Basic Information | |
---|---|
Family ID | F041075 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 160 |
Average Sequence Length | 45 residues |
Representative Sequence | MAITPPRSVRIPDVLWKKAKAKAKVQHTTVTAVIVKALFDWVNEK |
Number of Associated Samples | 122 |
Number of Associated Scaffolds | 160 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 73.75 % |
% of genes near scaffold ends (potentially truncated) | 30.62 % |
% of genes from short scaffolds (< 2000 bps) | 79.38 % |
Associated GOLD sequencing projects | 111 |
AlphaFold2 3D model prediction | No |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (79.375 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (22.500 % of family members) |
Environment Ontology (ENVO) | Unclassified (48.125 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (65.000 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 62.22% β-sheet: 8.89% Coil/Unstructured: 28.89% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 160 Family Scaffolds |
---|---|---|
PF00589 | Phage_integrase | 18.12 |
PF03928 | HbpS-like | 14.38 |
PF01794 | Ferric_reduct | 7.50 |
PF00294 | PfkB | 6.88 |
PF08022 | FAD_binding_8 | 5.62 |
PF13439 | Glyco_transf_4 | 3.12 |
PF00534 | Glycos_transf_1 | 2.50 |
PF13579 | Glyco_trans_4_4 | 2.50 |
PF01370 | Epimerase | 1.88 |
PF03721 | UDPG_MGDP_dh_N | 1.88 |
PF01041 | DegT_DnrJ_EryC1 | 1.88 |
PF02424 | ApbE | 1.25 |
PF09250 | Prim-Pol | 1.25 |
PF14340 | DUF4395 | 0.62 |
PF00908 | dTDP_sugar_isom | 0.62 |
PF00005 | ABC_tran | 0.62 |
PF03354 | TerL_ATPase | 0.62 |
PF04991 | LicD | 0.62 |
PF00202 | Aminotran_3 | 0.62 |
PF13539 | Peptidase_M15_4 | 0.62 |
PF03720 | UDPG_MGDP_dh_C | 0.62 |
COG ID | Name | Functional Category | % Frequency in 160 Family Scaffolds |
---|---|---|---|
COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 1.88 |
COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 1.88 |
COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 1.88 |
COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 1.88 |
COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 1.88 |
COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 1.88 |
COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 1.88 |
COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 1.88 |
COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 1.88 |
COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 1.88 |
COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 1.88 |
COG1477 | FAD:protein FMN transferase ApbE | Posttranslational modification, protein turnover, chaperones [O] | 1.25 |
COG1898 | dTDP-4-dehydrorhamnose 3,5-epimerase or related enzyme | Cell wall/membrane/envelope biogenesis [M] | 0.62 |
COG3475 | Phosphorylcholine metabolism protein LicD | Lipid transport and metabolism [I] | 0.62 |
COG4626 | Phage terminase-like protein, large subunit, contains N-terminal HTH domain | Mobilome: prophages, transposons [X] | 0.62 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 79.38 % |
All Organisms | root | All Organisms | 20.62 % |
Visualization |
---|
Powered by ApexCharts |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 22.50% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 18.12% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 11.88% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 10.00% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 6.88% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.25% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 4.38% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 4.38% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 2.50% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.50% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.25% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.25% |
Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 1.25% |
Mine Pit Pond | Environmental → Terrestrial → Geologic → Mine → Unclassified → Mine Pit Pond | 1.25% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.62% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 0.62% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.62% |
Freshwater And Marine | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine | 0.62% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.62% |
Meromictic Pond | Environmental → Aquatic → Freshwater → Pond → Unclassified → Meromictic Pond | 0.62% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.62% |
Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine Estuarine | 0.62% |
Saline | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline | 0.62% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2236876004 | Estuarine microbial communities from Columbia River, sample from South Channel ETM site, GS313-0p1-ETM-15m | Environmental | Open in IMG/M |
3300000882 | Freshwater microbial communities from the Columbia River | Environmental | Open in IMG/M |
3300004369 | Saline microbial communities from the South Caspian sea - cas-15 | Environmental | Open in IMG/M |
3300004771 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA2.5M | Environmental | Open in IMG/M |
3300004773 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA1M | Environmental | Open in IMG/M |
3300004802 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA2M | Environmental | Open in IMG/M |
3300004804 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0M | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300007544 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 | Environmental | Open in IMG/M |
3300007545 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3 | Environmental | Open in IMG/M |
3300007547 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02 | Environmental | Open in IMG/M |
3300007549 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-02 | Environmental | Open in IMG/M |
3300007550 | Estuarine microbial communities from the Columbia River estuary - metaG 1549A-3 | Environmental | Open in IMG/M |
3300007560 | Estuarine microbial communities from the Columbia River estuary - metaG 1560A-02 | Environmental | Open in IMG/M |
3300007562 | Estuarine microbial communities from the Columbia River estuary - metaG 1561A-02 | Environmental | Open in IMG/M |
3300007590 | Estuarine microbial communities from the Columbia River estuary - metaG 1562A-02 | Environmental | Open in IMG/M |
3300007593 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-3 | Environmental | Open in IMG/M |
3300007603 | Estuarine microbial communities from the Columbia River estuary - metaG 1568-02 | Environmental | Open in IMG/M |
3300007618 | Estuarine microbial communities from the Columbia River estuary - metaG 1554A-02 | Environmental | Open in IMG/M |
3300007620 | Estuarine microbial communities from the Columbia River estuary - metaG 1546C-02 | Environmental | Open in IMG/M |
3300007621 | Estuarine microbial communities from the Columbia River estuary - metaG 1547A-3 | Environmental | Open in IMG/M |
3300007622 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 | Environmental | Open in IMG/M |
3300007624 | Estuarine microbial communities from the Columbia River estuary - metaG 1548A-02 | Environmental | Open in IMG/M |
3300007625 | Estuarine microbial communities from the Columbia River estuary - metaG 1546B-02 | Environmental | Open in IMG/M |
3300007627 | Estuarine microbial communities from the Columbia River estuary - metaG 1546A-02 | Environmental | Open in IMG/M |
3300007634 | Estuarine microbial communities from the Columbia River estuary - metaG 1555A-02 | Environmental | Open in IMG/M |
3300007639 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02 | Environmental | Open in IMG/M |
3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
3300008021 | Estuarine microbial communities from the Columbia River estuary - metaG 1569A-3 | Environmental | Open in IMG/M |
3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
3300009051 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-02 | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009470 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, surface; DNA IDBA-UD | Environmental | Open in IMG/M |
3300009563 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 5, Depth 6m; RNA IDBA-UD | Environmental | Open in IMG/M |
3300009684 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG | Environmental | Open in IMG/M |
3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300011738 | Mine pit pond microbial communities from Vermont, USA - 1M | Environmental | Open in IMG/M |
3300011918 | Mine pit pond microbial communities from Vermont, USA - 2S | Environmental | Open in IMG/M |
3300012778 | Freshwater microbial communities from Lake Croche, Canada - C_130208_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
3300013092 | Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_150m | Environmental | Open in IMG/M |
3300013285 | Freshwater microbial communities from Lower Cathedral Lake, Yosemite National Park, California, USA - 13028-31Y | Environmental | Open in IMG/M |
3300013286 | Freshwater microbial communities from Elizabeth Lake, Yosemite National Park, California, USA - 13020-23Y | Environmental | Open in IMG/M |
3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
3300020158 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L227-6m | Environmental | Open in IMG/M |
3300020164 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L304-6m | Environmental | Open in IMG/M |
3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
3300020229 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L442-12m | Environmental | Open in IMG/M |
3300020565 | Freshwater microbial communities from Lake Mendota, WI - 29APR2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
3300021069 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L224-25m | Environmental | Open in IMG/M |
3300021070 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L442-13m | Environmental | Open in IMG/M |
3300021074 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L442-17m | Environmental | Open in IMG/M |
3300021079 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L442-9m | Environmental | Open in IMG/M |
3300021340 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L442-9m | Environmental | Open in IMG/M |
3300021349 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L227-6m | Environmental | Open in IMG/M |
3300021354 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L221-5m | Environmental | Open in IMG/M |
3300021516 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L626-11m | Environmental | Open in IMG/M |
3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
3300021601 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L224-21m | Environmental | Open in IMG/M |
3300021602 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L222-5m | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
3300025455 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA2.5M (SPAdes) | Environmental | Open in IMG/M |
3300025606 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0M (SPAdes) | Environmental | Open in IMG/M |
3300027246 | Estuarine microbial communities from the Columbia River estuary - metaG 1555B-02 (SPAdes) | Environmental | Open in IMG/M |
3300027697 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes) | Environmental | Open in IMG/M |
3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027712 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027720 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027777 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027819 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW37 contaminated, 5.8 m (SPAdes) | Environmental | Open in IMG/M |
3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028392 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2) | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
3300031786 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
3300034013 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034 | Environmental | Open in IMG/M |
3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
3300034022 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058 | Environmental | Open in IMG/M |
3300034095 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091 | Environmental | Open in IMG/M |
3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
none_03313191 | 2236876004 | Marine Estuarine | MVNDMAITPPRSVRIPDVLWKKAKAKAKIQHTTVTAVIVKALFDWVNEK |
FwDRAFT_100517972 | 3300000882 | Freshwater And Marine | MAITPPRSVRIPDVLWKKAKAKAKIQHTTVTAVIVKALFDWVNEK* |
Ga0065726_144564 | 3300004369 | Saline | MAITPPRSVRIPDVLWRKAKAKAKAQHTTVTAVIVKALYEWVNEK* |
Ga0007797_10358832 | 3300004771 | Freshwater | MPLTPARSVRIPEALWKKAKAKAKAQHTTVTAIIVKALYDWVNE* |
Ga0007795_100264672 | 3300004773 | Freshwater | MPLTPARSVRIPETLWKKAKAKAKAQHTTVTAIIVKALYDWVNE* |
Ga0007801_100917333 | 3300004802 | Freshwater | MPLTPARSVRIPEALWKKAKAKAKAQHTTVTAVIVKALYDWVNE* |
Ga0007796_100505492 | 3300004804 | Freshwater | MPLTPARSVRIPETLWKKAKAKAKAQHTTVTAVIVKALYDWVNE* |
Ga0068876_101869262 | 3300005527 | Freshwater Lake | MSITPPRSVRIPDVLWKKAKAKAKAQHTTVTAVIVKALYEWVNEK* |
Ga0078894_102000302 | 3300005662 | Freshwater Lake | MAITPPRSVRIPDVLWKKAKAKAKVQHTTVTAVIVKALFDWVNEK* |
Ga0078894_104586211 | 3300005662 | Freshwater Lake | LGRSVNDMAITPPRSVRIPDVLWKKAKAKAKIQHTTVTAVIVKALFDWVNEK* |
Ga0078894_111652882 | 3300005662 | Freshwater Lake | MAITPPRSVRIPDVLWKKAKAKAKIQHTTVTAVIVKALYEWVNEK* |
Ga0078894_117671761 | 3300005662 | Freshwater Lake | VRIPDVLWKKAKAKAKVQHTTVTAVIVKALFDWVNEK* |
Ga0075464_105327862 | 3300006805 | Aqueous | MVNLMAITPPRSVRIPDVLWKKAKAKAKIQHTTVTAVIVKALFDWVNEK* |
Ga0075464_110007892 | 3300006805 | Aqueous | TLITQLLCNRRKVILMAITPPRSVRISDVLWKKAKAKAKAQHTTVTAVIVKALYNWINE* |
Ga0102861_10269982 | 3300007544 | Estuarine | MVNDMAITPPRSVRIPDVLWKKAKAKAKIQHTTVTAVIVKALFDWVNEK* |
Ga0102873_10977232 | 3300007545 | Estuarine | MAITPPRSVRIPDVLWKKAKVKAKVQHTTVTAIIVKALFDWVNEK* |
Ga0102875_10811261 | 3300007547 | Estuarine | MAITPPRSVRIPDVLWKKAKAKAKVQHTTVTAVIVKALFNWVNEK* |
Ga0102875_11551081 | 3300007547 | Estuarine | RVNNMAITPPRSVRIPDVLWKKAKVKAKVQHTTVTAVIVKALFDWVSEK* |
Ga0102875_12703782 | 3300007547 | Estuarine | IRSSHYFNYGRMVNIMAITPPRSVRIPDVLWKKAKAKAKIQHTTVTAVIVKALFDWVNEK |
Ga0102879_10470342 | 3300007549 | Estuarine | MAITPPRSVRIPDVLWKKAKAKAKVQHTTVTAVIVKALYEWVNEK* |
Ga0102880_11854992 | 3300007550 | Estuarine | MAITPPRSVRIPDVLWKKAKAKAKVQHTTVTAVIVKALFDWVSEK* |
Ga0102913_11329772 | 3300007560 | Estuarine | MVNDIAITPPRSVRIPDVLWKKAKAKAKIQHTTVTAVIVKALFDWVNEK* |
Ga0102915_10692651 | 3300007562 | Estuarine | MVNIMAITPPRSVRIPDVLWKKAKAKAKIQHTTVTAVIVKALFDWVNEK* |
Ga0102917_11373022 | 3300007590 | Estuarine | MAITPPRSVRIPDVLWKKAKAKAKIQHTTVTAVIVKALFDWVSEK* |
Ga0102918_11411142 | 3300007593 | Estuarine | MVNDMAITPPRSVRIPDVLWKKAKVKAKVQHTTVTAVIVKALFDWVSEK* |
Ga0102921_10739481 | 3300007603 | Estuarine | MVNNMAITPPRSVRIPDVLWKKAKAKAKIQHTTVTAVIVKALFDWVNEK* |
Ga0102896_12361141 | 3300007618 | Estuarine | MAITPPRSGRIPDVLWKKAKAKAKIQHTTVTAVIVKALFDWVNEK* |
Ga0102871_10469974 | 3300007620 | Estuarine | MAITPPRSVRIPDVLWKKAKVKAKVQHTTVTAVIVKALFDWVNEK* |
Ga0102872_11949192 | 3300007621 | Estuarine | VRIPDVLWKKAKAKAKIQHTTVTAVIVKALFDWVNEK* |
Ga0102863_11141391 | 3300007622 | Estuarine | IPDVLWKKAKAKAKIQHTTVTAVIVKALFDWVSEK* |
Ga0102863_11586672 | 3300007622 | Estuarine | MAITPPRSVRIPDVLWKKAKVKAKVQHTTVTAVIVKALFDWVSEK* |
Ga0102878_11475202 | 3300007624 | Estuarine | NMAITPPRSVRIPDVLWKKAKVKAKVQHTTVTAVIVKALFDWVSEK* |
Ga0102870_10797882 | 3300007625 | Estuarine | MAITPPRSVRIPDVLWKKAKAKAKIQRTTVTAVIVKALFDWVSEK* |
Ga0102869_10899961 | 3300007627 | Estuarine | MVNDMAITPPRSVRIPDVLWKKAKAKAKIQHTTVTAVIVKALFDWVSEK* |
Ga0102901_11062032 | 3300007634 | Estuarine | VNNMAITPPRSVRIPDVLWKKAKAKAKVQHTTVTAVIVKALFDWVNEK* |
Ga0102865_11302972 | 3300007639 | Estuarine | MAITPPRSVRIPDVLWKKAKVKAQVQHTTVTAVIVKALFDWVSEK* |
Ga0105748_103166681 | 3300007992 | Estuary Water | MVNNMAITPPRSVRIPDVLWKKAKAKAKIQHTTVTAVIVKALFDWVSEK* |
Ga0102922_12910811 | 3300008021 | Estuarine | MVNNMAITPPRSVRIPDVLWKKAKVKAKVQHTTVTAVIVKALFDWVSEK* |
Ga0114341_101404381 | 3300008108 | Freshwater, Plankton | MAITPPRSVRIPDVLWKKAKAKAKVQHTTVTAVIVKALFDW |
Ga0114351_10463463 | 3300008117 | Freshwater, Plankton | MAFTPPRSVRIPDVLWKKAKAKAKAQHTTVTAVIVKALYE |
Ga0114351_12209161 | 3300008117 | Freshwater, Plankton | PPRSVRIPDVLWKKAKAKAKAQHTTVTAVIVKALYEWVNEK* |
Ga0114841_10453382 | 3300008259 | Freshwater, Plankton | MAFTPPRSVRIPDVLWKKAKAKAKAQHTTVTAVIVKALYEWVNEK* |
Ga0102864_10640312 | 3300009051 | Estuarine | MAITHPRSVRIPDVLWKKAKAKAKLQHTTVTAVIVKALFDWVNEK* |
Ga0102864_11162062 | 3300009051 | Estuarine | MVNNMAITPPRSVRIPDVLWKKAKAKAKLQHTTVTAVIV |
Ga0114973_102968732 | 3300009068 | Freshwater Lake | MVNIMAITPPRSVRIPDVLWKKAKAKAKVQHTTVTAVIVKALFDWVNEK* |
Ga0114980_100850462 | 3300009152 | Freshwater Lake | MTDTPARSVRIPEKLWKQAKIKAKKEHTTISAVIVKALFDWVNE* |
Ga0114980_100974152 | 3300009152 | Freshwater Lake | MVNNMAITPPRSVRIPDVLWKKAKAKAKVQHTTVTAVIVKALFDWVSEK* |
Ga0114980_108343881 | 3300009152 | Freshwater Lake | MVKNMAITPPRSVRIPDVLWKKAKVKAKVQHTTVTAVIVKALFDWVSEK* |
Ga0114963_102327832 | 3300009154 | Freshwater Lake | MPLTPARSVRIPEALWKKAKAKAKAQHTTVTAVILKALYDWANE* |
Ga0114977_100849493 | 3300009158 | Freshwater Lake | MVKNMAITPPRSVRIPDVLWKKAKVKAKVQHTTVTAVIVKALFDWVNEK* |
Ga0114981_106713092 | 3300009160 | Freshwater Lake | MVKNMAITPPRSVRIPDVLWKKAKVKAKVQHTTVTAIIVKALFDWVNEK* |
Ga0114966_100086242 | 3300009161 | Freshwater Lake | MAITPPRSVRIPDVLWKKSKAKAKAQHTTVTAVIVKALYDWINE* |
Ga0114966_101086922 | 3300009161 | Freshwater Lake | MVNNMAITPPRSVRIPDVLWKKAKAKAKIQHTTVTSVIVKALFDWVNEK* |
Ga0114966_106483382 | 3300009161 | Freshwater Lake | AITPPRSVRIPDVLWKKAKAKAKAQHTTVTDVIVKALYDWINE* |
Ga0114974_100017783 | 3300009183 | Freshwater Lake | MQTPARSIRVPDKLWSRAKAKAKRNHTTISAVIVAALLSWVEKD* |
Ga0114974_103787022 | 3300009183 | Freshwater Lake | MVNNMAMTPPRSVRIPDVLWKKAKAKAKIQHTTVTAVIVKALFDWVNEK* |
Ga0126447_10048132 | 3300009470 | Meromictic Pond | MAITPPRSVRIPDVLWRKAKAKAKTQHTTVTAVIVKALYEWVNEK* |
Ga0126447_10509681 | 3300009470 | Meromictic Pond | MAITPPRSVRIPDVLWKKAKAKAKVQHTTVTAVIV |
Ga0130030_10199521 | 3300009563 | Meromictic Pond | MALISLKQSEARTVQGMAITPPRSVRIPDVLWRKAKAKAKTQHTTVTAVIVKALYDWVNDK* |
Ga0114958_104180771 | 3300009684 | Freshwater Lake | MPLTPARSVRIPEALWKKAKAKAKAQHTSVTAIIVKALYDWVNE* |
Ga0114964_100981602 | 3300010157 | Freshwater Lake | MALTPARSVRIPEALWKKAKAKAKAQHTTVTAIIVKALYDWVNE* |
Ga0114960_100295492 | 3300010158 | Freshwater Lake | MPLTPARSVRIPEALWKKAKAKAKAQHTTVTAIIVKALYDWANE* |
Ga0114967_106539271 | 3300010160 | Freshwater Lake | MAITPPRSVRIPDVLWKKARAKAKVQHTTVTAVIVKALFDWVN |
Ga0129324_1000042130 | 3300010368 | Freshwater To Marine Saline Gradient | MAITLPRSVRIPDVLWKKAKAKAKTQHTTVTAVIVKALYEWVNEK* |
Ga0129324_1000064828 | 3300010368 | Freshwater To Marine Saline Gradient | MAITLPRSVRIPDVLWKKAKAKAKTQHITVTAVIVKALYEWVNEK* |
Ga0129324_101333411 | 3300010368 | Freshwater To Marine Saline Gradient | MAITPPRSVRIPDVLWKKAKAKAKAQHTTVTAVIVKALYEWVNEK* |
Ga0129324_103392102 | 3300010368 | Freshwater To Marine Saline Gradient | MAITPPRSVRIPDVLWKKAKAKAKVQHTTVTAVIVKALFEWVNEK* |
Ga0133913_100157486 | 3300010885 | Freshwater Lake | MAITPPRSVRIPDALWKKTKSKAKAQHTTVTAIIVKALYDWVNE* |
Ga0133913_110263311 | 3300010885 | Freshwater Lake | GRMVNNMAITPPRSVRIPDVLWKKAKAKAKIQHTTVTAVIVKGLFDWVNEK* |
Ga0133913_112797071 | 3300010885 | Freshwater Lake | MVNNMAITPPRSVRIPDVLWKKAKAKAKIQHTTVT |
Ga0133913_116378091 | 3300010885 | Freshwater Lake | MVNNMAITPPRSVRIPDVLWKKAKAKAKVQHTTVTAIIVKALFDWVNEK* |
Ga0120086_1060792 | 3300011738 | Mine Pit Pond | MAFTPPRSVRIPDVLWRKAKAKAKAQHTTVTAVIVRALYEWVNEK* |
Ga0120090_1030972 | 3300011918 | Mine Pit Pond | VFLMAFTPPRSVRIPDVLWRKAKAKAKAQHTTVTAVIVRALYEWVNEK* |
Ga0138269_12672581 | 3300012778 | Freshwater Lake | PARSVRIPEALWKKAKAKAKAQHTTVTAVIVKALYDWVNE* |
Ga0164293_100711374 | 3300013004 | Freshwater | MVNSMAITPPRSVRIPDVLWKKAKAKAKIQHTTVTAVIVKALFDWVNE |
Ga0164293_104880151 | 3300013004 | Freshwater | RVNLMAITPPRSVRIPDVLWKKAKAKAKIQHTTVTAVIVKALFDWVNEK* |
Ga0164293_110249961 | 3300013004 | Freshwater | MAITPPRSVRIPDVLWKKAKAKAKIQHTTVTAVIVKALFEWVNEK* |
Ga0164292_100169886 | 3300013005 | Freshwater | MVNSMAITPPRSVRIPDVLWKKAKAKAKIQHTTVTAVIVKALFDWVNEK* |
Ga0164294_100924773 | 3300013006 | Freshwater | MVNNMAITPPRSVRIPDVLWKKAKAKAKVQHTTVTAVIVKALFDWVNEK* |
Ga0164294_106541172 | 3300013006 | Freshwater | MVNNMAITPPRSVRIPDVLWKKAKAKAKIQHTTVTAVIVRALFDWVNEK* |
Ga0163199_10322902 | 3300013092 | Freshwater | MVTNMAITPPRSVRIPDVLWKKAKTKAKAQHTTVTAVIVKAIYDWVNE* |
Ga0136642_10534522 | 3300013285 | Freshwater | VPITPARSVRIPEALWKKAKAKAKAQHTTVTAIIVKALYDWVNE* |
Ga0136642_11147492 | 3300013285 | Freshwater | MPITPARSVRIPEALWKKAKAKAKAQHTTVTAIIVKALYDWVNE* |
Ga0136642_11820041 | 3300013285 | Freshwater | MPLTPARSVRIPDALWKKAKAKAKAQHTTVTAIIVKALYDWVTE* |
Ga0136641_11167812 | 3300013286 | Freshwater | VPTTPARSVRIPEALWKKAKAKAKAQHTTVTAIIVKALYDWVNE* |
Ga0170791_112214781 | 3300013295 | Freshwater | PRSVRIPDVLWKKAKAKAKIQHTTVTAVIVKALFDWVNEK* |
Ga0170791_133153991 | 3300013295 | Freshwater | RSVRIPDVLWKKAKAEAKIQHTTVTAVIVKALFDWVSEK* |
Ga0170791_150584261 | 3300013295 | Freshwater | PRSVRIPDVLWKKAKAKAKVQHTTVTAVIVKALFDWVSEK* |
Ga0177922_103991371 | 3300013372 | Freshwater | TMTDTPARSVRIPEKLWKQAKIKAKKEHTTISAVIVKALFEWVNE* |
Ga0211736_102728611 | 3300020151 | Freshwater | MVNSMAITPPRSVRIPDVLWKKAKAKAKVQHTTVTAVIVKALFDWVNEK |
Ga0194038_11684961 | 3300020158 | Anoxic Zone Freshwater | MALTPARSVRIPEALWKKAKAKAKAQHTTVTAIIAKALYDWVNE |
Ga0194037_11979011 | 3300020164 | Anoxic Zone Freshwater | MALTPARSVRIPEALWKKAKAKAKAQHTTVTAIIVKALYDWVSE |
Ga0194037_12061861 | 3300020164 | Anoxic Zone Freshwater | MPLTPARSVRIPEALWKKAKAKAKAQHTTVTAIIVKALYDWVIE |
Ga0211731_112846653 | 3300020205 | Freshwater | MAITPPRSVRIPDVLWKKAKAKAKIQHTTVTAVIVKALYDWVSEK |
Ga0194042_10834771 | 3300020229 | Anoxic Zone Freshwater | MALTPARSVRIPEALWKKAKAKAKAQHTTVTAVIVKALYDWVNE |
Ga0208718_10169172 | 3300020565 | Freshwater | MAITPPRSVRIPDVLWKKAKVKAKVQHTTVTAIIVKALFDWVNEK |
Ga0194062_10468291 | 3300021069 | Anoxic Zone Freshwater | PLTPARSVRIPEALWKKAKAKAKAKAQHTTVTAVIVKALYDWVNE |
Ga0194056_100159434 | 3300021070 | Anoxic Zone Freshwater | MPLTPARSVRIPEALWKKAKAKAKAQHSTVTAIIVKALYDWVNE |
Ga0194056_100232191 | 3300021070 | Anoxic Zone Freshwater | MPLTPARSVRIPEALWKKAKAKAKAKAQHTTVTAVIVKALYDWVNE |
Ga0194044_102616712 | 3300021074 | Anoxic Zone Freshwater | MALTPARSVRIPEALWKKAKAKAKAQHTTVTAVIVKALYDW |
Ga0194055_100162184 | 3300021079 | Anoxic Zone Freshwater | MPLTPARSVRIPEALWKKAKGKAKAQHTTVTAIIVKALYDWVNE |
Ga0194055_102164532 | 3300021079 | Anoxic Zone Freshwater | MALTPARSVRIPEALWKKAKAKAKAQHTTVTAIIAKA |
Ga0194041_100471002 | 3300021340 | Anoxic Zone Freshwater | PARSVRIPEALWKKAKAKAKAQHTTVTAVIVKALYDWVNE |
Ga0194041_100865071 | 3300021340 | Anoxic Zone Freshwater | MALTPARSVRIPEALWKKAKAKAKAQHTTVTAIIVKALYDWVNE |
Ga0194052_10737682 | 3300021349 | Anoxic Zone Freshwater | MPLTPARSVRIPEALWKKAKGKAKAQHTTVTAVIVKALYDWVNE |
Ga0194047_100611632 | 3300021354 | Anoxic Zone Freshwater | MALTPARSVRIPEALWKKAKAKAKAQHTTVTAAIVKALYDWVNE |
Ga0194045_11417182 | 3300021516 | Anoxic Zone Freshwater | SVRIPEALWKKAKAKAKAQHTTVTAVIVKALYDWVNE |
Ga0194045_11900652 | 3300021516 | Anoxic Zone Freshwater | MPLTPARSVRIPEALWKKAKAKAKAKAQHTTVTAIIVKALYDWVNE |
Ga0194048_100988512 | 3300021519 | Anoxic Zone Freshwater | MVIDMAITPPRSVRIPDVLWKKAKAKAKVQHTTVTAVIVKALFDWINE |
Ga0194061_12146961 | 3300021601 | Anoxic Zone Freshwater | MALTPARSVRIPQALWKKAKAKAKAQHTTVTAIIVKALYDWVNE |
Ga0194060_102462352 | 3300021602 | Anoxic Zone Freshwater | MPLTPARSVRIPEALWKKAKAKAKAQHTTVTAIIVKALYDWVNV |
Ga0222714_104823982 | 3300021961 | Estuarine Water | MAITPPRSVRIPDVLWKKAKAKAKTQHTTVTAVIVKALYEWVNEK |
Ga0222713_101926573 | 3300021962 | Estuarine Water | MVNDMAITPPRSVRIPDVLWRKAKAKAKIQHTTVTAVIVKALFDWVNEK |
Ga0214919_100412211 | 3300023184 | Freshwater | MANMAITPPRSVRIPDVLWKKSKAKAKAQHTTVTAVIVKA |
Ga0214919_106170681 | 3300023184 | Freshwater | MAITPPRSVRIPDVLWKKAKAKAKAQHTTVTAVIVKALYDW |
Ga0244777_104258991 | 3300024343 | Estuarine | MAITPPRSVRIPDVLWKKAKAKAKIQHTTVTAVIVKALFDWVNEK |
Ga0244777_108476971 | 3300024343 | Estuarine | MAITPPRSVRIPDVLWKKAKVKAKVQHTTVTAVIVKALFDWVSEK |
Ga0244776_108144312 | 3300024348 | Estuarine | MAITPPRSMRIPDVLWKKAKAKAKAQHTTVTAVIVKALYDWINE |
Ga0208376_10700481 | 3300025455 | Freshwater | VTNMPLTPARSVRIPEALWKKAKAKAKAQHTTVTAIIVKALYDWVNE |
Ga0207954_10094741 | 3300025606 | Freshwater | MPLTPARSVRIPETLWKKAKAKAKAQHTTVTAIIVKALYDWV |
Ga0207954_11559692 | 3300025606 | Freshwater | YLHKEGYGRNMPLTPARSVRIPETLWKKAKAKAKAQHTTVTAVIVKALYDWVNE |
Ga0208931_10830742 | 3300027246 | Estuarine | MVNDMAITPPRSVRIPDVLWKKAKVKAKVQHTTVTAVIVKALFDWVSEK |
Ga0209033_11410402 | 3300027697 | Freshwater Lake | MVNNMAITPPRSVRIPDVLWKKAKAKAKVQHTTVTAVIVKALFDWVNEK |
Ga0209188_11378042 | 3300027708 | Freshwater Lake | MPLTPARSVRIPEALWKKAKAKAKAQHTTVTAVIVKALYDWVNE |
Ga0209499_10871851 | 3300027712 | Freshwater Lake | MPLTPARSVRIPEALWKKAKAKAKAQHTTVTAIIVKALY |
Ga0209617_100889622 | 3300027720 | Freshwater And Sediment | MVNNMAITPPRSVRIPDVLWKKAKAKAKIQHTTVTAVIVKALFDWVNEK |
Ga0209442_100335611 | 3300027732 | Freshwater Lake | MAITPPRSVRIPDVLWKKAKVKAKVQHTTVTAVIVKALFDWVNEK |
Ga0209297_12539092 | 3300027733 | Freshwater Lake | MVKNMAITPPRSVRIPDVLWKKAKVKAKVQHTTVTAVIVKALFDWVNEK |
Ga0209087_10420743 | 3300027734 | Freshwater Lake | MAITPPRSVRIPDVLWKKAKAKAKVQHTTVTAVIVKALFDWVNEK |
Ga0209190_10630332 | 3300027736 | Freshwater Lake | MAITPPRSVRIPDVLWKKSKAKAKAQHTTVTAVIVKALYDWINE |
Ga0209084_10716342 | 3300027749 | Freshwater Lake | MPLTPARSVRIPEALWKKAKAKAKAQHTTVTAIIVKALYDWANE |
Ga0209296_10018422 | 3300027759 | Freshwater Lake | MQTPARSIRVPDKLWSRAKAKAKRNHTTISAVIVAALLSWVEKD |
Ga0209088_104201892 | 3300027763 | Freshwater Lake | MAITPPRSVRIPDVLWKKAKAKAKVQHTTVTAVIVKALFDWV |
Ga0209134_102120551 | 3300027764 | Freshwater Lake | MAITPPRSVRIPDVLWKKAKAKAKIQHTTVTAVIVKALFDWVSEK |
Ga0209086_100197796 | 3300027770 | Freshwater Lake | MVGNMAITPPRSVRIPDVLWKKAKAKAKAQHTTVTAVIVKAIYDWVNE |
Ga0209829_100462682 | 3300027777 | Freshwater Lake | MPLTPARSVRIPETLWKKAKAKAQHTTVTAIIVKALYDWVNE |
Ga0209829_102815961 | 3300027777 | Freshwater Lake | MALTPARSVRIPEALWKKAKAKAKAQHTTVTAIIVKALYDWV |
Ga0209500_103886511 | 3300027782 | Freshwater Lake | SVRIPDVLWKKAKAKAKVQHTTVTAVIVKALFDWVSEK |
Ga0209107_105569811 | 3300027797 | Freshwater And Sediment | MVNLMAITPPRSVRIPDVLWKKAKAKAKIQHTTVTAVIVKALFDWVNEK |
Ga0209358_100364925 | 3300027804 | Freshwater Lake | MAITPPRSVRIPDVLWKKAKAKAKVQHTTVTAVIVKALFEW |
Ga0209990_102991432 | 3300027816 | Freshwater Lake | VILMSITPPRSVRIPDVLWKKAKAKAKAQHTTVTAVIVKALYEWVN |
Ga0209514_100519485 | 3300027819 | Groundwater | MTNTPPRSVRVPDKLWKQAKVKAAKEHTTISRVIINALVAYTAKGEK |
Ga0209550_108454772 | 3300027892 | Freshwater Lake | MAITPPRSVRIPDVLWKKAKAKAKIQHTTVTAVIVKALFEWVNEK |
Ga0209191_13698262 | 3300027969 | Freshwater Lake | YGRMVNIMAITPPRSVRIPDVLWKKAKAKAKIQHTTVTAVIVKALFDWVNEK |
Ga0209298_101924322 | 3300027973 | Freshwater Lake | MVNIMAITPPRSVRIPDVLWKKAKAKAKVQHTTVTAVIVKALFDWVNEK |
Ga0304729_10861822 | 3300028392 | Freshwater Lake | MPLTPARSVRIPEALWKKAKAKAKAQHTTVTAIIVKALYDWVNE |
Ga0315907_100056037 | 3300031758 | Freshwater | MSITPPRSVRIPDVLWKKAKAKAKAQHTTVTAVIVKALYEWVNEK |
Ga0315899_115815291 | 3300031784 | Freshwater | PRSVRIPDVLWKKAKAKAKVQHTTVTAVIVKALFDWVNEK |
Ga0315908_107071232 | 3300031786 | Freshwater | MAFTPPRSVRIPDVLWKKAKAKAKAQHTTVTAVIVKALYEWVNEK |
Ga0315900_1001135018 | 3300031787 | Freshwater | MAITPPRSVRIPDVLWKKAKAKAKAQHTTVTAVIVKALYEWVNEK |
Ga0315900_100516115 | 3300031787 | Freshwater | VILMAITPPRSVRIPDVLWKKAKAKAKAQHTTVTAVIVKALYEWV |
Ga0315904_100700753 | 3300031951 | Freshwater | VILMAITPPRSVRIPDVLWKKAKAKAKAQHTTVTAVIVKALYEWVNEK |
Ga0315905_114067832 | 3300032092 | Freshwater | MVNLMAITPPRSVRIPDVLWKKAKAKAKVQHTTVTAVIVKALFDWVNEK |
Ga0334996_0183536_612_749 | 3300033994 | Freshwater | MAITPPRSVRIPDVLWKKAKAKAKVQHTTVTAVIVKALFEWVNEK |
Ga0334991_0279650_45_194 | 3300034013 | Freshwater | MVNNMAITPPRSVRIPDVLWKKAKAKAKIQHTTVTAVIVKALFDWVSEK |
Ga0334985_0654762_3_125 | 3300034018 | Freshwater | MAITPPRSVRIPDVLWKKAKAKAKIQHTTVTAVIVKALFDW |
Ga0335005_0189433_1_114 | 3300034022 | Freshwater | MKNMAITPPRSVRIPDVLWKKAKAKAKVQHTTVTAVIV |
Ga0335022_0534092_145_282 | 3300034095 | Freshwater | MAITPPRSVRIPDVLWKKAKAKAKMQHTTVTAVIVKALFDWVNEK |
Ga0335029_0395717_680_829 | 3300034102 | Freshwater | MVNSMAITPPRSVRIPDVLWKKAKAKAKVQHTTVTAVIVKALFEWVNEK |
Ga0335068_0460571_453_596 | 3300034116 | Freshwater | MVNNMAITPPRSVRIPDVLWKKAKAKAKIQHTTVTAVIVKALFDWVNE |
⦗Top⦘ |