| Basic Information | |
|---|---|
| Family ID | F039794 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 163 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MGPSASPYSVGVPEKVSYAAEYPARTFPCQRFDAALASGSA |
| Number of Associated Samples | 153 |
| Number of Associated Scaffolds | 163 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 20.13 % |
| % of genes near scaffold ends (potentially truncated) | 63.19 % |
| % of genes from short scaffolds (< 2000 bps) | 82.21 % |
| Associated GOLD sequencing projects | 149 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.18 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (82.822 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (9.202 % of family members) |
| Environment Ontology (ENVO) | Unclassified (17.178 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (41.718 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 11.59% β-sheet: 0.00% Coil/Unstructured: 88.41% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.18 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 163 Family Scaffolds |
|---|---|---|
| PF00078 | RVT_1 | 30.06 |
| PF03551 | PadR | 1.23 |
| PF09912 | DUF2141 | 1.23 |
| PF00903 | Glyoxalase | 1.23 |
| PF01042 | Ribonuc_L-PSP | 1.23 |
| PF13565 | HTH_32 | 1.23 |
| PF12697 | Abhydrolase_6 | 1.23 |
| PF00589 | Phage_integrase | 0.61 |
| PF00702 | Hydrolase | 0.61 |
| PF04335 | VirB8 | 0.61 |
| PF01940 | DUF92 | 0.61 |
| PF01053 | Cys_Met_Meta_PP | 0.61 |
| PF00990 | GGDEF | 0.61 |
| PF13533 | Biotin_lipoyl_2 | 0.61 |
| PF01965 | DJ-1_PfpI | 0.61 |
| PF01022 | HTH_5 | 0.61 |
| PF00437 | T2SSE | 0.61 |
| PF13601 | HTH_34 | 0.61 |
| PF07690 | MFS_1 | 0.61 |
| PF10431 | ClpB_D2-small | 0.61 |
| PF00724 | Oxidored_FMN | 0.61 |
| PF12867 | DinB_2 | 0.61 |
| PF13407 | Peripla_BP_4 | 0.61 |
| PF00924 | MS_channel | 0.61 |
| PF00155 | Aminotran_1_2 | 0.61 |
| PF04011 | LemA | 0.61 |
| PF00106 | adh_short | 0.61 |
| PF08401 | ArdcN | 0.61 |
| PF13338 | AbiEi_4 | 0.61 |
| PF09835 | DUF2062 | 0.61 |
| PF10415 | FumaraseC_C | 0.61 |
| PF05016 | ParE_toxin | 0.61 |
| PF14104 | DUF4277 | 0.61 |
| PF02661 | Fic | 0.61 |
| PF09364 | XFP_N | 0.61 |
| PF00805 | Pentapeptide | 0.61 |
| PF08207 | EFP_N | 0.61 |
| PF04434 | SWIM | 0.61 |
| PF01609 | DDE_Tnp_1 | 0.61 |
| PF00848 | Ring_hydroxyl_A | 0.61 |
| PF00271 | Helicase_C | 0.61 |
| PF08327 | AHSA1 | 0.61 |
| COG ID | Name | Functional Category | % Frequency in 163 Family Scaffolds |
|---|---|---|---|
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 1.23 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 1.23 |
| COG4638 | Phenylpropionate dioxygenase or related ring-hydroxylating dioxygenase, large terminal subunit | Inorganic ion transport and metabolism [P] | 1.23 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 1.23 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 1.23 |
| COG4100 | Cystathionine beta-lyase family protein involved in aluminum resistance | Inorganic ion transport and metabolism [P] | 0.61 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.61 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.61 |
| COG3264 | Small-conductance mechanosensitive channel MscK | Cell wall/membrane/envelope biogenesis [M] | 0.61 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.61 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.61 |
| COG3736 | Type IV secretory pathway, component VirB8 | Intracellular trafficking, secretion, and vesicular transport [U] | 0.61 |
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.61 |
| COG4227 | Antirestriction protein ArdC | Replication, recombination and repair [L] | 0.61 |
| COG4279 | Uncharacterized protein, contains SWIM-type Zn finger domain | Function unknown [S] | 0.61 |
| COG4715 | Uncharacterized protein, contains SWIM-type Zn finger domain | Function unknown [S] | 0.61 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.61 |
| COG5431 | Predicted nucleic acid-binding protein, contains SWIM-type Zn-finger domain | General function prediction only [R] | 0.61 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.61 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.61 |
| COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 0.61 |
| COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 0.61 |
| COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 0.61 |
| COG1902 | 2,4-dienoyl-CoA reductase or related NADH-dependent reductase, Old Yellow Enzyme (OYE) family | Energy production and conversion [C] | 0.61 |
| COG1836 | Cytidylyltransferase family enzyme | General function prediction only [R] | 0.61 |
| COG1704 | Magnetosome formation protein MamQ, lipoprotein antigen LemA family | Cell wall/membrane/envelope biogenesis [M] | 0.61 |
| COG1357 | Uncharacterized conserved protein YjbI, contains pentapeptide repeats | Function unknown [S] | 0.61 |
| COG0668 | Small-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 0.61 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.61 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.61 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.61 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.61 |
| COG0231 | Translation elongation factor P (EF-P)/translation initiation factor 5A (eIF-5A) | Translation, ribosomal structure and biogenesis [J] | 0.61 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.61 |
| COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 0.61 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 82.82 % |
| Unclassified | root | N/A | 17.18 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459010|GIO7OMY01ETGZK | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300001089|JGI12683J13190_1006465 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 1252 | Open in IMG/M |
| 3300001180|JGI12695J13573_1001184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Caballeronia → Caballeronia arationis | 1967 | Open in IMG/M |
| 3300001411|JGI20182J14882_100694 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1068 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100146561 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Caballeronia → Caballeronia arationis | 2231 | Open in IMG/M |
| 3300002558|JGI25385J37094_10123562 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 731 | Open in IMG/M |
| 3300002561|JGI25384J37096_10143476 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 770 | Open in IMG/M |
| 3300004137|Ga0058883_1534749 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 614 | Open in IMG/M |
| 3300005181|Ga0066678_10809874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Caballeronia → Caballeronia arationis | 618 | Open in IMG/M |
| 3300005186|Ga0066676_10150711 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Caballeronia → Caballeronia arationis | 1462 | Open in IMG/M |
| 3300005332|Ga0066388_100233070 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2475 | Open in IMG/M |
| 3300005365|Ga0070688_100317717 | All Organisms → cellular organisms → Bacteria | 1131 | Open in IMG/M |
| 3300005447|Ga0066689_10065348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Caballeronia → Caballeronia arationis | 1999 | Open in IMG/M |
| 3300005518|Ga0070699_100189300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Caballeronia → Caballeronia arationis | 1827 | Open in IMG/M |
| 3300005533|Ga0070734_10564285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Caballeronia → Caballeronia arationis | 648 | Open in IMG/M |
| 3300005536|Ga0070697_100219735 | All Organisms → cellular organisms → Bacteria | 1619 | Open in IMG/M |
| 3300005536|Ga0070697_100688622 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
| 3300005555|Ga0066692_10237551 | All Organisms → cellular organisms → Bacteria | 1148 | Open in IMG/M |
| 3300005559|Ga0066700_10915929 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 581 | Open in IMG/M |
| 3300005587|Ga0066654_10001259 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 7687 | Open in IMG/M |
| 3300005610|Ga0070763_10545229 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300005844|Ga0068862_101734395 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 633 | Open in IMG/M |
| 3300006028|Ga0070717_12121038 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300006173|Ga0070716_100020729 | All Organisms → cellular organisms → Bacteria | 3454 | Open in IMG/M |
| 3300006173|Ga0070716_100386873 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
| 3300006572|Ga0074051_11770124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → environmental samples → uncultured Acetobacteraceae bacterium | 1682 | Open in IMG/M |
| 3300006574|Ga0074056_11845600 | Not Available | 1003 | Open in IMG/M |
| 3300007265|Ga0099794_10777606 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300007510|Ga0105013_1025824 | All Organisms → cellular organisms → Bacteria | 6946 | Open in IMG/M |
| 3300008005|Ga0100385_1282044 | All Organisms → cellular organisms → Bacteria → Chrysiogenetes → Chrysiogenetes → Chrysiogenales → unclassified Chrysiogenales → Chrysiogenales bacterium | 780 | Open in IMG/M |
| 3300009089|Ga0099828_10425469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Caballeronia → Caballeronia arationis | 1197 | Open in IMG/M |
| 3300009091|Ga0102851_13281402 | Not Available | 520 | Open in IMG/M |
| 3300009098|Ga0105245_12584127 | Not Available | 561 | Open in IMG/M |
| 3300009100|Ga0075418_10634452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 1150 | Open in IMG/M |
| 3300009137|Ga0066709_103343586 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300009156|Ga0111538_12604727 | Not Available | 634 | Open in IMG/M |
| 3300009175|Ga0073936_10018776 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 7691 | Open in IMG/M |
| 3300009623|Ga0116133_1132902 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_2_60_7 | 645 | Open in IMG/M |
| 3300009638|Ga0116113_1005061 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2623 | Open in IMG/M |
| 3300010329|Ga0134111_10484025 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300010358|Ga0126370_12318736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Caballeronia → Caballeronia arationis | 531 | Open in IMG/M |
| 3300010361|Ga0126378_10668474 | All Organisms → cellular organisms → Bacteria | 1151 | Open in IMG/M |
| 3300010361|Ga0126378_10944095 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 968 | Open in IMG/M |
| 3300010375|Ga0105239_12525155 | Not Available | 599 | Open in IMG/M |
| 3300011120|Ga0150983_14130344 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 731 | Open in IMG/M |
| 3300011400|Ga0137312_1007557 | All Organisms → cellular organisms → Bacteria | 1289 | Open in IMG/M |
| 3300011421|Ga0137462_1117040 | Not Available | 643 | Open in IMG/M |
| 3300011445|Ga0137427_10025741 | All Organisms → cellular organisms → Bacteria | 2314 | Open in IMG/M |
| 3300012189|Ga0137388_10279679 | Not Available | 1526 | Open in IMG/M |
| 3300012208|Ga0137376_10800394 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 811 | Open in IMG/M |
| 3300012210|Ga0137378_11320806 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300012349|Ga0137387_10603133 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 796 | Open in IMG/M |
| 3300012357|Ga0137384_10644331 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 863 | Open in IMG/M |
| 3300012363|Ga0137390_11554907 | Not Available | 601 | Open in IMG/M |
| 3300012582|Ga0137358_10434672 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 887 | Open in IMG/M |
| 3300012906|Ga0157295_10341604 | Not Available | 538 | Open in IMG/M |
| 3300012917|Ga0137395_10917470 | Not Available | 632 | Open in IMG/M |
| 3300012923|Ga0137359_10512852 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1057 | Open in IMG/M |
| 3300013769|Ga0119887_1119954 | Not Available | 740 | Open in IMG/M |
| 3300014055|Ga0119878_1060550 | Not Available | 1020 | Open in IMG/M |
| 3300014160|Ga0181517_10335659 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Caballeronia → Caballeronia arationis | 787 | Open in IMG/M |
| 3300014168|Ga0181534_10936527 | Not Available | 520 | Open in IMG/M |
| 3300014199|Ga0181535_10072672 | All Organisms → cellular organisms → Bacteria | 2279 | Open in IMG/M |
| 3300014200|Ga0181526_11066974 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_2_60_7 | 507 | Open in IMG/M |
| 3300014491|Ga0182014_10133130 | All Organisms → cellular organisms → Bacteria | 1431 | Open in IMG/M |
| 3300014492|Ga0182013_10030504 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4533 | Open in IMG/M |
| 3300014492|Ga0182013_10401457 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300014494|Ga0182017_10631601 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 651 | Open in IMG/M |
| 3300014654|Ga0181525_10798841 | Not Available | 532 | Open in IMG/M |
| 3300014658|Ga0181519_10150139 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1485 | Open in IMG/M |
| 3300014838|Ga0182030_10714576 | Not Available | 936 | Open in IMG/M |
| 3300015054|Ga0137420_1126051 | All Organisms → cellular organisms → Bacteria | 1227 | Open in IMG/M |
| 3300015241|Ga0137418_10291616 | All Organisms → cellular organisms → Bacteria | 1368 | Open in IMG/M |
| 3300015359|Ga0134085_10331014 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 674 | Open in IMG/M |
| 3300016341|Ga0182035_12051481 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
| 3300016357|Ga0182032_10817940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Caballeronia → Caballeronia arationis | 788 | Open in IMG/M |
| 3300017823|Ga0187818_10509386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Caballeronia → Caballeronia arationis | 540 | Open in IMG/M |
| 3300017946|Ga0187879_10484717 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 686 | Open in IMG/M |
| 3300017955|Ga0187817_11004405 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300017965|Ga0190266_10075222 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1299 | Open in IMG/M |
| 3300017973|Ga0187780_10077305 | Not Available | 2287 | Open in IMG/M |
| 3300018016|Ga0187880_1408147 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 568 | Open in IMG/M |
| 3300018046|Ga0187851_10090185 | All Organisms → cellular organisms → Bacteria | 1918 | Open in IMG/M |
| 3300018085|Ga0187772_10246442 | Not Available | 1212 | Open in IMG/M |
| 3300019082|Ga0187852_1009924 | All Organisms → cellular organisms → Bacteria | 5300 | Open in IMG/M |
| 3300019787|Ga0182031_1273459 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 1213 | Open in IMG/M |
| 3300020002|Ga0193730_1152454 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300020199|Ga0179592_10171796 | Not Available | 988 | Open in IMG/M |
| 3300020200|Ga0194121_10589812 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300020579|Ga0210407_10391370 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1087 | Open in IMG/M |
| 3300021180|Ga0210396_10279714 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1480 | Open in IMG/M |
| 3300021346|Ga0210335_1230193 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
| 3300021404|Ga0210389_10445193 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1019 | Open in IMG/M |
| 3300021478|Ga0210402_11375528 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 633 | Open in IMG/M |
| 3300022555|Ga0212088_10001354 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 54329 | Open in IMG/M |
| 3300022849|Ga0224531_1009773 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2597 | Open in IMG/M |
| 3300022861|Ga0224528_1054393 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 638 | Open in IMG/M |
| 3300022877|Ga0224527_1086010 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300023101|Ga0224557_1215935 | Not Available | 656 | Open in IMG/M |
| 3300023228|Ga0224530_1008202 | Not Available | 2393 | Open in IMG/M |
| 3300025162|Ga0209083_1002088 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 19925 | Open in IMG/M |
| 3300025167|Ga0209642_10070538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Caballeronia → Caballeronia arationis | 2017 | Open in IMG/M |
| 3300025878|Ga0209584_10096853 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1086 | Open in IMG/M |
| 3300025918|Ga0207662_11313006 | Not Available | 514 | Open in IMG/M |
| 3300026456|Ga0255351_1000003 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 134982 | Open in IMG/M |
| 3300026538|Ga0209056_10450796 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 730 | Open in IMG/M |
| 3300026548|Ga0209161_10457216 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 562 | Open in IMG/M |
| 3300027061|Ga0209729_1004575 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Caballeronia → Caballeronia arationis | 1414 | Open in IMG/M |
| 3300027634|Ga0209905_1043477 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300027874|Ga0209465_10297214 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 809 | Open in IMG/M |
| 3300027884|Ga0209275_10061260 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Caballeronia → Caballeronia arationis | 1839 | Open in IMG/M |
| 3300028069|Ga0255358_1023466 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 861 | Open in IMG/M |
| 3300028597|Ga0247820_10106890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1703 | Open in IMG/M |
| 3300028779|Ga0302266_10120583 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1050 | Open in IMG/M |
| 3300028860|Ga0302199_1033781 | All Organisms → cellular organisms → Bacteria | 1840 | Open in IMG/M |
| 3300029883|Ga0311327_10115393 | All Organisms → cellular organisms → Bacteria | 1953 | Open in IMG/M |
| 3300029911|Ga0311361_10304484 | Not Available | 1786 | Open in IMG/M |
| 3300029913|Ga0311362_10102900 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3772 | Open in IMG/M |
| 3300029988|Ga0302190_10357755 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
| 3300030041|Ga0302274_10047158 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2569 | Open in IMG/M |
| 3300030041|Ga0302274_10083581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Caballeronia → Caballeronia arationis | 1762 | Open in IMG/M |
| 3300030049|Ga0302191_10063417 | All Organisms → cellular organisms → Bacteria | 1572 | Open in IMG/M |
| 3300030051|Ga0302195_10016151 | All Organisms → cellular organisms → Bacteria | 5049 | Open in IMG/M |
| 3300030053|Ga0302177_10723239 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300030399|Ga0311353_10705752 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300030503|Ga0311370_10035080 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7534 | Open in IMG/M |
| 3300031238|Ga0265332_10084798 | Not Available | 1342 | Open in IMG/M |
| 3300031249|Ga0265339_10135067 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1259 | Open in IMG/M |
| 3300031258|Ga0302318_10352211 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 738 | Open in IMG/M |
| 3300031524|Ga0302320_10606167 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1278 | Open in IMG/M |
| 3300031524|Ga0302320_10956512 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 59-55 | 917 | Open in IMG/M |
| 3300031545|Ga0318541_10036202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Caballeronia → Caballeronia arationis | 2477 | Open in IMG/M |
| 3300031573|Ga0310915_10168350 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1522 | Open in IMG/M |
| 3300031576|Ga0247727_10685847 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 752 | Open in IMG/M |
| 3300031708|Ga0310686_112086626 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 814 | Open in IMG/M |
| 3300031711|Ga0265314_10056044 | All Organisms → cellular organisms → Bacteria | 2715 | Open in IMG/M |
| 3300031711|Ga0265314_10214083 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1129 | Open in IMG/M |
| 3300031747|Ga0318502_10055487 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2096 | Open in IMG/M |
| 3300031751|Ga0318494_10074021 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Caballeronia → Caballeronia arationis | 1840 | Open in IMG/M |
| 3300031754|Ga0307475_10130580 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1985 | Open in IMG/M |
| 3300031833|Ga0310917_10334710 | All Organisms → cellular organisms → Bacteria | 1026 | Open in IMG/M |
| 3300031833|Ga0310917_10893647 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300031880|Ga0318544_10095285 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1118 | Open in IMG/M |
| 3300031890|Ga0306925_10243031 | All Organisms → cellular organisms → Bacteria | 1940 | Open in IMG/M |
| 3300031910|Ga0306923_10354435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Propylenellaceae → Propylenella → Propylenella binzhouense | 1673 | Open in IMG/M |
| 3300031947|Ga0310909_10295758 | Not Available | 1356 | Open in IMG/M |
| 3300031954|Ga0306926_10517773 | All Organisms → cellular organisms → Bacteria | 1464 | Open in IMG/M |
| 3300031962|Ga0307479_11498733 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 631 | Open in IMG/M |
| 3300032044|Ga0318558_10051517 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1823 | Open in IMG/M |
| 3300032065|Ga0318513_10499668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 595 | Open in IMG/M |
| 3300032156|Ga0315295_11633239 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Caballeronia → Caballeronia arationis | 617 | Open in IMG/M |
| 3300032173|Ga0315268_10863489 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 908 | Open in IMG/M |
| 3300032256|Ga0315271_11725622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Caballeronia → Caballeronia arationis | 538 | Open in IMG/M |
| 3300032261|Ga0306920_100569536 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1677 | Open in IMG/M |
| 3300032261|Ga0306920_101718881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_52_11b | 888 | Open in IMG/M |
| 3300032783|Ga0335079_10313050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Caballeronia → Caballeronia arationis | 1710 | Open in IMG/M |
| 3300032805|Ga0335078_10362313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Caballeronia → Caballeronia arationis | 1920 | Open in IMG/M |
| 3300032828|Ga0335080_10252292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae | 1927 | Open in IMG/M |
| 3300033134|Ga0335073_10354378 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1736 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.59% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 7.98% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 4.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.29% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 4.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.91% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.68% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.68% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 3.07% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.45% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.45% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 2.45% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.84% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.84% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.84% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.84% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.84% |
| Freshwater Lake Hypolimnion | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion | 1.23% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.23% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.23% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.23% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.23% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.23% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.23% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.23% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.23% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.23% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.23% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.23% |
| Sewage Treatment Plant | Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Sewage Treatment Plant | 1.23% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.61% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.61% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.61% |
| Aquifer | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Aquifer | 0.61% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.61% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.61% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.61% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.61% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.61% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.61% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.61% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.61% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.61% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.61% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.61% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.61% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459010 | Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!) | Environmental | Open in IMG/M |
| 3300001089 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 | Environmental | Open in IMG/M |
| 3300001180 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 | Environmental | Open in IMG/M |
| 3300001411 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 shallow-072012 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004137 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF202 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006572 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006574 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007510 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 267m, 250-2.7um, replicate a | Environmental | Open in IMG/M |
| 3300008005 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-09 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009175 | Freshwater lake bacterial and archeal communities from Alinen Mustajarvi, Finland, to study Microbial Dark Matter (Phase II) - Alinen Mustajarvi 5m metaG | Environmental | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300009638 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011400 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT133_2 | Environmental | Open in IMG/M |
| 3300011421 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT769_2 | Environmental | Open in IMG/M |
| 3300011445 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012906 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1 | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300013769 | Sewage treatment plant microbial communities from Vermont, USA - Sand_B | Engineered | Open in IMG/M |
| 3300014055 | Sewage treatment plant microbial communities from Vermont, USA - ANOX_W | Engineered | Open in IMG/M |
| 3300014160 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaG | Environmental | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014491 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG | Environmental | Open in IMG/M |
| 3300014492 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaG | Environmental | Open in IMG/M |
| 3300014494 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaG | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018016 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300019082 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40 | Environmental | Open in IMG/M |
| 3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020200 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015020 Mahale Deep Cast 50m | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021346 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.374 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022555 | Alinen_combined assembly | Environmental | Open in IMG/M |
| 3300022849 | Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T100 | Environmental | Open in IMG/M |
| 3300022861 | Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T25 | Environmental | Open in IMG/M |
| 3300022877 | Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T0 | Environmental | Open in IMG/M |
| 3300023101 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14 | Environmental | Open in IMG/M |
| 3300023228 | Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T75 | Environmental | Open in IMG/M |
| 3300025162 | Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025167 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025878 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026456 | Peat soil microbial communities from Stordalen Mire, Sweden - H.B.S.T-25.r2 | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300027061 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027634 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812S1M | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028069 | Peat soil microbial communities from Stordalen Mire, Sweden - G.F.S.T0 | Environmental | Open in IMG/M |
| 3300028597 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14 | Environmental | Open in IMG/M |
| 3300028779 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_2 | Environmental | Open in IMG/M |
| 3300028860 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_3 | Environmental | Open in IMG/M |
| 3300029883 | I_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029911 | III_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029913 | III_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029988 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_3 | Environmental | Open in IMG/M |
| 3300030041 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300030049 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_1 | Environmental | Open in IMG/M |
| 3300030051 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_2 | Environmental | Open in IMG/M |
| 3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Host-Associated | Open in IMG/M |
| 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Host-Associated | Open in IMG/M |
| 3300031258 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_1 | Environmental | Open in IMG/M |
| 3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031576 | Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Host-Associated | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033489 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F62_06469900 | 2170459010 | Grass Soil | RGTRLRLAISAHPMVPSASSYDVGIPEYISFAAEYPARTFPCQRFDAALTSGSA |
| JGI12683J13190_10064651 | 3300001089 | Forest Soil | MEPSAFSYSVGVPEEDSYAAEYPARTFPCPCFDAALASGSA* |
| JGI12695J13573_10011842 | 3300001180 | Forest Soil | MGPSAFSYSVGVPEEETYAAEYPARTFPCQRFDAALASGSA* |
| JGI20182J14882_1006941 | 3300001411 | Arctic Peat Soil | MLPSASPYSVGVPEGISFAAEYPARTFPYQRFDAALASGSA* |
| JGIcombinedJ26739_1001465612 | 3300002245 | Forest Soil | MEPSASPYSVGVPELFYAAEYPARTFPCQRFDAALASGSA* |
| JGI25385J37094_101235621 | 3300002558 | Grasslands Soil | MSVYQVGPSAFSYSVGVPEGVTFAAQYPARTYPCQRFGAALAGGSA* |
| JGI25384J37096_101434761 | 3300002561 | Grasslands Soil | MGPSACSYGVSVPEEGSYAAEYPARTFPCQRFDAALASGSA* |
| Ga0058883_15347492 | 3300004137 | Forest Soil | VHLAISVHPMGPFAFSYSVGVPEEGSYAAEYPARTVPYQRFDVTLASDSA* |
| Ga0066678_108098742 | 3300005181 | Soil | MATHPVWPSASPYSVGTPEEMSFAAEYPARTYPCQRFDATL |
| Ga0066676_101507111 | 3300005186 | Soil | MSMRWMVPSASPYSVGVPERFSFAAEYPARTYPCQRFDAALA |
| Ga0066388_1002330702 | 3300005332 | Tropical Forest Soil | MLPSAFSYSVGVPEDDSFAAEYPARTLPYQRFDAALASGSA* |
| Ga0070688_1003177172 | 3300005365 | Switchgrass Rhizosphere | MTVPAVLPSAFLYSVGAPDIQHYAAQYPARRFPCQRFDAALASDAA* |
| Ga0066689_100653481 | 3300005447 | Soil | MGPSASPYSVGVPEKVSYAAEYPARTFPCQRFDAALASGSA* |
| Ga0070699_1001893002 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | VHPIAPSASPYSVGVPEKVSYAAEYPARTFPCQRFDAALAS |
| Ga0070734_105642851 | 3300005533 | Surface Soil | MRLAISAHRVLPSAFSYSVGIPEGLSFAAQYPARTFPYPRFDAALANGSAGLGATVGR* |
| Ga0070697_1002197351 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | GTLARLAISAYPMGPSASPYSVGVPEEETYAAEYPARTFPCQRFDAALASSSA* |
| Ga0070697_1006886221 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | GTLARLAISAYPMGPSASPYSVGVPEEETYAAEYPARTFPCQRFDAALANGSA* |
| Ga0066692_102375513 | 3300005555 | Soil | AISVHPMGPSASPYSVGVPEKVSYAAEYPARTFPCQRFDAALASGSA* |
| Ga0066700_109159291 | 3300005559 | Soil | MHQMGPSASPYSVGVPEEVSYAAEYPARTFPCQRFDA |
| Ga0066654_100012599 | 3300005587 | Soil | VHPMEPSAFSYSVGIPEEGSYAAEYPARTLPCQRFDTALASGSA* |
| Ga0070763_105452292 | 3300005610 | Soil | MEPSASPYIVGIPEESSYAAEYPARTFPCQRFDVTLASDSA* |
| Ga0068862_1017343952 | 3300005844 | Switchgrass Rhizosphere | VEPSASPYSVGTPEELAFAAEYPARTCPCQRFDAA |
| Ga0070717_121210381 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MGPSASPYSVGVPEEETYAAEYPARTFPCQRFDAALASSS |
| Ga0070716_1000207291 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | AISAFQMGPSASPYSVGVPEEVSYAAVYPARTFPCQRFDAALASGSA* |
| Ga0070716_1003868733 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MEPSAFSYSVGVPEEVSYAAEYPARTFPCQRFDGALASGSA* |
| Ga0074051_117701242 | 3300006572 | Soil | MTVPAVLPSAFLYSVGAPDIQHFAAQYPARRFPCQRFDAALASDAA* |
| Ga0074056_118456001 | 3300006574 | Soil | MTVRTVLPSAFLYSVGAPDIQHFAAQYPARRFPCQRFDAALASDAA* |
| Ga0099794_107776061 | 3300007265 | Vadose Zone Soil | VRARGLGPRRTRTHLAISVRPMEPSASSYSVGVPEGGSYAAEYPARPLPCQRFSTAL |
| Ga0105013_10258245 | 3300007510 | Marine | MLPSASFHGVGTPNLVNFAAQYLARTYPCQRFTSTLADVGA* |
| Ga0100385_12820443 | 3300008005 | Aquifer | HSVGIPEEVTFAAEYPARTYPCQRFAPVLADSHA* |
| Ga0099828_104254691 | 3300009089 | Vadose Zone Soil | MRQVEPSAFSYSVSVPEEIHFAAQYPARTYPCQRFDAALAGDS |
| Ga0102851_132814021 | 3300009091 | Freshwater Wetlands | PRGARQRLAISTLPMLPSDVSYRVGAPEKDTFAAECPARTFPCQRFVAALASSSA* |
| Ga0105245_125841271 | 3300009098 | Miscanthus Rhizosphere | MTVRTVLPSAFLYSVGAPDIQHYAAQYPARRFPCQRFDAALASDAA* |
| Ga0075418_106344522 | 3300009100 | Populus Rhizosphere | MTVRAVLPSAFLYSVGAPDIQHYAAQYPARRFPSQRFDAALASDAA* |
| Ga0066709_1033435861 | 3300009137 | Grasslands Soil | MGPSASPYSVGVPEEVSYAAEYPARTFPCQRFDATLASDSA* |
| Ga0111538_126047271 | 3300009156 | Populus Rhizosphere | MTVPAVLPSAFLYSVGAPEIQHFAAQYPARRFPCQRFDAALASDAA* |
| Ga0073936_100187767 | 3300009175 | Freshwater Lake Hypolimnion | LRLAVSAHPMLPSASSYGVGIPEDISFAAEYPARTFPCQRFDAALTSGSA* |
| Ga0116133_11329022 | 3300009623 | Peatland | RMLPSAFSYSAGIPEELSYAAQYPARTFPWQRFDAALASGSAGLGAGVGR* |
| Ga0116113_10050613 | 3300009638 | Peatland | MLPSAFSYSVGVQKDISFAAEYPARTFPCQRFDAALADGSA* |
| Ga0134111_104840252 | 3300010329 | Grasslands Soil | SAFQMGPSASPYSVGVPEEDPYAAEFPARTFPCQRFDAALASSSA* |
| Ga0126370_123187362 | 3300010358 | Tropical Forest Soil | IDVADMPSDYAYSVGIPKRHNFAAEYPARTYPCQRFAASLARSLA* |
| Ga0126378_106684742 | 3300010361 | Tropical Forest Soil | MRSVLPSASPYSVGVPEECTFAAEYPARTFPCQRFDASLARS |
| Ga0126378_109440951 | 3300010361 | Tropical Forest Soil | MLPSAFSYSLGVPEDDRFAAEYPARTLPYQRFDAALASGSA* |
| Ga0105239_125251552 | 3300010375 | Corn Rhizosphere | MTVPAVLPSAFLYSVGAPDIQHYTAQYPARRFPCQRFDAALA |
| Ga0150983_141303442 | 3300011120 | Forest Soil | MLSSASPYGVGVPEDRIFAAEYPARTFPCQRFGAALASDTA* |
| Ga0137391_101165453 | 3300011270 | Vadose Zone Soil | AISMRWMVPSASSYSVGVPKDVSFAAQYPARTYLCQRFDTTLAGSSA* |
| Ga0137312_10075573 | 3300011400 | Soil | MTVAAVLPSAFLYSVGAPDIQHYAAQYPARRFPCQRFDAALASDAA* |
| Ga0137462_11170401 | 3300011421 | Soil | MTVPAVLPSAFLYSVGAPDIQHFAAQYPARRFPCQRFGAALASDAA* |
| Ga0137427_100257412 | 3300011445 | Soil | MTVPAVLPSAFLYSVGVPDIQHYAAQYPARRFPCQRFDAALASDAA* |
| Ga0137388_102796791 | 3300012189 | Vadose Zone Soil | VEPSAFSYSVSVPEEIHFAAQYPARTYPCQRFDAALAGDSV* |
| Ga0137376_108003941 | 3300012208 | Vadose Zone Soil | MAMRRMLPSAFSYSVGTPEDDSFAAQYPARTYPCQRFDAAL |
| Ga0137378_113208062 | 3300012210 | Vadose Zone Soil | VHPMEPSAFSYSVGVPEDMSFAAEYPARTFPCQRFDAALTSDSA* |
| Ga0150985_1184071761 | 3300012212 | Avena Fatua Rhizosphere | MTVHDVLPSTFLYSVSALDIQNFAAQYPARSFPCQRFAAALAGVSA* |
| Ga0137387_106031331 | 3300012349 | Vadose Zone Soil | MRRMLPSAFSYSVGTPEEVSFAAQYPARTYPCQRFDAALAS |
| Ga0137384_106443311 | 3300012357 | Vadose Zone Soil | YSVGVPEESSFAAEYPARTFPCQRFGAALASGSA* |
| Ga0137390_115549073 | 3300012363 | Vadose Zone Soil | SAFQMEPSASPYSVGVPEQVSYAAEYPARTFPCQRFDAALASGSA* |
| Ga0137358_104346721 | 3300012582 | Vadose Zone Soil | MGPSASPYSVGVPEEGSYAAEYPARTFPCQRFDAALAGGSA* |
| Ga0157295_103416041 | 3300012906 | Soil | MTVPAVLPSAFLYSVGAPDIQHYAAQYPARRFPCQRFDAALANDAA* |
| Ga0137395_109174701 | 3300012917 | Vadose Zone Soil | RGTLQRLAISAFQMGPSASPYSVGVPEEGTYAAEYPARTFPYQRFDAALASSSA* |
| Ga0137359_105128523 | 3300012923 | Vadose Zone Soil | YSVGVPEEGSYAAEYPARTFPCQRFDAALAGGSA* |
| Ga0119887_11199541 | 3300013769 | Sewage Treatment Plant | MTVRAVLPSAFLYSVGAPDIQHFAAQYPARRFPCQRFDAALASDAA* |
| Ga0119878_10605501 | 3300014055 | Sewage Treatment Plant | MTVHAVLPSAFLYSVGAPDIQHFAAQYPARRFPCQRFDAALASDAA* |
| Ga0181517_103356591 | 3300014160 | Bog | MHLAISVHPMLPSASSYNVGVPKEGSYAAQYPAHTFPYQRFSAALASG |
| Ga0181534_109365271 | 3300014168 | Bog | MLPSAFSYSVGVQEDISFAAEYPARTFPCQRFDAALASGSA* |
| Ga0181535_100726721 | 3300014199 | Bog | MLPSASSYGVGIPEDMSFAAEYPARTFPCQRFDAALTSGSA* |
| Ga0181535_104105481 | 3300014199 | Bog | MSAHPMLPSASSYGVGVPELESFAAEYPARTFPCQRFA |
| Ga0181526_110669741 | 3300014200 | Bog | LAISAYPMLPSAFSYSVGVQEDISFAAEYPARTFPCQRFDAALASGSA* |
| Ga0182014_101331301 | 3300014491 | Bog | MLPSASPYGVGVPEDMFFAAEYPARTFPYQRFKAALTSGSA* |
| Ga0182013_100305044 | 3300014492 | Bog | MVPSASSYGVGIPEDISFAAEYPARTFPCQRFDAALTSGSA* |
| Ga0182013_104014571 | 3300014492 | Bog | PMLPSASPYSVGVPEGISFAAEYPARTFPYQRFDAALANGSA* |
| Ga0182017_106316011 | 3300014494 | Fen | ISAHPMVPSAISYSVGVPEDSSFAAEYLARTFPCQRFDATLASGSA* |
| Ga0181525_107988412 | 3300014654 | Bog | MRLAISALPILPSAFSYSVGIPEDLSFAAEYPARTFPCQRFDAALADGSA* |
| Ga0181519_101501392 | 3300014658 | Bog | MSAHPMLPSASSYGVGVPELESFAAEYPARTFPCQRFAAALTSD |
| Ga0182030_107145761 | 3300014838 | Bog | LPMLPSACLDGVGVPEDGCYAAEYPARTFPCQRFVTAFTDGSA* |
| Ga0137420_11260511 | 3300015054 | Vadose Zone Soil | PRGTLAYLAISVHPMGPSAFSYSVGVPEEEPYAAEYPARPFPCQRFDAALASGSA* |
| Ga0137418_102916161 | 3300015241 | Vadose Zone Soil | LQRLAISAFQMGPSASPYSVGVPEEGTYAAEYPARTFPCQRFDAALASSSA* |
| Ga0134085_103310141 | 3300015359 | Grasslands Soil | PLHLAISVHRMRPSASPYNVGVPEECTFAAEYPARTYPCQRFDATLAGGSA* |
| Ga0182035_120514811 | 3300016341 | Soil | MLPSAFSYSVGIPKQSSYAAEYPAHTFPCPRFDAALASGSA |
| Ga0182032_108179401 | 3300016357 | Soil | HLALAMRSVLPSASPYNVGIPKKRPFAAVYPARTYHCQRFDASLARSSA |
| Ga0187818_105093861 | 3300017823 | Freshwater Sediment | MEPSAFSYSVGVPEEVSYAAEYPARTFPCQRFDAA |
| Ga0187879_104847171 | 3300017946 | Peatland | MLPSAFSYSAGIPEELSYAAQYPARTFPCQRFDAALASGSAGLG |
| Ga0187817_110044051 | 3300017955 | Freshwater Sediment | MSVCPMEPSASSYGVGIPEQLSYAAQYPARTFPCQRFSA |
| Ga0190266_100752222 | 3300017965 | Soil | MTVPAVLPSAFLYSVGAPDIQHFAAQYPARRFPCQRFDAALASDAA |
| Ga0187780_100773053 | 3300017973 | Tropical Peatland | SPYSVSIPKYVSFAAEYPARTFPCQRFATALTGDSA |
| Ga0187880_14081471 | 3300018016 | Peatland | MRLAISALLILPSAFSYNVGVPEEFSFAAEYPACAYPCQRFDDA |
| Ga0187851_100901852 | 3300018046 | Peatland | MLPSAFSYSAGIPEELSYAAQYPARTFPCQRFDAALASGSAGLGA |
| Ga0187772_102464423 | 3300018085 | Tropical Peatland | RMLPSASPYSVGIPELSYAAVYPARTFPCQRFVAALTSGAA |
| Ga0187852_10099244 | 3300019082 | Peatland | MRLAISALPILPSAFSYNVGVPEEFSFAAEYPARTFPCQRFDAALTSGSA |
| Ga0182031_12734591 | 3300019787 | Bog | ALPMLPSACLDGVGVPEDGCYAAEYPARTFPCQRFETAFADGSA |
| Ga0193730_11524541 | 3300020002 | Soil | SYSVGVPEECSYAAQYPARTLPCQRFVTALAGGSA |
| Ga0179592_101717961 | 3300020199 | Vadose Zone Soil | AHLALSVHPMGPSASPYSVGVPEEDSYAAEYPARTSPCQRFDAALASGSA |
| Ga0194121_105898121 | 3300020200 | Freshwater Lake | VVTPAMWPSASPYSVGTPELVTFAAEYPARPFPYRRFDVALT |
| Ga0210407_103913702 | 3300020579 | Soil | MLSSASPYGVGVPEDRIFAAEYPARTFPCQRFGAALA |
| Ga0210396_102797142 | 3300021180 | Soil | MRLAISAHPMLPSAISDGVSIPEGFSFAAEYPARTFPYQRFDAALASGSA |
| Ga0210335_12301932 | 3300021346 | Estuarine | PSASPYSVGTPEEFSFAAEYPARTYPCQRFAPALAGSHA |
| Ga0210389_104451932 | 3300021404 | Soil | MLSSASPYGVGVPEDRIFAAEYPARTFPCQRFGAALASDTA |
| Ga0210402_113755281 | 3300021478 | Soil | MLPSAISDGVSIPEGFSFAAEYTARTFPYQRFDAALASGSA |
| Ga0212088_1000135445 | 3300022555 | Freshwater Lake Hypolimnion | LRLAVSAHPMLPSASSYGVGIPEDISFAAEYPARTFPCQRFDAALTSGSA |
| Ga0224531_10097731 | 3300022849 | Soil | AVHSMVPSARPYSVGVPKEVCFAAEYPARTFPCQRFADALTSASA |
| Ga0224528_10543932 | 3300022861 | Soil | MHLAFAVHSMVPSARPYSVGVPKEVCFAAEYPARTFPCQRFADALTS |
| Ga0224527_10860101 | 3300022877 | Soil | MLPSASPYGVGVPKEVCFAAEYPARTFPCQRFADALTSASA |
| Ga0224557_12159351 | 3300023101 | Soil | AFSYSVGVPEEFSFAAEYPARTFPCQRFTAALTSGSA |
| Ga0224530_10082024 | 3300023228 | Soil | RMHLAFAVHSMVPSARPYSVGVPKEVCFAAEYPARTFPCQRFGDALTSASA |
| Ga0209083_100208817 | 3300025162 | Freshwater | PRGTRLRLAVSAHPMLPSASSYGVGIPEDISFAAEYPARTFPCQRFDAALTSGSA |
| Ga0209642_100705383 | 3300025167 | Soil | MHLAVSMHRMEPSASSYGVGVPEKIPFAAQYPARTCPCQRFDAALTGS |
| Ga0209584_100968531 | 3300025878 | Arctic Peat Soil | MLPSASPYSVGVPEGISFAAEYPARTFPYQRFDAALASGSA |
| Ga0207662_113130062 | 3300025918 | Switchgrass Rhizosphere | MTVPAVLPSAFLYSVGAPDIQHYAAQYPARRFPCQRFDAALASDAA |
| Ga0255351_100000356 | 3300026456 | Soil | MLPSASPYSVDVPEGISFAAEYPARTFPYQRFDAALASGSA |
| Ga0209056_104507962 | 3300026538 | Soil | MVPSASPYSVGVPEECSFAAEYPARTCPCQRFDATL |
| Ga0209161_104572162 | 3300026548 | Soil | MVPSASPYSVGVPEECSFAAEYPARTCPCQRFDATLAGGSA |
| Ga0209729_10045751 | 3300027061 | Forest Soil | MEPSAFSYSVGIPEEGSYAAEYPARTLPCQRFDAALA |
| Ga0209905_10434772 | 3300027634 | Thawing Permafrost | MVPSASSYGVGIPEDISFAAEYPARTFPCQRFDAALTSGSA |
| Ga0209465_102972141 | 3300027874 | Tropical Forest Soil | MEPSAFSYSVGVPEEVSFAAVYPARTFPCQRFDAALTGG |
| Ga0209275_100612603 | 3300027884 | Soil | VHLAISVHPMGPFAFSYSVGVPEEGSYAAEYPARTVPYQRFDVT |
| Ga0255358_10234662 | 3300028069 | Soil | SYGVGVPEGNPFAAEYPARTFPCQRFSAALASGSA |
| Ga0247820_101068904 | 3300028597 | Soil | VHLAMTVPAVLPSAFLYSVGAPDIQHYAAQYPARRFPCQRFDAALASDAA |
| Ga0302266_101205832 | 3300028779 | Bog | MLPSASPYGVGVPKNSIFEAEYPARTFPCQRFKAALASDS |
| Ga0302199_10337814 | 3300028860 | Bog | IPAQPMLPSASPYSVDVPEGISFAAEYPARTFPYQRFDAALASGSA |
| Ga0311327_101153932 | 3300029883 | Bog | MLPSASPYGVGVPEDLFFAAEYPARTFPCQRFKAAL |
| Ga0311361_103044841 | 3300029911 | Bog | HLAFAVHSMVPSARPYSVGVPKEVCFAAEYPARTFPCQRFADALTSASA |
| Ga0311362_101029007 | 3300029913 | Bog | MLPSASPYSVGVPEGISFAAEYPARTFPYQRFDAALANGSA |
| Ga0302190_103577551 | 3300029988 | Bog | MLPSASPYGVGVPEECIFAAEYPARTFPCQRFAAALTSGSA |
| Ga0302274_100471581 | 3300030041 | Bog | LAISAHTMLPSATPYGVGVPEEEIFAAEYPARTFPCQRFKAALTSGSA |
| Ga0302274_100835812 | 3300030041 | Bog | MVPSASSYGVGIPEDISFAAEYPARTFPCQRFDAALTSGS |
| Ga0302191_100634172 | 3300030049 | Bog | MLPSASPYGVGVPEDLFFAAEYPARTFPCQRFKAALA |
| Ga0302195_100161511 | 3300030051 | Bog | MLPSAFSYSVGVQEDISFAAEYPARTFPCQRFDAALASGSA |
| Ga0302177_107232391 | 3300030053 | Palsa | PSAYPKSVGVPECESFAAEYPARTFPCQRFDVALTNNSA |
| Ga0311353_107057522 | 3300030399 | Palsa | RPILPSAYPKSVGVPECESFAAEYPARTFPCQRFDVALTNNSA |
| Ga0311370_100350801 | 3300030503 | Palsa | AYPKSVGVPECESFAAEYPARTFLCQRFDIVLANNSA |
| Ga0265332_100847981 | 3300031238 | Rhizosphere | MRLAISAHTMLPSATPYGVGVPEEEIFAAEYPARTFPCQRFKAALTSGSA |
| Ga0265339_101350672 | 3300031249 | Rhizosphere | MLPSATPYGVGVPEEEIFAAEYPARTFPCQRFKAALTSGSA |
| Ga0302318_103522112 | 3300031258 | Bog | MAAHPMLPSASPYGVGVPEECIFAAEYPARTFPCQRFAAAL |
| Ga0302320_106061671 | 3300031524 | Bog | MSAHTMLPSASPYGVGVPEDSSFAAEYPARTFPCQRFAAAL |
| Ga0302320_109565122 | 3300031524 | Bog | SASPYGVGVPKNSIFEAEYPARTIPCQRFKAALASDSA |
| Ga0318541_100362023 | 3300031545 | Soil | MHLAISVHRVLPSAFSYSVGIPKQSSYAAEYPAHTFPCPRFDAALASGSAGLGAVVGC |
| Ga0310915_101683503 | 3300031573 | Soil | LYLAISVYGTEPSAFSYSVGIPEYGSYAAEYLARTLPYQRFDAALAGGSA |
| Ga0247727_106858472 | 3300031576 | Biofilm | MRRMEPSASPYSVGTPEGSSFAAEYPARTCPCQRFD |
| Ga0310686_1120866261 | 3300031708 | Soil | AISVHRMGPPAFSYSVGVPEECSYAAEYPARMFPCQRFDAALASGSA |
| Ga0265314_100560443 | 3300031711 | Rhizosphere | MLPSAFSYSVGVQKDISFAAEYPARTFPCQRFDAALADGSA |
| Ga0265314_102140831 | 3300031711 | Rhizosphere | MRLAISAHTMLPSATPYGVGVPEEEIFAAEYPARTFPCQRFKAALTSG |
| Ga0318502_100554871 | 3300031747 | Soil | MHLAISVHRVLPSAFSYSVGIPKQSSYAAEYPAHTFPCPRFDAALASGSAGLGAVVDMIE |
| Ga0318494_100740212 | 3300031751 | Soil | MRPVLPSASPYSVGVPEEVSFAAEYPARTYPCQRFAAFLPE |
| Ga0307475_101305801 | 3300031754 | Hardwood Forest Soil | AFSYSVDVPEGSSYAAEYPARTFPCQRFDAVLANSSA |
| Ga0310917_103347101 | 3300031833 | Soil | SYSVGIPEYGSYAAEYLARTLPYQRFDAALAGGSA |
| Ga0310917_108936471 | 3300031833 | Soil | SAPRMLPSACRYSVGIPELDYAAEYPARTFPCQRFVATLASDSA |
| Ga0318544_100952851 | 3300031880 | Soil | MEPSASPYSVGIPEESSYAAEYPARPFPCQRFDAALASGSA |
| Ga0306925_102430313 | 3300031890 | Soil | RGTPKHLAISVHQMLPSAFSYSVGIPKQTSYAAEYPARTFPCPRFDAALASGSAGLRAVVGC |
| Ga0306923_103544353 | 3300031910 | Soil | MRPVVLSASPYYVSVPEGPSFAAQYPARTYPCQRFDAAFTDNSA |
| Ga0310909_102957584 | 3300031947 | Soil | EPSAFSYSVGIPEYGSYAAEYLARTLPYQRFDAALAGGSA |
| Ga0306926_105177732 | 3300031954 | Soil | AFSYSVGIPKQTSYAAEYPARTFPCPRFDAALASGSAGLRAVVGC |
| Ga0307479_114987332 | 3300031962 | Hardwood Forest Soil | HRMGPPAFSYSVGVPEGLAYAAEYPARTFPCQRFDAALASGSA |
| Ga0318558_100515172 | 3300032044 | Soil | MHLAISVHRVLPSAFSYSVGIPKQSSYAAEYPAHMFPCPRFDAALASGSAGLGAVVGC |
| Ga0318513_104996682 | 3300032065 | Soil | MEPSAFSYSVGIPEDRFYAAEYPARTFPCQRFDAALASGSA |
| Ga0315295_116332392 | 3300032156 | Sediment | MVPSASPYSVGAPEEFAFAAEYPARTYPCQRFDTAL |
| Ga0315268_108634892 | 3300032173 | Sediment | MRLAISAHRMLPSAFSYSVGIPEESCYAAQYPARTFPCPRFGAALTGRT |
| Ga0315271_117256221 | 3300032256 | Sediment | MVPSASPYSVGAPEEFAFAAEYPARTYPCQRFDAAL |
| Ga0306920_1005695362 | 3300032261 | Soil | MYPMVPSAFSYSVGIPEGEPYAAEYPARTLSYQRFDAALASGSA |
| Ga0306920_1017188811 | 3300032261 | Soil | MLPSAFLYNVGVPEEVCYAAEYPARTFPCPRFGATLTGDSAGLRAV |
| Ga0335079_103130501 | 3300032783 | Soil | MRLAISAPRMLPSASPYSVGIPELSYAAVYPARTFPYQRFVAALTSGAA |
| Ga0335078_103623133 | 3300032805 | Soil | MHPIWPSASSYGVGIPEQVSFAAEYPARTYPCQRFTAFLMEC |
| Ga0335080_102522921 | 3300032828 | Soil | PHLALAMRSVLPSASPYSVSIPKQVSFAAEYPARTYPCQRFDASLPESSA |
| Ga0335073_103543781 | 3300033134 | Soil | MHLAISAHPMLPSASFHSVGIPENICFAAEYPARTFPCQRFVAALASGSA |
| Ga0299912_102655251 | 3300033489 | Soil | MDRMWPSAFSYGVGAPEEFTFAARYPACTYPCQRFASALASG |
| ⦗Top⦘ |