NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F040117

Metagenome / Metatranscriptome Family F040117

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F040117
Family Type Metagenome / Metatranscriptome
Number of Sequences 162
Average Sequence Length 102 residues
Representative Sequence MWFDVRYGTKFLYIVYMPQLFYLVVSYILSPVWRRTDERYHLRFADGEGDDIDETEPFVTYQQRKKPLTRRKYTDAVKLVYSGEEEYDYIPEQPLRYR
Number of Associated Samples 143
Number of Associated Scaffolds 162

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 25.31 %
% of genes near scaffold ends (potentially truncated) 11.73 %
% of genes from short scaffolds (< 2000 bps) 99.38 %
Associated GOLD sequencing projects 129
AlphaFold2 3D model prediction Yes
3D model pTM-score0.33

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (98.765 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater
(9.877 % of family members)
Environment Ontology (ENVO) Unclassified
(31.481 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(40.741 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 30.95%    β-sheet: 19.05%    Coil/Unstructured: 50.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.33
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 162 Family Scaffolds
PF01529DHHC 1.23



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000976|BBAY71_10142906All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea815Open in IMG/M
3300001102|BBAY67_10090603All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea538Open in IMG/M
3300001199|J055_10137635All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea924Open in IMG/M
3300001263|BBAY83_14703435All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea544Open in IMG/M
3300001273|B570J13893_110070All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea567Open in IMG/M
3300001273|B570J13893_110599All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea550Open in IMG/M
3300001827|ACM21_1041250All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea616Open in IMG/M
3300002161|JGI24766J26685_10072012All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea752Open in IMG/M
3300004112|Ga0065166_10530115All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea500Open in IMG/M
3300004685|Ga0065177_1083436All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea593Open in IMG/M
3300004777|Ga0007827_10065042All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea835Open in IMG/M
3300004807|Ga0007809_10103700All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea866Open in IMG/M
3300005069|Ga0071350_1017994All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1745Open in IMG/M
3300005527|Ga0068876_10415271All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea749Open in IMG/M
3300005600|Ga0070726_10610202All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea551Open in IMG/M
3300005662|Ga0078894_10350937All Organisms → Viruses → Predicted Viral1336Open in IMG/M
3300005662|Ga0078894_10375350All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1287Open in IMG/M
3300005662|Ga0078894_11036908All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea704Open in IMG/M
3300005662|Ga0078894_11063522All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea693Open in IMG/M
3300005662|Ga0078894_11156180All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea658Open in IMG/M
3300005982|Ga0075156_10635793All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea536Open in IMG/M
3300005987|Ga0075158_10492482All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea680Open in IMG/M
3300005988|Ga0075160_10372465All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea776Open in IMG/M
3300005988|Ga0075160_10469222All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea680Open in IMG/M
3300005989|Ga0075154_10547345All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea630Open in IMG/M
3300006033|Ga0075012_10859582All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea544Open in IMG/M
3300006037|Ga0075465_10122712All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea584Open in IMG/M
3300006103|Ga0007813_1092568All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea585Open in IMG/M
3300006106|Ga0007833_1071689All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea622Open in IMG/M
3300006122|Ga0007837_1066229All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea611Open in IMG/M
3300006384|Ga0075516_1264914All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea500Open in IMG/M
3300006392|Ga0075507_1519876All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea521Open in IMG/M
3300006394|Ga0075492_1418347All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea547Open in IMG/M
3300006396|Ga0075493_1000392All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea539Open in IMG/M
3300006641|Ga0075471_10609871All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea535Open in IMG/M
3300006803|Ga0075467_10452007All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea664Open in IMG/M
3300006917|Ga0075472_10068674All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1696Open in IMG/M
3300007230|Ga0075179_1004477All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea560Open in IMG/M
3300007516|Ga0105050_10603168All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea640Open in IMG/M
3300007545|Ga0102873_1225074All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea563Open in IMG/M
3300007552|Ga0102818_1076427All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea661Open in IMG/M
3300007559|Ga0102828_1146407All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea591Open in IMG/M
3300007561|Ga0102914_1048312All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1338Open in IMG/M
3300007593|Ga0102918_1217231All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea583Open in IMG/M
3300007600|Ga0102920_1152301All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea741Open in IMG/M
3300007649|Ga0102912_1040094All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1365Open in IMG/M
3300007649|Ga0102912_1176983All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea612Open in IMG/M
3300007760|Ga0105018_1147119All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea718Open in IMG/M
3300008021|Ga0102922_1219074All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea598Open in IMG/M
3300008107|Ga0114340_1215781All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea625Open in IMG/M
3300008113|Ga0114346_1290103All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea572Open in IMG/M
3300008114|Ga0114347_1227457All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea594Open in IMG/M
3300008117|Ga0114351_1407398All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea574Open in IMG/M
3300008928|Ga0103711_10062000All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea548Open in IMG/M
3300008929|Ga0103732_1032767All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea775Open in IMG/M
3300008933|Ga0103736_1045383All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea576Open in IMG/M
3300009071|Ga0115566_10320375All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea910Open in IMG/M
3300009077|Ga0115552_1454741All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea503Open in IMG/M
3300009155|Ga0114968_10271888All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea956Open in IMG/M
3300009155|Ga0114968_10544252All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea619Open in IMG/M
3300009161|Ga0114966_10622825All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea599Open in IMG/M
3300009182|Ga0114959_10629988All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea511Open in IMG/M
3300009184|Ga0114976_10687054All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea514Open in IMG/M
3300009187|Ga0114972_10170580All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1365Open in IMG/M
3300009187|Ga0114972_10556597All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea644Open in IMG/M
3300009432|Ga0115005_11295620All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea594Open in IMG/M
3300009436|Ga0115008_10814166All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea685Open in IMG/M
3300009441|Ga0115007_10896204All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea605Open in IMG/M
3300009470|Ga0126447_1132802All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea604Open in IMG/M
3300009544|Ga0115006_11406269All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea629Open in IMG/M
3300009606|Ga0115102_10954409All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea525Open in IMG/M
3300009677|Ga0115104_10390834All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea520Open in IMG/M
3300010157|Ga0114964_10432082All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea620Open in IMG/M
3300010388|Ga0136551_1044401All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea815Open in IMG/M
3300010885|Ga0133913_12540640All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1246Open in IMG/M
3300012469|Ga0150984_113415745All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea553Open in IMG/M
3300012518|Ga0129349_1348195All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea618Open in IMG/M
3300012953|Ga0163179_10445811All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1060Open in IMG/M
3300013004|Ga0164293_10425415All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea889Open in IMG/M
3300013005|Ga0164292_10813602All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea590Open in IMG/M
3300013087|Ga0163212_1259117All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea539Open in IMG/M
(restricted) 3300013126|Ga0172367_10719856All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea524Open in IMG/M
(restricted) 3300013131|Ga0172373_10771561All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea563Open in IMG/M
(restricted) 3300013132|Ga0172372_10234746All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1356Open in IMG/M
3300013295|Ga0170791_10738362All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea514Open in IMG/M
(restricted) 3300014720|Ga0172376_10486630All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea693Open in IMG/M
3300015360|Ga0163144_11709080All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea538Open in IMG/M
3300017262|Ga0186220_118373All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea532Open in IMG/M
3300017788|Ga0169931_10480850All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea884Open in IMG/M
3300017788|Ga0169931_10857348All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea577Open in IMG/M
3300017957|Ga0181571_10802385All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea558Open in IMG/M
3300018739|Ga0192974_1071548All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea563Open in IMG/M
3300018974|Ga0192873_10401309All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea551Open in IMG/M
3300018996|Ga0192916_10171315All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea643Open in IMG/M
3300019021|Ga0192982_10377215All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea506Open in IMG/M
3300019048|Ga0192981_10305976All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea591Open in IMG/M
3300019150|Ga0194244_10074183All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea605Open in IMG/M
3300019151|Ga0192888_10196554All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea615Open in IMG/M
3300020146|Ga0196977_1019825All Organisms → Viruses → Predicted Viral1622Open in IMG/M
3300020146|Ga0196977_1053581All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea959Open in IMG/M
3300020159|Ga0211734_10956879All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea566Open in IMG/M
3300020183|Ga0194115_10393603All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea598Open in IMG/M
3300020205|Ga0211731_10837241All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1069Open in IMG/M
3300021108|Ga0214162_1065744All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea592Open in IMG/M
3300021376|Ga0194130_10568311All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea568Open in IMG/M
3300021939|Ga0063095_1047965All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea500Open in IMG/M
3300024343|Ga0244777_10178883All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1365Open in IMG/M
3300024343|Ga0244777_10231178All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1180Open in IMG/M
3300024343|Ga0244777_10785264All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea563Open in IMG/M
3300024343|Ga0244777_10910925All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea513Open in IMG/M
3300025451|Ga0208426_1060528All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea584Open in IMG/M
3300025487|Ga0208105_1038257All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea877Open in IMG/M
3300025598|Ga0208379_1138722All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea555Open in IMG/M
3300025848|Ga0208005_1091944All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea946Open in IMG/M
3300025887|Ga0208544_10263290All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea685Open in IMG/M
3300025887|Ga0208544_10269631All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea674Open in IMG/M
3300027719|Ga0209467_1150104All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea839Open in IMG/M
3300027736|Ga0209190_1281542All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea644Open in IMG/M
3300027760|Ga0209598_10193342All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea865Open in IMG/M
3300027760|Ga0209598_10218336All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea793Open in IMG/M
3300027781|Ga0209175_10184879All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea892Open in IMG/M
3300027789|Ga0209174_10288220All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea721Open in IMG/M
3300027805|Ga0209229_10386222All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea609Open in IMG/M
3300027810|Ga0209302_10409105All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea612Open in IMG/M
3300027833|Ga0209092_10450844All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea665Open in IMG/M
3300027851|Ga0209066_10657498All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea516Open in IMG/M
3300027885|Ga0209450_10192568All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1435Open in IMG/M
3300027899|Ga0209668_10882848All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea602Open in IMG/M
3300027983|Ga0209284_10344511All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea745Open in IMG/M
3300030551|Ga0247638_1145052All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea572Open in IMG/M
3300030565|Ga0247635_1311655All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea516Open in IMG/M
3300030571|Ga0247652_1151704All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea565Open in IMG/M
3300030575|Ga0210288_1270365All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea502Open in IMG/M
3300030579|Ga0247633_10290311All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea531Open in IMG/M
3300030592|Ga0247612_1197516All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea518Open in IMG/M
3300030741|Ga0265459_13547719All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea547Open in IMG/M
3300030756|Ga0073968_11313860All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea514Open in IMG/M
3300030859|Ga0073963_11230426All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea601Open in IMG/M
3300031225|Ga0307942_1042179All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea2194Open in IMG/M
3300031231|Ga0170824_110499503All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea526Open in IMG/M
3300031231|Ga0170824_115006055All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea581Open in IMG/M
3300031258|Ga0302318_10406697All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea687Open in IMG/M
3300031404|Ga0307945_1159915All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea607Open in IMG/M
3300031569|Ga0307489_10093305All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1725Open in IMG/M
3300031569|Ga0307489_11430895All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea503Open in IMG/M
3300031638|Ga0302125_10184563All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea651Open in IMG/M
3300031729|Ga0307391_10907541All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea508Open in IMG/M
3300031737|Ga0307387_10913729All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea557Open in IMG/M
3300031750|Ga0307389_11223832All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea503Open in IMG/M
3300031758|Ga0315907_11074948All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea574Open in IMG/M
3300031784|Ga0315899_11329361All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea613Open in IMG/M
3300031951|Ga0315904_11253211All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea565Open in IMG/M
3300032018|Ga0315272_10400851All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea676Open in IMG/M
3300032617|Ga0314683_10892533All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea531Open in IMG/M
3300033980|Ga0334981_0396465All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea591Open in IMG/M
3300033984|Ga0334989_0488643All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea614Open in IMG/M
3300034019|Ga0334998_0573565All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea618Open in IMG/M
3300034019|Ga0334998_0691764All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea544Open in IMG/M
3300034060|Ga0334983_0594851All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea604Open in IMG/M
3300034066|Ga0335019_0442297All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea787Open in IMG/M
3300034073|Ga0310130_0299496All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea512Open in IMG/M
3300034355|Ga0335039_0503483All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea606Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater9.88%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine8.02%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous8.02%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine8.02%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake7.41%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater5.56%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine5.56%
Wastewater EffluentEngineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent4.94%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake4.32%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.32%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton2.47%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater1.85%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.85%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater1.85%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface1.85%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment1.23%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment1.23%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.23%
WatershedsEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Watersheds1.23%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater1.23%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine1.23%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine1.23%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water1.23%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.23%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil1.23%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica1.23%
Freshwater Microbial MatEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat0.62%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.62%
LoticEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Lotic0.62%
Pond Fresh WaterEnvironmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water0.62%
FreshwaterEnvironmental → Aquatic → Freshwater → Pond → Sediment → Freshwater0.62%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.62%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.62%
Marine PlanktonEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton0.62%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment0.62%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.62%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.62%
Meromictic PondEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond0.62%
Fracking WaterEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water0.62%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.62%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.62%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.62%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water0.62%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000976Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY71Host-AssociatedOpen in IMG/M
3300001102Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY67Host-AssociatedOpen in IMG/M
3300001199Lotic microbial communities from nuclear landfill site in Hanford, Washington, USA - IFRC combined assemblyEnvironmentalOpen in IMG/M
3300001263Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY83Host-AssociatedOpen in IMG/M
3300001273Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnionEnvironmentalOpen in IMG/M
3300001827Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM21, ROCA_DNA110_2.0um_23kEnvironmentalOpen in IMG/M
3300002161Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USAEnvironmentalOpen in IMG/M
3300004112Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2)EnvironmentalOpen in IMG/M
3300004685Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Jul08 (version 2)EnvironmentalOpen in IMG/M
3300004777Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Jul07EnvironmentalOpen in IMG/M
3300004807Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07EnvironmentalOpen in IMG/M
3300005069Metagenomes from Harmful Algal Blooms in Lake Erie, HABS-E2014-0024EnvironmentalOpen in IMG/M
3300005527Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaGEnvironmentalOpen in IMG/M
3300005600Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.1EnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300005982Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 8/11/14 A brown DNAEngineeredOpen in IMG/M
3300005987Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 B DNAEngineeredOpen in IMG/M
3300005988Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 C2 DNAEngineeredOpen in IMG/M
3300005989Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 7/17/14 B DNAEngineeredOpen in IMG/M
3300006033Freshwater microbial communities in response to fracking from Pennsylvania, USA - Allegheny Zone_MetaG_DW_15EnvironmentalOpen in IMG/M
3300006037Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNAEnvironmentalOpen in IMG/M
3300006103Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29Jun09EnvironmentalOpen in IMG/M
3300006106Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Jul07EnvironmentalOpen in IMG/M
3300006122Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE31Jul07EnvironmentalOpen in IMG/M
3300006384Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006392Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006394Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006396Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006641Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006917Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300007230Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 C RNA (Eukaryote Community Metatranscriptome)EngineeredOpen in IMG/M
3300007516Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01EnvironmentalOpen in IMG/M
3300007545Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3EnvironmentalOpen in IMG/M
3300007552Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.571EnvironmentalOpen in IMG/M
3300007559Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541EnvironmentalOpen in IMG/M
3300007561Estuarine microbial communities from the Columbia River estuary - metaG 1561A-3EnvironmentalOpen in IMG/M
3300007593Estuarine microbial communities from the Columbia River estuary - metaG 1563A-3EnvironmentalOpen in IMG/M
3300007600Estuarine microbial communities from the Columbia River estuary - metaG 1568A-3EnvironmentalOpen in IMG/M
3300007649Estuarine microbial communities from the Columbia River estuary - metaG 1560A-3EnvironmentalOpen in IMG/M
3300007760Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate aEnvironmentalOpen in IMG/M
3300008021Estuarine microbial communities from the Columbia River estuary - metaG 1569A-3EnvironmentalOpen in IMG/M
3300008107Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NAEnvironmentalOpen in IMG/M
3300008113Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NAEnvironmentalOpen in IMG/M
3300008114Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NAEnvironmentalOpen in IMG/M
3300008117Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008928Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_E3EnvironmentalOpen in IMG/M
3300008929Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1AEnvironmentalOpen in IMG/M
3300008933Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 2BEnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009077Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328EnvironmentalOpen in IMG/M
3300009155Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaGEnvironmentalOpen in IMG/M
3300009161Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaGEnvironmentalOpen in IMG/M
3300009182Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaGEnvironmentalOpen in IMG/M
3300009184Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaGEnvironmentalOpen in IMG/M
3300009187Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaGEnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009470Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, surface; DNA IDBA-UDEnvironmentalOpen in IMG/M
3300009544Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M MetagenomeEnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010157Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaGEnvironmentalOpen in IMG/M
3300010388Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV, may 2015EnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012518Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300013004Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaGEnvironmentalOpen in IMG/M
3300013005Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaGEnvironmentalOpen in IMG/M
3300013087Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30LEnvironmentalOpen in IMG/M
3300013126 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10mEnvironmentalOpen in IMG/M
3300013131 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10mEnvironmentalOpen in IMG/M
3300013132 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5mEnvironmentalOpen in IMG/M
3300013295northern Canada Lakes metatranscriptome co-assemblyEnvironmentalOpen in IMG/M
3300014720 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35mEnvironmentalOpen in IMG/M
3300015360Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.BULKMAT1EnvironmentalOpen in IMG/M
3300017262Metatranscriptome of marine eukaryotic communities from Tyrrhenian Sea in autoclaved artificial seawater, 19 C, 33 psu salinity and 291 ?mol photons light - Pseudokeronopsis sp. OXSARD2 (MMETSP0211)Host-AssociatedOpen in IMG/M
3300017788Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20LEnvironmentalOpen in IMG/M
3300017957Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018739Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001019 (ERX1789514-ERR1719246)EnvironmentalOpen in IMG/M
3300018974Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000809 (ERX1782160-ERR1711971)EnvironmentalOpen in IMG/M
3300018996Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000839 (ERX1782178-ERR1712156)EnvironmentalOpen in IMG/M
3300019021Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019150Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000616 (ERX1782105-ERR1711908)EnvironmentalOpen in IMG/M
3300019151Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000705 (ERX1789682-ERR1719501)EnvironmentalOpen in IMG/M
3300020146Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_10-13CEnvironmentalOpen in IMG/M
3300020159Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1EnvironmentalOpen in IMG/M
3300020183Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surfaceEnvironmentalOpen in IMG/M
3300020205Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1EnvironmentalOpen in IMG/M
3300021108Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnionEnvironmentalOpen in IMG/M
3300021376Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surfaceEnvironmentalOpen in IMG/M
3300021939Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-37M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300025451Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025487Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Jul07 (SPAdes)EnvironmentalOpen in IMG/M
3300025598Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07 (SPAdes)EnvironmentalOpen in IMG/M
3300025848Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025887Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027719Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 11 (SPAdes)EnvironmentalOpen in IMG/M
3300027736Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027760Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027781Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 C2 DNA (SPAdes)EngineeredOpen in IMG/M
3300027789Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 B DNA (SPAdes)EngineeredOpen in IMG/M
3300027805Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes)EnvironmentalOpen in IMG/M
3300027810Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027851Freshwater microbial communities in response to fracking from Pennsylvania, USA - Allegheny Zone_MetaG_DW_15 (SPAdes)EnvironmentalOpen in IMG/M
3300027885Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes)EnvironmentalOpen in IMG/M
3300027899Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)EnvironmentalOpen in IMG/M
3300027983Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-03 (SPAdes)EnvironmentalOpen in IMG/M
3300030551Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030565Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb12 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030571Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb5 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030575Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO747-VDE050SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030579Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb10 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030592Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Ab1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030741Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assemblyEnvironmentalOpen in IMG/M
3300030756Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_T_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030859Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_R_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031225Saline water microbial communities from Organic Lake, Antarctica - #175EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031258Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_1EnvironmentalOpen in IMG/M
3300031404Saline water microbial communities from Organic Lake, Antarctica - #228EnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300031638Marine microbial communities from Western Arctic Ocean, Canada - CB4_surfaceEnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031737Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031750Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031784Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112EnvironmentalOpen in IMG/M
3300031951Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120EnvironmentalOpen in IMG/M
3300032018Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_middleEnvironmentalOpen in IMG/M
3300032617Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033980Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007EnvironmentalOpen in IMG/M
3300033984Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Mar2001-rr0030EnvironmentalOpen in IMG/M
3300034019Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049EnvironmentalOpen in IMG/M
3300034060Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16May2013-rr0016EnvironmentalOpen in IMG/M
3300034066Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087EnvironmentalOpen in IMG/M
3300034073Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XLEnvironmentalOpen in IMG/M
3300034355Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Oct2015-rr0135EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
BBAY71_1014290613300000976Macroalgal SurfaceMKGNRNWAWFDHRLGTKFIYVVYFPQMVFAIFCYILTPAFRRTDERYHLRYGDGEDDDIEDFESFVTYQQRKKPMTRRKYADAVKLVYDGIEEIDYAPQQPLRYR*
BBAY67_1009060313300001102Macroalgal SurfaceVRLKSVRMKGHRNWHWFDVRFGWKFHNFVWIPQLWLFAIVYVITPVWRRNDERYHLRYGDGEDDDVEDVEPFMDYQSRKKPLTRRKYADGVKLVIGETEQFDYAPEQPQRYR*
J055_1013763523300001199LoticMWFDVRFGSKFIYLVYLPQLVFCVILYILTPVWRRLDERYHLRYGQGEDDDIEDIEPFVTYQPRKKPMTRRKYADAIKLVYGGNEELDYAPEQPQRYR*
BBAY83_1470343513300001263Macroalgal SurfaceLKALRLRSNRNWMWFDVRYGTKFLYIFYMPQLFYVTVSYLLVPVWRRLDERYHLRFSEGEIDDMDDNEPFVTYQQRKKPMTRRKYADCVKLVYGGVEEYDFTPEQPQRYR*
B570J13893_11007013300001273FreshwaterMPQLFFLTVSYILTPVWRRADERYHIRFADGEFDDIDENEPFVTYQQRKKPLTRRKYSDSVKLVYDGKEEYDYVPEQPQRYR*
B570J13893_11059913300001273FreshwaterMWFDIRYGTKFLYIFYMPQLFFLTVSYILTPVWRRADERYHIRFADGEFDDIDENEPFVTYQQRKKPLTRRKYSDSVKLVYDGKEEYDYVPEQPQRYR*
ACM21_104125013300001827Marine PlanktonMWFDQRYGVKFIFIFYIPQLLFVTASYLITPIWRRADERYHIRFADGEFDDIEDVEPFVTYQQRKRPMTRRKYADAVKLVYNGEEEYDYASEQPQRYR*
JGI24766J26685_1007201213300002161Freshwater And SedimentVGWQRVIKTFLILKFRSNFLELLRXKSVRLKSNRNWMWFDIRYGAKFLYIVYMPQLFYLVISYILSPVWHKTDERYHLRFADGEGDDIDETEPFVTYQQRKKPLTRRKYSDAVKLVYGGEEEYDYIPEQPLRYR*
Ga0065166_1053011513300004112Freshwater LakeNWMWFDVRYGTKFLYVVYMPQLFYLVVSYILSPVWRRTDERYHLRFAEGEGDDIDEAEPFVTYQQRKKPLTRRKYSDAVKLIYSGEEEYDYVPEQPLRYR*
Ga0065177_108343613300004685FreshwaterNFLELLRLKSVRLKSNRNWMWFDVRYGTKFLYVVYMPQLFYLVVSYILSPVWRRTDERYHLRFADGEGDDIDETEPFVTYQQRKKPLTRRKYTDAVKLIYSGEEEYDYIPEQPLRYR*
Ga0007827_1006504213300004777FreshwaterMWFDVRYGTKFLYVVYMPQLFYLVVSYILSPVWRRTDERYHLRFADGEGDDIDETEPFVTYQQRKKPLTRRKYTDAVKLIYSGEEEYDYIPEQPLRYR*
Ga0007809_1010370013300004807FreshwaterVGRQRVRTKFDDNKLYRSNFLELLRLKSVRLKSNRNWMWFDVRYGTKFLYVVYMPQLFYLVVSYILSPVWRRTDERYHLRFADGEGDDIDETEPFVTYQQRKKPLTRRKYTDAVKLIYSGEEEYDYIPEQPLRYR*
Ga0071350_101799413300005069FreshwaterMRYGVKFLYMFYMPQLFFLTASYALSPVWRRLDERYHLRFADGEFDDIEEVEPFVTYQQRKRPMTRRKYADAVKLVYGGSEEYDYASEQPQRYR*
Ga0068876_1041527113300005527Freshwater LakeMWFDVRYGTKFLYVVYMPQLFYLVVSYMLSPVWRRTDERYHLRFAEGEGDDIDETEPFVTYQQRKKPITRRKYSDTVKLVYSGEEEYDYVPEQPLRYR*
Ga0070726_1061020213300005600Marine SedimentMWFDIRYGWKFLYIIYMPQFIFVAILYILTPAWRRMDERYHLRFSSDEGDTNDEVEPFVNYQMRKKPVTRRKYSDAIKVVYNGVEEWDYISEQPIRYR*
Ga0078894_1035093713300005662Freshwater LakeMWFDVRYGTKFLYIVYMPQLFYLVISYLLSPVWHKTDERYHLRFAEGEGDDIDETEPFVTYQQRKKPLTRRKYSDAVKLVYSGEEEYDYIPEQPLRYR*
Ga0078894_1037535033300005662Freshwater LakeVGWQRVIKTLLILKFRSNFLELLRLKSVRLKSNRNWMWFDIRYGAKFLYIVYMPQLFYLVISYILSPVWHKTDERYHLRFADGEGDDIDETEPFVTYQQRKKPLTRRKYSDAVKLVYGGEEEYDYIPEQPLRYR*
Ga0078894_1103690813300005662Freshwater LakeLKSVRLKSNRNWMWFDVRYGTKFLYVVYMPQLFYLVVSYILSPVWRRTDERYHLRFAEGEGDDIDEAEPFVTYQQRKKPLTRRKYSDAVKLIYSGEEEYDYVPEQPLRYR*
Ga0078894_1106352223300005662Freshwater LakeLELLRLKSVRLKSNRNWMWFDVRYGTKFLYVVYMPQLFYLVVSYMLSPVWRRTDERYHLRFAEGEGDDIDETEPFVTYQQRKKPITRRKYSDSVKLVYSGEEEYDYVPEQPLRYR*
Ga0078894_1115618023300005662Freshwater LakeMWFDIRYGAKFLYIVYMPQLFYLVISYLLSPVWHRTDERYHLRFADGEGDDIDETEPFVTYQQRKKPLTRRKYSDAVKLVYNGEEEYDYIPEQPLRYR*
Ga0075156_1063579323300005982Wastewater EffluentMFYIYMPQLFFVFFSYILTPVWRRLDERYHLRFGQGEDEEIEDLEPFVTYQQRKKPMTRRKWADSIKIVYEGREEMDYAPEQPMRYR*
Ga0075158_1049248213300005987Wastewater EffluentMPQLFYLVVSYLLAPAWRRTDERYHLRFADGEGDEIDEVEPFVTYQQRKKPLTRRKYSDTVKLVYNGEEEYDYIPEQPIRYR*RTSAT
Ga0075160_1037246513300005988Wastewater EffluentMWFDIRYGTKFLYIIYMPQLFYLVVSYLLAPAWRRTDERYHLRFADGEGDEIDEVEPFVTYQQRKKPLTRRKYSDTVKLVYNGEEEYDYIPEQPIRYR*
Ga0075160_1046922213300005988Wastewater EffluentVRLKSNRNWMWFDVRYGTKFLYLIYIPNFLFLSVSYLLVPVWRRIDERYHLRFADGEVDDIDENEPFVTYQQRKKPVTRKRYSDAVKLIYEGKEEYDYISEQPLRYR*
Ga0075154_1054734523300005989Wastewater EffluentLKSVRLKSNRNWMWFDIRYGTKFLYIIYMPQLFYLVVSYLLAPAWRRTDERYHLRFADGEGDEIDEVEPFVTYQQRKKPLTRRKYSDTVKLVYNGEEEYDYIPEQPIRYR*
Ga0075012_1085958213300006033WatershedsLELLRLKSVRLKSNRNWMWFDIRYGTKFLYILYMPQLFYLVVSYLLTPVWRRGDERYHLRFADGEGDEIDEVEPFVTYQQRKKPLTRKKYSDTVKLIYNGEEEYDYIPEQPLRYR*
Ga0075465_1012271213300006037AqueousMKAQRLKSNRNWMWFDIRYGTKFLYIFYMPQLFFLTVSYILTPVWRRLDERYHIRFADGEFDDIEANEPFVTYQQRKKPLTRRKYSDAVKLVYDG*
Ga0007813_109256813300006103FreshwaterMWFDVRYGVKFLYIFYMPQLFFVSASYLLSPAYRKLDERYALRYAEGEIDELDETEPFVTYQQRKKPVTRRKYSDAVKLIYGGKEEYDYIPEMPQRYR*
Ga0007833_107168913300006106FreshwaterLKSNRNWMWFDVRYGTKFLYVVYMPQLFYLVVSYILSPVWRRTDERYHLRFADGEGDDIDETEPFVTYQQRKKPLTRRKYTDAVKLIYSGEEEYDYIPEQPLRYR*
Ga0007837_106622913300006122FreshwaterMWFDVRYGVKFLYIFYMPQLFFVSASYLLSPAYRKLDERYALRYAEGEIDELDEAEPFVTYQQRKKPVTRRKYSDAVKLIYGGKEEYDYIPEMPQRYR*
Ga0075516_126491413300006384AqueousMELLRLKAFRMKAHRNWMWFDIRYGKKFMYLLYMPQLFFVTASYLLTPAWRRGDERYHLRFADGEFDDIEEVEPFVSYQMRKKPMTRRKYADSVKLVYNGKEEYDYASE*
Ga0075507_151987623300006392AqueousMKSNRNWMWFDVRYGTKFLYIFYMPQLFFLTASYLLTPVWRRGDERYHLRFAEGDFDDIDENEPFVTYQLRKKPLTRRKYSDAVKLIYNGEEEYDYISEQPQRYR*
Ga0075492_141834713300006394AqueousMWFDIRYGSKFLYMFYMPQLVYLTGFYILTPVWRRGDERYHLRFADGEFDDIDENEPFVVYQQRKKPMTRRKYSDAIKLVYDGKEDYDYISEQP*
Ga0075493_100039213300006396AqueousMWFDMRYGAKFLYVFYMPQLFYLTASYALSPVWRRLDERYHLRFADGEFDDIEEVEPFVTYQQRKKPLTRRKYADAVKLVYDGKEEYDYASEQPQRYR*
Ga0075471_1060987113300006641AqueousMWFDIRYGTKFLYVFYFPQLLFLTFSYALTPVWRRLDERYHLRFADGEFDDIEEVEPFVVYQQRKRPYTRRKYADSIKIVYEGKEDYDYAQEQPQRYR*
Ga0075467_1045200713300006803AqueousMRYGSKFLYMFYIPQLFFLTASYALSPVWRRLDERYHLRFADGEFDDIEEVEPFVTYQQRKKPMTRRKYADAVKLVYNGKEEYDYASEQPQRYR*
Ga0075472_1006867413300006917AqueousVRLKSNRNWMWFDIRYGTKFLYVFYFPQLLFLTFSYALTPVWRRLDERYHLRFADGEFDDIEEVEPFVVYQQRKRPYTRRKYADSIKIVYEGKEDYDYAQEQPQRYR*
Ga0075179_100447713300007230Wastewater EffluentMWFDIRYGTKFLYIIYMPQLFYLVVSYLLTPVWRRTDERYHLRFADGEGDEIDEVEPFVTYQQRKKPLTRRKYSDTVKLVYNGEEEYDYIPEQPIRYR*
Ga0105050_1060316823300007516FreshwaterMWFDIRYGTKFLYILYMPQLFYLVVSYLLAPVWRKTDERYHLRFADGEGDEIDETEPFVTYQQRKKPITRRKYSDTVKLIYGGEEEYDYVSEQPLRYR*
Ga0102873_122507413300007545EstuarineLELLRLKAVRSRSNRNWMWFDVRYGTKFLYIFYMPQLFFLTASYLLSPVWRRQDERYHLRYAEGEIDDLDETEPFVTYQQRKKPVTRRKYADAVKLIYNGEEEYDFIPEQPQRYR*
Ga0102818_107642713300007552EstuarineMWFDVRYGYKFLYIVYFPQLFFLTGSYLLTPAWRKLDERYNLRYCDGEIDDLDPTEPFVTYQQRKKPVTRRKYADAIKLIYNGEEDYDYVPEQPLRYR*
Ga0102828_114640713300007559EstuarineMWFDIRYGTKFLYIVYFPQLFFLTLSYLITPIFRRMDERYHLRFADGEFDDISDNEPFVTYQLRKKPMTRRKYADSIKLVYNGNEEYDYASEQPQRYR*
Ga0102914_104831223300007561EstuarineMWFDIRYGTKFLYIFYIPQLFFLTISYILTPVWRRLDERYHIRFADGEFDDIDENEPFVTYQQRKKPLTRRKYSDSVKLVYDG*
Ga0102918_121723113300007593EstuarineMWFDIRYGTKFLYIFYIPQLFFLTISYILTPVWRRLDERYHIRFADGEFDDIDENEPFVTYQQRKKPLTRRKYSDSVKLVYDGQEEYDYVPE*
Ga0102920_115230113300007600EstuarineMWFDIRYGAKFLYIIYMPQLFYLVISYLLSPVWRKTDERYHLRFAEGEGDEIDETEPFVSYQERKKPLTRRKYSDTVKLIYNGQEEYDYIPEQPLRYR*
Ga0102912_104009413300007649EstuarineMWFDIRYGTKFLYIFYIPQLFFLTISYILTPVWRRLDERYHIRFADGEFDDIDENEPFVTYQQRKKPLTRRKYSDSVKLVYDGQEEYDYVPEQP*
Ga0102912_117698313300007649EstuarineMELLRMKAQRLKSNRNWMWFDIRYGTKFLYIFYMPQLFFVSGSYILTPVWRRMDERYHIRFADGEVDDIEENEPFVTYQQRKKPMTRRKYSDQVKLVYNGEEEYDYVSEQPQRYR*
Ga0105018_114711913300007760MarineMWFDVRYGTKFIYIFYIPQLFFLTVSYLLSPAFRKLDERYALRYAEGEIDDLDEVEPFVTYQQRKRPMTRRKYTDCVKLIYNGKEEYDFIQENP*
Ga0102922_121907413300008021EstuarineMWYDIRYGTKFLYIFYMPQLFFLTASYALTPVWRRLDERYHIRFADGEVDDIDDNELFVTYMQRKKPLTRRKYSEAVKIVYDGVEEYDYVPEQPQRYR*
Ga0114340_121578113300008107Freshwater, PlanktonEGKLHHLVQISFSSNFLELLRLKSVRLKSNRNWMWFDVRYGTKFLYVVYMPQLFYLVVSYMLSPVWRRTDERYHLRFAEGEGDDIDETEPFVTYQQRKKPITRRKYSDSVKLVYSGEEEYDYVPEQPLRYR*
Ga0114346_129010313300008113Freshwater, PlanktonMWFDVRYGTKFLYVVYMPQLFYLVVSYMLSPVWRRTDERYHLRFAEGEGDDIDETEPFVTYQQRKKPITRRKYSDSVKLVYSGEEEYDYVPEQPLRYR*
Ga0114347_122745713300008114Freshwater, PlanktonMELLRMKAQRLKSNRNWMWFDIRYGTKFLYIFYMPQLFFVSGSYILTPVWRRMDERYHIRFADGEIDDIEENEPFVTYQQRKKPMTRRKYSDQVKLVYNGEEEYDYVSEQPQRYR*
Ga0114351_140739813300008117Freshwater, PlanktonMELLRMKAVRLKSNRNWMWFDIRYGTKFLYIFYFPQLFFLTLSYVLTPVWKRGDERYHLRFADGEFDDISDNEPFVTYQLRKKPMTRRKYADSIKIVYHGNEEYDYASEQPQRYR*
Ga0103711_1006200013300008928Ocean WaterMWFDIRYGVKFLYIFYMPQLFFVTGSYLLTPVWRRLDERYHIRFADGEFDDIEDSEPFVTYQLRKKPMTRRKYADSIKLVYDGEEEYDYASEQPQRYR*
Ga0103732_103276713300008929Ice Edge, Mcmurdo Sound, AntarcticaMPQLFFLSASYLLSPVWRRLDERYALRYAEGEIDELDETEPFVTYQQRKKPLTRRKYSDAVKLVYNGQEEYDFVPEQPGRYR*
Ga0103736_104538313300008933Ice Edge, Mcmurdo Sound, AntarcticaMWFDVRYGTKFLYIFYMPQLFFLSASYLLSPVWRRLDERYALRYAEGEIDELDETEPFVTYQQRKKPLTRRKYSDAVKLVYNGQEEYDFVPEQPGRYR*
Ga0115566_1032037513300009071Pelagic MarineKFLYIFYFPQLFFLSGSYLLSPAWRKLDERYALRYAEGETDELDESEPFVTYQQRKRPVTRRKYADTIKLIYNGKEEYDFIPEQPARYR*
Ga0115552_145474113300009077Pelagic MarineGRGSNFLEILRLKAVRLKSNRNWMWFDVRYGTKFLYIFYMPQLFFLTASYLLSPVFRRLDERYHLRYAEGEIDDLDETEPFVTYQQRKKPQTRRKYADAVKLIYNGKEEYDFIPEQPQRYR*
Ga0114968_1027188833300009155Freshwater LakeMWFDIRYGAKFLYIVYMPQLFYLVISYILAPVWHKTDERYHLRFAEGEGDDIDETEPFVTYQQRKKPLTRRKYSDSVKLVYSGEEEYDYIPEQPLRYR*
Ga0114968_1054425223300009155Freshwater LakeLKAVRLRSNRNWMWFDVRYGVKFLYIFYMPQLFFVSASYLLSPAYRKLDERYALRYAEGEIDELDETEPFVTYQQRKKPVTRRKYSDAVKLIYGGKEEYDYIPEMPQRYR*
Ga0114966_1062282523300009161Freshwater LakeMWFDIRYGTKFLYIVYMPQLFYLVISYLLAPAYRKTDERYHLRFADGEGDDIDETEPFVTYQQRKKPLTRRKYSDAVKLVYNSEEEYDYIPEQPIRYR*
Ga0114959_1062998813300009182Freshwater LakeMWFDVRYGTKFLYVVYMPQLFYLVVSYILSPVWRRTDERYHLRFAEGEGDDIDEAEPFVTYQQRKKPLTRRKYSDAVKLIYSG
Ga0114976_1068705413300009184Freshwater LakeMQSGCKSTSLVLIGGLAEGKIYCFVNIFSSNFLELLRLKSVRLKSNRNWMWFDVRYGTKFLYVVYMPQLFYLVVSYMLSPVWRRTDERYHLRFAEGEGDDIDETEPFVTYQQRKKPITRRKYSDSV
Ga0114972_1017058013300009187Freshwater LakeMWFDIRYGTKFLYIFYIPQLFFLTISYILTPVWRRLDERYHIRFADGEFDDIDENEPFVTYQQRKKPLTRRKYSDSIKLVYDGQEEYDYVSEQP*
Ga0114972_1055659723300009187Freshwater LakeMWFDIRYGAKFLYIIYMPQLFYLVISYLLSPAWRKTDERYHLRFADGEGDEIDETEPFVTYQQRKKPLTRRKYTDSVKLIYSGEEEYDYVPEQPLRYR*
Ga0115005_1129562013300009432MarineMWFDQRYGVKFIFIFYIPQLVFVTASYLLTPVWRRADERYHIRFADGEFDDIEEAEPFVTYQQRKKPMTRRKYADAIKLVYNGEEEYDYASEQPQRYR*
Ga0115008_1081416623300009436MarineMWFDIRYGTKFLYVFYMPQLFFLTASYALTPVWRRLDERYHLRFADGEFDDIDEVEPFVTYQQRKKPMTRRKYADTIKIVYEGKEEYDYASEQPQRYR*
Ga0115007_1089620413300009441MarineMWFDVRYGTKFIYVFYMPQLFFVAGSYALTPIWRRLDERYHIRFSEDWFDDIEDCEPFVTYQLRKKPLTRRKYADTVKLVYDGEEEYDYATEQPQRYR*
Ga0126447_113280213300009470Meromictic PondMWFDVRYGSKFLYIFYFPQLFFLSGSYLLSPAWRKLDERYHLRYAEGEVDELDECEPFVTYQPRKKPVTRRKYTDTIKLVYNGKEEYDFIPEQPQRYR*
Ga0115006_1140626913300009544MarineMWFDMRYGAKFLYMFYMPQLFFLTASYAITPVWRRLDERYHIRFADGEFDDIEEVEPFVTYQQRKKPYTRRKYADTIKLVYEGKEEYDYAQEQPQRYR*
Ga0115102_1095440913300009606MarineVKFIFIFYIPQLVFVTASYLLTPVWRRADERYHIRFADGEFDDIDDVEPFVTYQQRKKPYTRRKYADAVKIVYEGEEDYDYASEQPQRYR*
Ga0115104_1039083423300009677MarineMWFDVRYGTKFLYVFYMPQLFFLTASYLTSPAWRKLDERYALRYAEGEIDDLDEVEPFVTYQQRKKPMTRRKYTDSVKLIYNGKEEYDYVSEQPQRYR*
Ga0114964_1043208213300010157Freshwater LakeMPQLFFLTISYVLTPVWRRLDERYHIRFADGETDDIDDNEPFVTYQQRKKPLTRRKYSDAIKLVYDGKEEYDYVPEQPQRYR*
Ga0136551_104440113300010388Pond Fresh WaterMWFDVRYGTKFLYVVYMPQLFYLVVSYILSPVWRKTDERYHLRFAEGEGDDIDETEPFVTYQQRKKPLTRRKYSDTVKLIYSGEEEYDYVPEQPLRYR*
Ga0133913_1254064023300010885Freshwater LakeMWFDIRYGTKFLYIFYIPQLFFLTVSYILTPVWRRLDERYHIRFADGEFDDIDENEPFVTYQQRKKPLTRRKYSDSIKLVYDGQEEYDYVPEQPQRYR*
Ga0150984_11341574513300012469Avena Fatua RhizosphereMWFDVRYGVKFLYIFYMPQLFYLVISYTLSPAYRRGDERYHLRFADGENDDIDEVEPFVTYQQRKKPLTRRKYTDTVKLIYEGQEQYDYIPEQPLRYR*
Ga0129349_134819513300012518AqueousMWFDIRYGTKFIYMLYIPQLFFLTASYMLTPVWRRLDERYHIRFADGEFDDIDEVEPFVTYQQRKRPYTRRKYADSVKLVYNGQEEYDYAQEQPQRYR*
Ga0163179_1044581123300012953SeawaterMWFDIRYGSKFICVIYLPQLFFVTASYLLSPIWRRTDERYHIRFAEGEYDDIEDNEPFITYQLRKKPMTRRKYADSIKLVYNGVEEYDYASEQPQRYR*
Ga0164293_1042541523300013004FreshwaterMWFDIRYGTKFLYIVYMPQLFYLVISYLLSPVWHKTDERYHLRFADGEGDDIDETEPFVTYQERKKPLTRRKYSDSVKLVYHGEEEYDYIPEQPLRYR*
Ga0164292_1081360213300013005FreshwaterMWFDIRYGTKFLYIFYMPQLFFLSASYALTPVWRRLDERYHIRFADGEVDDIDDNELFVTYMQRKKPLTRRKYSEAIKLVYDGVEEYDYVPEQPQRYR*
Ga0163212_125911713300013087FreshwaterMWFDIRYGTKFLYIIYMPQLFYVVISYILSPAWRKTDERYHLRFAEGEGDEIDETEPFVSYQERKKPLTRRKYSDAVKLIYGGEEQYDYIPEQPLRYR*
(restricted) Ga0172367_1071985613300013126FreshwaterMWFDIRYGSKFLYIFYMPQLFFLQVSYILTPVWRRADERYHIRFADGEFDDIDENEPFVTYQQRKKPLTRRKYSDAIKLVYDGKEEYDYIPEQPQRYR*
(restricted) Ga0172373_1077156123300013131FreshwaterLIDLYRSNFLELLRLKSVRLKSNRNWMWFDIRYGTKFLYIVYMPQLFYLVVSYLLSPVWRKTDERYHLRFADGEGDEIDETEPFVSYQQRKKPLTRRKYSDTVKLIYNGEEEYDYVPEQPIRYR*
(restricted) Ga0172372_1023474613300013132FreshwaterVGWERVCIRLIDLYRSNFLELLRLKSVRLKSNRNWMWFDIRYGTKFLYIVYMPQLFYLVVSYLLSPVWRKTDERYHLRFADGEGDEIDETEPFVSYQQRKKPLTRRKYSDTVKLIYNGEEEYDYVPEQPIRYR*
Ga0170791_1073836213300013295FreshwaterMWFDVRYGTKFLYVVYMPQLFYLVVSYILSPVWRRTDERYHLRFAEGEGDDIDEAEPFVTYQQRKKPLTRRKYSDAVKLIYSGEEEYDYVPEQPLRYR*
(restricted) Ga0172376_1048663013300014720FreshwaterVGWERVCIRLIDLYRSNFLELLRLKSVRLKSNRNWMWFDIRYGTKFLYIVYMPQLFYLVVSYLLSPVWRKTDERYHLRFAVGEGDEIGETEPFVSYQQRKKPLTRRKYSDTVKLIYNGEEEYDYVPEQPIRYR*
Ga0163144_1170908013300015360Freshwater Microbial MatIPFTYRSNFLELLRLKSVRLKSNRNWMWFDMRYGVKFLYIFYMPQFFFVVVSYILAPAYRRNDERYHLRFADGEVGDDLDETEPFVTYQQRKKPTTRRKYSDAVKLIYGGEEEYDYVPEQPIRYR*
Ga0186220_11837313300017262Host-AssociatedMPQLFFLVVSYLLTPAYRRLDERYHLRFADGEGDDIDEVETFVTYHQRKKPLTRKKYSDAVKLIYKGEEEYDYIPEQPIRYR
Ga0169931_1048085023300017788FreshwaterMWFDVRYGTKFLYIVYMPQLFYLVVSYILSPVWRRTDERYHLRFADGEGDDIDETEPFVTYQQRKKPLTRRKYTDAVKLVYSGEEEYDYIPEQPLRYR
Ga0169931_1085734813300017788FreshwaterMWFDIRYGSKFLYIFYMPQLFFLQVSYILTPVWRRADERYHIRFADGEFDDIDENEPFVTYQQRKKPLTRRKYSDAIKLVYDGKEEYDYIPEQPQRYR
Ga0181571_1080238513300017957Salt MarshMWFDVRYGTKFLYIFYFPQLFFISASYLLSPVWRRLDERYHLRYAEGEIDDLDETEPFVTYQQRKKPVTRRKYADAVKLIYNG
Ga0192974_107154813300018739MarineMRYGVKFLYIFYMPQLFYLTASYAITPVWRRLDERYHLRFADGEFDDIEEVEPFVTYQQRKKPYTRRKYADSIKLVYNGSEEYDYASEQPQRYR
Ga0192873_1040130913300018974MarineMWFDIRYGSKFLYVFYFPQLLYLTASYAITPVWRRLDERYHLRFADGEFDDIDEVEPFVTYQQRKRPYTRRKYADSVKLVYNGSEEYDYAQEQPQRYR
Ga0192916_1017131523300018996MarineMWFDMRYGSKFLYIFYMPQLIYLTASYAITPVWRRLDERYHLRFADGEFDDIEEVEPFVIYQQRKRPMTRRKYADAAKLVYNGKEDYDYASEQPQRYR
Ga0192982_1037721513300019021MarineMWFDVRYGTKFLYIFYIPQLFFLTASYLTSPAFRKLDERYALRYAEGEIDDLDEVEPFVTYQQRKKPMTRRKYTDSIKLVYNGKEEYDFISEQP
Ga0192981_1030597623300019048MarineMWFDVRYGSKFMYIFYIPQLLFLTVSYTLSPVWRRLDERYHLRFSEGEVDDLDEIEPFVTYQQRKKPVTRRRYADAIKLVYNGREEYDFIPE
Ga0194244_1007418313300019150MarineGSNFMELLRKKSVYLLSNRNWMWFDIRYGTKFLYIFYLPQLFFLSASYLTTPVWRRGDERYHLRFADGEFDDIDENEPFVTYQCRKKPYTRRKYADMVKLVYEGREEYDYAQEQPQRYR
Ga0192888_1019655423300019151MarineMWFDMRYGVKFLYVFYMPQLFFLTASYLMTPVWRRLDERYHLRFADGEFDDIDENEPFVTYQQRKKPMTRRKYADSIKLVYEGKEEYDYAQEQPQRYR
Ga0196977_101982513300020146SoilLLRLKSVRLKSNRNWMWFDIRYGTKFLYIFYMPQLFFLVVSYLLTPAYRRLDERYHLRFADGEGDDIDEVEPFVTYQQRKKPITRRKYSEAIKLVYHGEEEYDYISEQPLRYR
Ga0196977_105358113300020146SoilMPQLFFLVVSYLLTPAYRRLDERYHLRFADGEGDDIDEVEPFVTYQQRKKPITRRKYSEAIKLVYHGEEEYDYISEQPLRYR
Ga0211734_1095687913300020159FreshwaterMKAVRLKSNRNWMWFDIRYGTKFLYIFSFPQLFFLTLSYVLTPVWKRNDERYHLRFADGEFDDISDNEPFVTYQLRKKPMTRRKYADSIKLVYHQNEEYDYASEQPQRYR
Ga0194115_1039360313300020183Freshwater LakeMQGGCKSTSLALIGGLVEGKFYSFLISVSSNFLELLRLKSVRLKSNRNWMWFDVRYGTKFLYVVYMPQLFYLVVSYIMAPVWRRTDERYHLRFAEGEGDDIDETEPFVTYQQRKKPLTRRKYSDAVKLIYSGEEEYDYVPEQPLRYR
Ga0211731_1083724123300020205FreshwaterLELLRLKSVRLKSNRNWMWFDIRYGAKFLYIVYMPQLFYLVISYILAPVWHKTDERYHLRFAEGEGDDIDETEPFVTYQQRKKPLTRRKYSDSVKLVYSGEEEYDYIPEQPLRYR
Ga0214162_106574413300021108FreshwaterMWFDIRYGTKFLYIFYMPQLFFLTVSYILTPVWRRADERYHIRFADGEFDDIDENEPFVTYQQRKKPLTRRKYSDSVKLVYDGKEEYDYVPEQPQRYR
Ga0194130_1056831113300021376Freshwater LakeMWFDIRYGTKFLYIFYFPQLFFLTLSYLLTPVWKRNDERYHLRFADGEFDDISDNEPFVTYQLRKKPMTRRKYADSIKIVYHQNEEYDYASEQP
Ga0063095_104796513300021939MarineLKSVRLKSNRNWMWFDMRYGAKFLYMFYMPQLFFLTASYAITPVWRRLDERYHIRFADGEFDDIEEVEPFVTYQQRKKPYTRRKYADTIKLVYEGKEEYDYAQEQPQRYR
Ga0244777_1017888313300024343EstuarineMWFDIRYGTKFLYIFYIPQLFFLTISYILTPVWRRLDERYHIRFADGEFDDIDENEPFVTYQQRKKPLTRRKYSDSVKLVYDGQEEYDYVPEQP
Ga0244777_1023117843300024343EstuarineMWFDIRYGTKFLYIFYIPQLFFLTISYILTPVWRRLDERYHIRFADGEFDDIDENEPFVTYQQRKKPLTRRKYSDSVKLVYDGQEEYDYVPE
Ga0244777_1078526413300024343EstuarineLELLRLKAVRSRSNRNWMWFDVRYGTKFLYIFYMPQLFFLTASYLLSPVWRRQDERYHLRYAEGEIDDLDETEPFVTYQQRKKPVTRRKYADAVKLIYNGEEEYDFIPEQPQRYR
Ga0244777_1091092513300024343EstuarineMKAQRLKSNRNWMWFDIRYGTKFLYIFYMPQLFFVSGSYILTPVWRRMDERYHIRFADGEVDDIEENEPFVTYQQRKKPMTRRKYSDQVKLVYNGEEEYDYVSEQ
Ga0208426_106052813300025451AqueousMKAQRLKSNRNWMWFDIRYGTKFLYIFYMPQLFFLTVSYILTPVWRRLDERYHIRFADGEFDDIEANEPFVTYQQRKKPLTRRKYSDAVKLVYDG
Ga0208105_103825713300025487FreshwaterMWFDVRYGTKFLYVVYMPQLFYLVVSYILSPVWRRTDERYHLRFADGEGDDIDETEPFVTYQQRKKPLTRRKYTDAVKLIYSGEEEYDYIPEQPLRYR
Ga0208379_113872213300025598FreshwaterYMPQLFYLVVSYILSPVWRRTDERYHLRFADGEGDDIDETEPFVTYQQRKKPLTRRKYTDAVKLIYSGEEEYDYIPEQPLRYR
Ga0208005_109194413300025848AqueousMWFDIRYGTKFLYVFYFPQLLFLTFSYALTPVWRRLDERYHLRFADGEFDDIEEVEPFVVYQQRKRPYTRRKYADSIKIVYEGKEDYDYAQEQPQRYR
Ga0208544_1026329013300025887AqueousMRYGSKFLYMFYIPQLFFLTASYALSPVWRRLDERYHLRFADGEFDDIEEVEPFVTYQQRKKPMTRRKYADAVKLVYNGKEEYDYASEQPQRYR
Ga0208544_1026963113300025887AqueousMWFDMRYGAKFLYVFYMPQLFYLTASYALSPVWRRLDERYHLRFADGEFDDIEEVEPFVTYQQRKKPLTRRKYADAVKLVYDGKEEYDYASEQPQRYR
Ga0209467_115010413300027719FreshwaterMEILRLKSVRLKSNRNWMWFDVRYGTKFLYLFYMPQLFYVVVSYILVPAYRRLDERYHLRFSDGEGDDIDETEPFVTYQERKKPLSRRKYSDVVKITYKGEEEYDYVPEQPLRYR
Ga0209190_128154213300027736Freshwater LakeMTLSSCTSISRVLTGGPAEGNSLHFDHLVFRSNFLELLRLKSVRLKSNRNWMWFDIRYGTKFLYIVYMPQLFYLVISYLLAPAYRKTDERYHLRFADGEGDDIDETEPFVTYQQRKKPLTRRKYSDAVKLVYNSEEEYDYIPEQPIRYR
Ga0209598_1019334223300027760Freshwater LakeMWFDIRYGAKFLYIIYMPQLFYLVISYLLSPAWRKTDERYHLRFADGEGDEIDETEPFVTYQQRKKPLTRRKYTDSVKLIYSGEEEYDYVPEQPLRYR
Ga0209598_1021833613300027760Freshwater LakeLELLRLKSVRLKSNRNWMWFDVRYGTKFLYVVYMPQLFYLVVSYMLSPVWRRTDERYHLRFAEGEGDDIDETEPFVTYQQRKKPITRRKYSDSVKLVYSGEEEYDYVPEQPLRYR
Ga0209175_1018487913300027781Wastewater EffluentMWFDIRYGTKFLYIIYMPQLFYLVVSYLLAPAWRRTDERYHLRFADGEGDEIDEVEPFVTYQQRKKPLTRRKYSDTVKLVYNGEEEYDYIPEQPIRYR
Ga0209174_1028822013300027789Wastewater EffluentMPQLFYLVVSYLLAPAWRRTDERYHLRFADGEGDEIDEVEPFVTYQQRKKPLTRRKYSDTVKLVYNGEEEYDYIPEQPIRYR
Ga0209229_1038622213300027805Freshwater And SedimentVGWQRVIKTFLILKFRSNFLELLRLKSVRLKSNRNWMWFDIRYGAKFLYIVYMPQLFYLVISYILSPVWHKTDERYHLRFADGEGDDIDETEPFVTYQQRKKPLTRRKYSDAVKLVYGGEEEYDYIPEQPLRYR
Ga0209302_1040910513300027810MarineMWFDVRYGTKFIYVFYMPQLFFVAGSYALTPIWRRLDERYHIRFSEDWFDDIEDCEPFVTYQLRKKPLTRRKYADTVKLVYDGEEEYDYATEQPQRYR
Ga0209092_1045084423300027833MarineMWFDIRYGTKFLYVFYMPQLFFLTASYALTPVWRRLDERYHLRFADGEFDDIDEVEPFVTYQQRKKPMTRRKYADTIKIVYEGKEEYDYASEQPQRYR
Ga0209066_1065749813300027851WatershedsLELLRLKSVRLKSNRNWMWFDIRYGTKFLYILYMPQLFYLVVSYLLTPVWRRGDERYHLRFADGEGDEIDEVEPFVTYQQRKKPLTRKKYSDTVKLIYNGEEEYDYIPEQPLRYR
Ga0209450_1019256823300027885Freshwater Lake SedimentMRYGVKFLYMFYMPQLFFLTASYALSPVWRRLDERYHLRFADGEFDDIEEVEPFVTYQQRKRPMTRRKYADAVKLVYGGSEEYDYASEQPQRY
Ga0209668_1088284813300027899Freshwater Lake SedimentMKAVRLKSNRNWMWFDIRYGAKFLYIIYMPQLFYLVISYLLSPAWRKTDERYHLRFADGEGDEIDETEPFVTYQQRKKPLTRRKYTDSVKLIYSGEEEYDYVPEQPLRYR
Ga0209284_1034451113300027983FreshwaterMIRSSSTSTSPTPTGGLAEGKLSPFNFIFRSNFLELLRLKSVRLKSNRNWMWFDIRYGTKFLYILYMPQLFYLVVSYLLAPVWRKTDERYHLRFADGEGDEIDETEPFVTYQQRKKPITRRKYSDTVKLIYGGEEEYDYVSEQPLRYR
Ga0247638_114505213300030551SoilMWFDIRYGTKFLYMFYMPQLFYLVISYLLTPAWRRLDERYHLRFAEGEFDDIDEVEPFVTYQQRKKPVTRRKYSDTVKLIYNGEEEYDYVPEQPQRYR
Ga0247635_131165513300030565SoilMWFDVRYGSKFLYILYMPSLFFLVASYILTPVWRRVDERYHLRFAEGEGDDIEEVEPFVTYQQRKKPLTRRKYSDAVKLIYNGIEEYDYVPE
Ga0247652_115170413300030571SoilLKSVRLKSNRNWMWFDIRYGTKFLYMFYMPQLFYLVISYLLTPAWRRLDERYHLRFAEGEFDDIDEVEPFVTYQQRKKPVTRRKYSDTVKLIYNGEEEYDYVPEQPQRYR
Ga0210288_127036513300030575SoilMPQLFFLVVSYLLTPVWRRTDERYHLRFADGETDDIDEAEPFVKYQERKRPVTRRKYSDSVKLIYKGIEQYDYIPEQPQRYR
Ga0247633_1029031123300030579SoilMWFDVRYGTKFLYIFYMPQLFFLVVSYLLTPVWRRLDERYHLRFADGEGDDIDEIEPFVSYQERKKPMTRRKYSEAIKLIYHGEEDYDYIPEQPLRYR
Ga0247612_119751613300030592SoilMWFDVRYGSKFLYILYMPSLFFLVASYILTPVWRRVDERYHLSLEEGEGDDIEEVEPFVTYQQRKKPLTRRKYSDAVKLIYNGIEEYDYVPE
Ga0265459_1354771913300030741SoilMWFDIRYGSKFLYIIYAPQFLFLTVSYLLVPVWRRTDERYHLRFADGEVDDIDENEPFVTYQQRKKPLTRRKYSDAVKLVYGGVEEYDYIPEQPQRYR
Ga0073968_1131386013300030756MarineMKSNRNWMWFDVRYGTKFLYIFYMPQLFFLTASYLLTPVWRRGDERYHLRFAEGEFDDIDENEPFVTYQLRKKPLTRRKYSDAVKLIYNGQEEYDYISEQPQRYR
Ga0073963_1123042613300030859MarineMWFDVRYGTKFLYIFYLPQLFFLSASYAVTPVWRRLDERYHLRFADGEFDDIDENEAFVTYQMRKKPYTRRKYADTVKIVYEGKEDYDYAQEQP
Ga0307942_104217913300031225Saline WaterLLKPNRKRTGGLAEGKISTNNDRTGFLELLRLKAVRMKSNRNWMWFDIRYGWKFIYFIYMPNFFFVTLSYVLSPAWRKLDERYALRFSDSEGDEIDDIEPYVTYQMRKKPLTRRKYSETIKLVYNEKEEWDYIPEQPIRYR
Ga0170824_11049950313300031231Forest SoilLELLRLKSVRLKSNRNWMWFDVRYGTKFLYIIYMPQLFYLVLSYLLTPCWRRNDERYHLRFADGEGDDIDEIEPFVTYQQRKKPLTRRKYSDMIKLVYHGEEEYDYIQEQPQRYR
Ga0170824_11500605513300031231Forest SoilMWFDVRYGTKFLYIFYIPQLFYLVVSYLLTPVWRRGDERYHLRFADGEFDDTDEVEPFVTYQQRKKPVTRRKYTDAVKLIYNGVEEYDYIPEQPQRYR
Ga0302318_1040669713300031258BogMWFDVRYGTKFLYIIYMPQLFYLVVSYLLSPVWRKTDERYHLRFADGEGDDIDETEPFVTYQQRKKPMTRRKYSDSVKLVYSGEEEYDYISEQPLRYR
Ga0307945_115991513300031404Saline WaterMKSNRNWMWFDIRYGWKFIYFIYMPNFFFVTLSYVLSPAWRKLDERYALRFSDSEGDEIDDIEPYVTYQMRKKPLTRRKYSETIKLVYNEKEEWDYIPEQPIRYR
Ga0307489_1009330533300031569Sackhole BrineMWFDIRYGSKFLYMFYLPQLFFLTVSYALSPIWRRLDERYHLRFADGEFDDIEEVEPFVTYQQRKKPMTRRKYADSVKLVYNGNEEYDYASEQPQRYR
Ga0307489_1143089513300031569Sackhole BrineGSNFLEILRLKAVRTKSNRNWMWFDVRYGAKFLYIFYMPQLFFLTASYLLSPVWRRLDERYHLRYAEGEIDDLDETEPFVTYQQRKKPVTRRKYADAVKLIYNQKEEYDFIPEQP
Ga0302125_1018456313300031638MarineMWFDIRYGTKFLYVFYFPQLLFLTASYAITPVWRRLDERYHLRFADGEFDDIDEVEPFVTYQQRKKPYTRRKYADAVKLVYEGKEEYDYAQEQPQRYR
Ga0307391_1090754113300031729MarineLKSGRLKSNRNWMWFDIRYGVKFLYIFYMPQLFYLTASYAITPVWRRLDERYHLRFADGEFDDIEEVEPFVTYQQRKRPMTRRKYADSIKLVYNGSEEYDYAQEQPQRYR
Ga0307387_1091372923300031737MarineMRYGSKFLYMFYMPQLFFLTASYALTPVWRRLDERYHLRFADGEFDDIDEVEPFVTYQQRKRPLTRRKFADSVKLVYNGSEEYDYASEQPQRYR
Ga0307389_1122383223300031750MarineMWFDVRYGTKFLYIFYMPQLFFLTASYLTSPAWRKLDERYALRYAEGEIDDLDEVEPFVTYQQRKKPMTRRKYTDCVKLIYNGKEEYDFVSE
Ga0315907_1107494813300031758FreshwaterMKAVRLKSNRNWMWFDIRYGTKFLYIFYFPQLFFLTLSYVLTPVWKRGDERYHLRFADGEFDDISDNEPFVTYQLRKKPMTRRKYADSIKIVYHGNEEYDYASEQPQRYR
Ga0315899_1132936113300031784FreshwaterMWFDIRYGTKFLYIFYMPQLFFVSGSYILTPVWRRMDERYHIRFADGEIDDIEENEPFVTYQQRKKPMTRRKYSDQVKLVYNGEEEYDYVSEQPQRYR
Ga0315904_1125321113300031951FreshwaterRLKSVRLKSNRNWMWFDVRYGTKFLYVVYMPQLFYLVVSYMLSPVWRRTDERYHLRFAEGEGDDIDETEPFVTYQQRKKPITRRKYSDTVKLVYSGEEEYDYVPEQPLRYR
Ga0315272_1040085113300032018SedimentMWFDIRYGVKFLYIFYMPQLFFLTASYALSPVWRRLDERYHLRFADGEFDDIEEVEPFVTYQQRKRPYTRRKYADAVKLVYNG
Ga0314683_1089253313300032617SeawaterMWFDIRYGVKFLYVFYMPQLFFLTVSYVLAAIWRRSDERYHLRFADGEFDDIDENEPFVTYQMRKKPMTRRKYADSVKLVYGG
Ga0334981_0396465_65_3613300033980FreshwaterMWFDIRYGTKFLYIVYFPQLFFLTLSYLITPIFRRMDERYHLRFADGEFDDISDNEPFVTYQLRKKPMTRRKYADAVKLVYNGNEEYDYASEQPQRYR
Ga0334989_0488643_75_3713300033984FreshwaterMWYDIRYGTKFLYIFYMPQLFFLTASYALTPVWRRLDERYHIRFADGEVDDIDDNELFVTYMQRKKPLTRRKYSEAVKIVYDGVEEYDYVPEQPQRYR
Ga0334998_0573565_190_5373300034019FreshwaterMELLRMKAQRLKSNRNWMWFDIRYGTKFLYIFYMPQLFFVSGSYILTPVWRRMDERYHIRFADGEIDDIEENEPFVTYQQRKKPMTRRKYSDQVKLVYNGEEEYDYVSEQPQRYR
Ga0334998_0691764_3_2753300034019FreshwaterMWFDVRYGTKFLYVVYMPQLFYLVVSYMLSPVWRRTDERYHLRFAEGEGDDIDETEPFVTYQQRKKPITRRKYSDSVKLVYSGEEEYDYVP
Ga0334983_0594851_235_5313300034060FreshwaterMWFDIRYGTKFLYIFYMPQLFFLTASYALTPVWRRLDERYHIRFADGEVDDIDDNELFVTYMQRKKPLTRRKYSEAVKIVYDGVEEYDYVPEQPQRYR
Ga0335019_0442297_229_5253300034066FreshwaterMWFDVRYGTKFLYVVYMPQLFYLVVSYMLSPVWRRTDERYHLRFAEGEGDDIDETEPFVTYQQRKKPITRRKYSDSVKLVYSGEEEYDYVPEQPLRYR
Ga0310130_0299496_7_3033300034073Fracking WaterMWFDVRYGTKFLYIFYMPQLFFLTASYLLSPVWRRQDERYHLRYSEGEIDDLDETEPFVTYQQRKKPVTRRKYADAVKLIYNGEEEYDFIPEQPQRYR
Ga0335039_0503483_72_3683300034355FreshwaterMWFDIRYGTKFLYIFYMPQLFFLSASYALTPVWRRLDERYHIRFADGEVDDIDDNELFVTYMQRKKPLTRRKYSEAIKLVYDGVEEYDYVPEQPQRYR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.