3300002245 | Forest Soil | MTRAPWYMRLEFWIVMATLFVPFFWILPLSRAAYARVS |
| Ga0055437_100190753 | 3300004009 | Natural And Restored Wetlands | MTRAPWYLRQEFWMVVGTLVVPFFWILPLSRAAYARVSLLRDRRF* |
| Ga0055437_100390033 | 3300004009 | Natural And Restored Wetlands | MTRAPWYLRQEFWMVVATLVVPFFWILPLSRAAYAWVSVLRDRHF* |
| Ga0055437_101576071 | 3300004009 | Natural And Restored Wetlands | MTRAPWYMRQEFWIVLATLIVPFFWILPLSRAAYARVSVRRERRF* |
| Ga0055436_100640013 | 3300004024 | Natural And Restored Wetlands | MTRAPWYLRQDFWMLVGTLVVPFFWILPLSRAALARVNSRRGRSF* |
| Ga0055433_100652551 | 3300004025 | Natural And Restored Wetlands | MTRAPWYMRQEFWIVLATLIVPFFWILPLSRAAYARVSIRRERRF* |
| Ga0066395_100010675 | 3300004633 | Tropical Forest Soil | MTRAPWYARPEFWILMGTLFVPFFWILPLSRAAYARAAIRRERRF* |
| Ga0066395_100868073 | 3300004633 | Tropical Forest Soil | MTRAPWYARPEFWILMGTLFVPFFWILPLSRAAYARVAIRRERRF* |
| Ga0066674_101164311 | 3300005166 | Soil | MTRAPWYMRQEFWMVVGTLVVPFFWILPLSRAAYARVYVHRERRF* |
| Ga0066685_102222553 | 3300005180 | Soil | MTRAPWYMRQEFWMVVGTLVVPFFWSLPLSRAAYARVYVHRERRF* |
| Ga0066388_1008925421 | 3300005332 | Tropical Forest Soil | MTRAPWYAKPEFWILMGTLFVPFFWILPLSRAAYARVAVRRERRF* |
| Ga0070689_1001228261 | 3300005340 | Switchgrass Rhizosphere | MTRPPLYMRQEFWMVIGTLFIPFFWILPLSRAAYARVSVRRERRF* |
| Ga0070713_1003178613 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRPPLYMRQEFWMVMGTLFIPFFWILPLSRAAYARVSVRRERRF* |
| Ga0070708_1001315322 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRAPWYLRQEFWMVVATLVVPFFWILPLSRAAYARVSARRERRF* |
| Ga0070706_1007700012 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRAPWYLRQEFWMVVATLVVPFFWILPLSRAAYAYARVSARRERRF* |
| Ga0070707_1020393681 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MERPAWYMKPEFWMVVGTLVVPFFWLLPLSRAAYARVNVRRDRRF* |
| Ga0070697_1013589501 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MERAAWYMRPEFWMMVGTLVVPFFWILPLSRAAYARVYVRRERRF* |
| Ga0070696_1011136711 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRPPLYMRQEFWMVIGTLFIPFFWILPLSRAAYARVSVRRER |
| Ga0074479_103011973 | 3300005829 | Sediment (Intertidal) | MRQEFWMVMGTLFVPFFWILPLGRAAYARASVRRERRRF* |
| Ga0074479_111456191 | 3300005829 | Sediment (Intertidal) | MTRAPWYLRQEFWMVVGTLVVPFFWILPLSRAAYARVCLRRGRHF* |
| Ga0074472_105473824 | 3300005833 | Sediment (Intertidal) | MRAPWYLRQEFWMVVGTLVVPFFWILPLSRAAYARA |
| Ga0066651_105099632 | 3300006031 | Soil | MTRAPWYLRQEFWMVVGTLVVPFFWILPLSRAAYARVSVRRERRF* |
| Ga0066652_1011845091 | 3300006046 | Soil | MTRAPWYLRQEFWMVVGTLVVPFFWILPLSRAAYARVYVHRERRF* |
| Ga0066665_109124892 | 3300006796 | Soil | MTRAPWYLRQEFWMVVGTLVVPFFWILPLSRAAYA |
| Ga0075425_1000105004 | 3300006854 | Populus Rhizosphere | MTRAPWYARPEFWILMGTLFVPFFWILPLSRAAYARVAIRRDRRF* |
| Ga0099791_106269102 | 3300007255 | Vadose Zone Soil | MTRAPWYLRQEFWMVVGTLVVPFFWILPLSRAAYARVSVHRERRF* |
| Ga0099829_100719432 | 3300009038 | Vadose Zone Soil | MTRAPWYLRQEFWMVVGTLVVPFFWILPLSRAAYARVSVPRERRF* |
| Ga0099829_101455843 | 3300009038 | Vadose Zone Soil | MRQEFWMVVGTLVVPFFWILPLSRAAYSRVSVRRGRRF* |
| Ga0099828_105462782 | 3300009089 | Vadose Zone Soil | MTQAPWYLRQEFWIVVPTLVVPFFWILPLSRAAYARVYSRRGRRF* |
| Ga0099828_106395651 | 3300009089 | Vadose Zone Soil | MTRAPWYLRQEFWMVVGTLVVPFLWILPLSRAAYARVSVRRERRF* |
| Ga0099827_118899072 | 3300009090 | Vadose Zone Soil | EFWMVVGTLVVPFFWLLPLSRAAYARVNVRRDRRF* |
| Ga0066709_1005583652 | 3300009137 | Grasslands Soil | MTRAPWYMRQEFWMVVGTLVVPFFWILPLSRAAYARVSVRRERRF* |
| Ga0105164_106481462 | 3300009777 | Wastewater | MTRAPWYLRQEFWMLVGTLVVPFFWILPLSRAAYARVNSRRGRRF* |
| Ga0126384_101190973 | 3300010046 | Tropical Forest Soil | MERAAWYMRPEFWMVVGTLVVPFFWLLPLSRAAYARVTVRRDRRF* |
| Ga0126384_101213891 | 3300010046 | Tropical Forest Soil | MTRAPWYARPEFWILMGTLFVPFFWILPLSRAAYGRVAIRRERRF* |
| Ga0126382_100027683 | 3300010047 | Tropical Forest Soil | MTRASWYARPEFWILMGTLFVPFFWILPLSRAAYARVAIRRERRF* |
| Ga0126382_100702462 | 3300010047 | Tropical Forest Soil | MERPAWYMKPEFWMVVGTLVVPFFWLLPLSRAAYARVSVRRDRRF* |
| Ga0134084_102938901 | 3300010322 | Grasslands Soil | MRQEFWMVVGTLVVPFFWILPLSRAAYARVYVHRERRF* |
| Ga0126370_102258701 | 3300010358 | Tropical Forest Soil | ATQARRSWMERAAWYMRPEFWMVVGTLVVPFFWLLPLSRAAYARVTVRRDRRF* |
| Ga0126370_117725781 | 3300010358 | Tropical Forest Soil | MTRAPWYAKPEFWILMGTLFVPFFWILPLSRAAYARVAIRRERRF* |
| Ga0126376_122245801 | 3300010359 | Tropical Forest Soil | TRRSGMTRAPWYARPEFWILMGTLFVPFFWILPLSRAAYARVAIRRERRF* |
| Ga0126376_129758441 | 3300010359 | Tropical Forest Soil | WYARPEFWILMGTLFVPFFWILPLSRAAYARVAIRRERRF* |
| Ga0136847_109118703 | 3300010391 | Freshwater Sediment | MRQEFWMVVAMLVVPFFWILPLSRAAYVRVNSRWGRPF* |
| Ga0136847_119527882 | 3300010391 | Freshwater Sediment | MRQEFWMVVGTLVVPFFWILPLSRAAYARVNSRRDRGF* |
| Ga0136847_121026971 | 3300010391 | Freshwater Sediment | MVRARWYLRQEFWMLMGTLFVPFFWILPLGRAAYARVSVRRDRRF* |
| Ga0126383_105496721 | 3300010398 | Tropical Forest Soil | MTRAPWYARPEFWILMGTLFVPFFWILPLSRAAYAR |
| Ga0137391_104660213 | 3300011270 | Vadose Zone Soil | MERPAWYMKPEFWMVVGTLVVPFFWLLPLSRAAYARVNVRRDHRF* |
| Ga0137446_10619231 | 3300011419 | Soil | PTTARRRRMTPAPWYMSQEFWMVVGTLVVPFFWILPLSRAAYARVYLRRGRRF* |
| Ga0137445_11360952 | 3300012035 | Soil | QEFWIVVGTLVVPFFWILPLSRAAYARAYSGRDRRF* |
| Ga0137389_102354082 | 3300012096 | Vadose Zone Soil | MVRAPWYLRQEFWMVVGTLVVPFFWILPLSRAAYARVSVRRERRF* |
| Ga0137388_106650232 | 3300012189 | Vadose Zone Soil | MVRAPWYLRQEFWMVVGTLVVPFFWILPLSRAAYARVSVPRERRF* |
| Ga0137365_102945662 | 3300012201 | Vadose Zone Soil | MTRAPWYLRQEFWMVVGTLVVPFFWILPLSRAAYAYARVSARRERRF* |
| Ga0137374_1000377115 | 3300012204 | Vadose Zone Soil | MTRPPWYLRQEFWIVVGTLVVPFFWILPLSRAAYARVSVRRERRF* |
| Ga0137380_106459582 | 3300012206 | Vadose Zone Soil | MRQEFWMVLGTLFIPFFWILPLSRAAYARVSIRRERRF* |
| Ga0137381_102691563 | 3300012207 | Vadose Zone Soil | MERPAWYMKPEFWMVVGTLVVPFFWLLPLSRAAYARVNLRRDRRF* |
| Ga0137379_101828771 | 3300012209 | Vadose Zone Soil | RPAWYMKPEFWMVVGTLVVPFFWLLPLSRAAYARVNLRRDRRS* |
| Ga0137379_102379781 | 3300012209 | Vadose Zone Soil | MTRAPWYLRQEFWMVVGTLVVPFFWILPLSRLAYARVSVHRERRF* |
| Ga0137339_10370171 | 3300012673 | Soil | MRHEFWMVLATLVVPFFWILPLSRAAYARVSLRRDSRF* |
| Ga0137397_100392473 | 3300012685 | Vadose Zone Soil | MTRAPWYLRQEFWMVVGTLVVPFFWILPLSRVAYARVSVRRERRF* |
| Ga0137394_113203341 | 3300012922 | Vadose Zone Soil | MTRAPWYMRQEFWMVVGTLVVPFFWILPLSRLAYARVSVRRERRF* |
| Ga0137419_115117351 | 3300012925 | Vadose Zone Soil | MTRAPWYMRLEFWMVMATLFVPFFWILPLSRAAYARVSVRRERRF* |
| Ga0137416_102476592 | 3300012927 | Vadose Zone Soil | MTRAPWYLRQEFWMVVGTLVVPFFWILPLSRLAYARVSVRRERRF* |
| Ga0153915_103293334 | 3300012931 | Freshwater Wetlands | MRRAPWYLRQEFWMLVGTLVVPFFWILPLSRAAFARVSLRRDRRF* |
| Ga0153915_128849762 | 3300012931 | Freshwater Wetlands | MTRAPWYLRQEFWMLVRTLVVPFFWILPLSRAAYARVNSRRDRRF* |
| Ga0137410_108361012 | 3300012944 | Vadose Zone Soil | WYMRQEFWMVVGTLVVPFFWILPLSRLAYARVSVRRERRF* |
| Ga0137410_108818862 | 3300012944 | Vadose Zone Soil | MRLEFWMVMATLFVPFFWILPLSRAAYARVSVRRERRF* |
| Ga0126375_111811421 | 3300012948 | Tropical Forest Soil | MERPAWYMKPEFWMVVGTLVVPFFWLLPLSRAAYARVS |
| Ga0153916_100329904 | 3300012964 | Freshwater Wetlands | MTRAPWYRRQEFWMLVGTLVVPFFWILPLSRAAYARVSLRRDRRF* |
| Ga0075353_11131252 | 3300014321 | Natural And Restored Wetlands | MTRAPWYLRQEFWMVVGTLVVPFFWILPLSRAVYARVSLRRD* |
| Ga0180066_10981282 | 3300014873 | Soil | MRQEFWMLVGTLVVPFFWILPLSRAAYARVNSRRDRRF* |
| Ga0180074_10339921 | 3300014877 | Soil | MTRAPWYLRQEFWMLVATLVVPFFWILPLSRAAYARISLRRNRHF* |
| Ga0180094_10074562 | 3300014881 | Soil | MRQEFWMVVGTLVVPFFWILPLSRAAYARVNSRRGRRI* |
| Ga0180069_10111693 | 3300014882 | Soil | MTRAPWYLRQEFWMVVGTLVVPFFWILPLSRAVYARVYLRRGRRF* |
| Ga0180104_10145123 | 3300014884 | Soil | MTRAPWYLRQEFWMVVGTLVVPFFWILPLSRAAYARVNSRRGRRI* |
| Ga0180089_10841341 | 3300015254 | Soil | MTRAPWYLRQEFWMVVGTLVVPFFWILPLSRAVYARVYLRRGRRF |
| Ga0180073_10283673 | 3300015256 | Soil | MRQEFWIVVGTLVVPFFWILPLSRAAYARVYSRRDRRF* |
| Ga0137403_103794422 | 3300015264 | Vadose Zone Soil | MTRAPWYLRQEFWMVVGTLVVPFFWILPLSRAAYARVYVRRERRF* |
| Ga0184638_12175952 | 3300018052 | Groundwater Sediment | MERAAWYMRPEFWMMVGTLVVPFFWILPLSRAAYARVYVRRERRF |
| Ga0184615_100540053 | 3300018059 | Groundwater Sediment | MTRAPWYMRQEFWIVVGTLVVPFFWILPLSRAAYARVNSRRDRRF |
| Ga0184615_102348862 | 3300018059 | Groundwater Sediment | MTRAPWYLRQEFWMLVGTLVVPFFWILPLSRAAYARVSLRRARRF |
| Ga0184615_105501241 | 3300018059 | Groundwater Sediment | MTRAPWYLRQEFWMLVGTLVVPFFWILPLSRAAYARVSARRDRRF |
| Ga0184615_105515071 | 3300018059 | Groundwater Sediment | MTRAPWYMRQEFWMVVGTLVVPFFWILPLSRAAYARVNSR |
| Ga0184619_100436312 | 3300018061 | Groundwater Sediment | MTRAPWYMRQEFWMVVGTLVVPFFWILPLSRLAYARVSVRRERRF |
| Ga0184637_105435712 | 3300018063 | Groundwater Sediment | MVRAPWYLRQEFWMLMGTLFVPFFWILPLGRAAYARASVRRDRRF |
| Ga0184633_102080452 | 3300018077 | Groundwater Sediment | MVRAPWYLRQEFWMLMGTLFVPFFWILPLGRAAYARLSVRRDRRS |
| Ga0184612_101177741 | 3300018078 | Groundwater Sediment | MTRAPWYMRQEFWMVVGTLMVPFFWIVPLSRAAYARVNSRRDRRF |
| Ga0184627_106430492 | 3300018079 | Groundwater Sediment | MTRAPWYMRQEFWMVAGTLVVPFFWILPLSRAAYARVNLRR |
| Ga0184629_104429361 | 3300018084 | Groundwater Sediment | MRQEFWMVVGTLVVPFFWILPLSRAAYARVSSRRGRRF |
| Ga0184629_105084962 | 3300018084 | Groundwater Sediment | MTRAPWYLRQEFWMVVGTLVVPFFWILPLSRAAYARVYLRRGRRF |
| Ga0066669_121903111 | 3300018482 | Grasslands Soil | MRQEFWMVVGTLVVPFFWILPLSRAAYARVSVRRERRF |
| Ga0184648_10445992 | 3300019249 | Groundwater Sediment | YLRQEFWMVVGTLVVPFFWLLPLGRAAYARVYLRRGRRF |
| Ga0180109_12440761 | 3300020067 | Groundwater Sediment | QSMTRVPWYMRQEFWILMGTLFVPFFWILPLSRAAYARVTVRRERRF |
| Ga0206224_10053991 | 3300021051 | Deep Subsurface Sediment | MTRAPWYMRQEFWMVVGTLVVPFFWILPLSRAAYARVYLRRGRRF |
| Ga0206227_10251912 | 3300021063 | Deep Subsurface Sediment | MTRAPWYIRQEFWMVVGTLVVPFFWILPLSRAAYARVSLRRDRRF |
| Ga0210377_101111782 | 3300021090 | Groundwater Sediment | MRQEFWIVVGTLVVPFFWILPLSRAAYARVNSRRDRRF |
| Ga0210377_104843921 | 3300021090 | Groundwater Sediment | MTRAPWYLRQEFWMLVGTLVVPFFWILPLSRAAYARVSLRRDRRF |
| Ga0210377_106838232 | 3300021090 | Groundwater Sediment | TTTTARRRRMTRAPWYLRQEFWMLVGTLVVPFFWILPLSRAAYARVSARRDRRF |
| Ga0210324_13261721 | 3300021333 | Estuarine | MTRAPWYMRQEFWMVMGTLFVPFFWILPLGRAAYARASVRRERRR |
| Ga0213917_10125763 | 3300021437 | Freshwater | MTRTPWYLRQEFWIVVGTLVLPFFWILPLSRAAYARVGLRRDRRF |
| Ga0126371_103569273 | 3300021560 | Tropical Forest Soil | MTRAPWYAKPEFWILMGTLFVPFFWILPLSRAAYARVAVRRERRF |
| Ga0126371_116250011 | 3300021560 | Tropical Forest Soil | MTRAPWYARREFWILMGTLFLPFFWILPLSRAAYARAAIRRERRF |
| Ga0126371_128180492 | 3300021560 | Tropical Forest Soil | MTRAPWYARPEFWILMGTLFVPFFWILPLSRAAYARVAIRRERRF |
| Ga0209001_10029314 | 3300025002 | Soil | MTRAPWYMRQEFWMLVGTLVVPFFWILPLSRAAYARVSVRRDRRF |
| Ga0209343_102152432 | 3300025311 | Groundwater | MTRAPWYMRQEFWMLVGTLVVPFFWILPLSRAAYARVSLRRDSRF |
| Ga0209751_105954813 | 3300025327 | Soil | QEFWMLVGTLVVPFFWILPLSRAAYARVSVRRDRRF |
| Ga0210132_10290232 | 3300025538 | Natural And Restored Wetlands | MTRAPWYLRQEFWMVVGTLVVPFFWILPLSRAAYARVSLLRDRRF |
| Ga0210131_10395441 | 3300025551 | Natural And Restored Wetlands | MTRAPWYMRQEFWIVLATLIVPFFWILPLSRAAYA |
| Ga0210108_10013912 | 3300025560 | Natural And Restored Wetlands | MTRAPWYMRQEFWIVLATLIVPFFWILPLSRAAYARVSIRRERRF |
| Ga0210073_10763691 | 3300025569 | Natural And Restored Wetlands | MTRAPWYMRQEFWIVLATLIVPFFWILPLSRAAYARVSIR |
| Ga0210138_10023534 | 3300025580 | Natural And Restored Wetlands | MTRAPWYMRQEFWIVLATLIVPFFWILPLSRAAYARVSVRRERRF |
| Ga0207685_106920112 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRAPWYLRQEFWMVVATLVVPFFWILPLSRAAYARVSVRRERRF |
| Ga0207646_113763951 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MERPAWYMKPEFWMVVGTLVVPFFWLLPLSRAAYARVNVRRDRRF |
| Ga0207686_100452642 | 3300025934 | Miscanthus Rhizosphere | MTRPPLYMRQEFWMVIGTLFIPFFWILPLSRAAYARVSVRRERRF |
| Ga0257170_10386091 | 3300026351 | Soil | MTRAPWYLRQEFWMVVGTLVVPFFWILPLSRAAYARVSVRRERRF |
| Ga0209117_10519892 | 3300027645 | Forest Soil | MTRAPWYMRQEFWIVVGTLVVPFFWILPLSRAAYARVYSGRDRRS |
| Ga0209466_10036504 | 3300027646 | Tropical Forest Soil | MTRAPWYARPEFWILMGTLFVPFFWILPLSRAAYARAAIRRERRF |
| Ga0208991_11745792 | 3300027681 | Forest Soil | MTRAPWYMRQEFWMVVGTLVVPFFWILPLSRAAYARVYVHRERRF |
| Ga0209180_105981861 | 3300027846 | Vadose Zone Soil | MTRAPWYMRQEFWMVVGTLVVPFFWILPLSRAAYSRVSVRRGRRF |
| Ga0137415_100524883 | 3300028536 | Vadose Zone Soil | MTRAPWYLRQEFWMVVGTLVVPFFWILPLSRLAYARVSVRRERRF |
| Ga0307504_100088371 | 3300028792 | Soil | MTRAPWYLRQEFWIVVATLVVPFFWILPLSRAAYARVSVRRERRF |
| Ga0170820_118165852 | 3300031446 | Forest Soil | LPLYMRQEFWMVMGTLFIPFFWILPLSRAAYARVSVRRERRF |
| Ga0318516_103203311 | 3300031543 | Soil | MTRAPWYARPEFWILMGTLFVPFFWILPLSRAAYA |
| Ga0307469_113142882 | 3300031720 | Hardwood Forest Soil | MERPAWYMKPEFWMMVGTLVVPFFWILPISRAAYARVYVRRERRF |
| Ga0307469_114221251 | 3300031720 | Hardwood Forest Soil | MERPAWYMKPEFWMVVGTLVVPFFWLLPLSRAAYARVNLRRDRRF |
| Ga0318494_102817411 | 3300031751 | Soil | MTRAPWYARPEFWILMGTLFVPFFWILPLSRAAYARAAI |
| Ga0307473_106678612 | 3300031820 | Hardwood Forest Soil | MTRAPWYMRQEFWMVVGTLVVPFFWLLPLSRAAYARVNSRRDRRF |
| Ga0315290_100188216 | 3300031834 | Sediment | MTRAPWYMRQEFWVVMGTLFVPFFWILPLGRAAYARVSVRRGRRF |
| Ga0315290_100747712 | 3300031834 | Sediment | MTRAPWYMRKEFWMVVATLVVPFFWMLPLSRAAYARVYLRRGRRF |
| Ga0326597_1000184518 | 3300031965 | Soil | MTRTPWYLRQEFWLLVGTLVVPFFWILPVSRAAYARVSVRRDRRF |
| Ga0326597_103869642 | 3300031965 | Soil | MTRAPWYLRQEFWMLVVALVVPFFWILPLSRAAYARVSLRRDRRF |
| Ga0326597_105596841 | 3300031965 | Soil | RRMTRPPWYLRQEFWMLVGTLVVPFFWILPLSRAAYARVSVRQDPRF |
| Ga0326597_109854082 | 3300031965 | Soil | MTRAPWYLRLEFWMLVATLVVPFFWILPLSRAAYARISLRRNRRF |
| Ga0315278_102675933 | 3300031997 | Sediment | MTQAPWYMRQEVWMVVATLVVPFFWMLPLGRAAYARVNLRRGRRF |
| Ga0315292_112259982 | 3300032143 | Sediment | MRQEFWVVMGTLFVPFFWILPLGRAAYARVSVRRGRRF |
| Ga0315281_100466373 | 3300032163 | Sediment | MTQAPWYLRQDFWMLIGTIVVPFFWVLPLSRAVYARVSLRQDRRF |
| Ga0315283_120200481 | 3300032164 | Sediment | VRRRRMTRAPWYMRKEFWMVVATLVVPFFWMLPLSRAAYARVYLRRGRRF |
| Ga0315276_110950972 | 3300032177 | Sediment | RQEVWMVVATLVVPFFWMLPLGRAAYARVNLRRGRRF |
| Ga0307471_1042679891 | 3300032180 | Hardwood Forest Soil | MTRAPWYMRQEFWMVVGTLVVPFFWLLPLSRAAYARVNSRRN |
| Ga0315271_117604481 | 3300032256 | Sediment | MTRAPWYLRQEFWMVVGTLVVPFFWILPLSRAAYARVYLRRGR |
| Ga0315287_113428381 | 3300032397 | Sediment | TTTTVRRRRMTQAPWYMRQEVWMVVATLVVPFFWMLPLGRAAYARVNLRRGRRF |
| Ga0335070_105397603 | 3300032829 | Soil | MTRDPWYLRPDFWMLIGTLVVPFFWLVPLSRAAYARVTVRRNCRF |
| Ga0334722_110083981 | 3300033233 | Sediment | MTRAPWYLRQEFWMVVGTLVVPFFWVLPLSRAAYACVYQRRGRRF |
| Ga0214472_102461112 | 3300033407 | Soil | MTRVPWYMRQEFWMLVGTLVVPFFWILPLSRAAYARVSVRRDRRF |
| Ga0214471_103214323 | 3300033417 | Soil | MTRAPWYMRQEFWMLVGTLVVPFFWILPLSRAAYARVSVRRDRCF |
| Ga0364928_0108447_71_187 | 3300033813 | Sediment | MRQEFWMVVGTLVVPFFWILPLSRAAYARVNSRRGRPF |
| Ga0364930_0247342_2_109 | 3300033814 | Sediment | EFWIVVGTLVVPFFWILPLSRAAYARVNLRRGRRF |
| Ga0326723_0041383_1035_1151 | 3300034090 | Peat Soil | MRQEFWIVLATLIVPFFWILPLSRAAYARVSVRRERRF |
| Ga0364942_0095324_772_888 | 3300034165 | Sediment | MRQEFWIVVGTLVVPFFWILPLSRAAYARVNLRRGRRF |
| Ga0364932_0350183_7_123 | 3300034177 | Sediment | MRQEFWMVVGTLVVPFFWILPLSRAAYARVSVRRDRRF |
| ⦗Top⦘ |