| Basic Information | |
|---|---|
| Family ID | F038572 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 165 |
| Average Sequence Length | 41 residues |
| Representative Sequence | AVLIQSVGVDEAAPTVLFGFTVIVPVALTLPQPPVNGML |
| Number of Associated Samples | 135 |
| Number of Associated Scaffolds | 154 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 6.49 % |
| % of genes near scaffold ends (potentially truncated) | 73.33 % |
| % of genes from short scaffolds (< 2000 bps) | 92.12 % |
| Associated GOLD sequencing projects | 127 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.27 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (55.152 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (15.758 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.939 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (36.970 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.90% β-sheet: 0.00% Coil/Unstructured: 79.10% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.27 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 55.15 % |
| All Organisms | root | All Organisms | 44.85 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000176|TB03JUN2009E_c029249 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → unclassified Flavobacterium → Flavobacterium sp. WG47 | 773 | Open in IMG/M |
| 3300002072|JGIcombinedJ21914_10177138 | Not Available | 597 | Open in IMG/M |
| 3300002220|MLSBCLC_10720911 | Not Available | 512 | Open in IMG/M |
| 3300002549|JGI24130J36418_10065240 | Not Available | 902 | Open in IMG/M |
| 3300002899|JGIcombinedJ43975_10088619 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Hanamia → Hanamia caeni | 556 | Open in IMG/M |
| 3300004769|Ga0007748_11366113 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cyclobacteriaceae → Algoriphagus | 623 | Open in IMG/M |
| 3300004792|Ga0007761_11216612 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium | 739 | Open in IMG/M |
| 3300004810|Ga0007757_11167433 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cyclobacteriaceae → Algoriphagus | 621 | Open in IMG/M |
| 3300005295|Ga0065707_10665591 | Not Available | 653 | Open in IMG/M |
| 3300005457|Ga0070662_101533194 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → unclassified Sphingobacteriales → Sphingobacteriales bacterium UPWRP_1 | 575 | Open in IMG/M |
| 3300005525|Ga0068877_10729310 | Not Available | 528 | Open in IMG/M |
| 3300005525|Ga0068877_10765136 | Not Available | 512 | Open in IMG/M |
| 3300005527|Ga0068876_10390185 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → unclassified Sphingobacteriales → Sphingobacteriales bacterium UPWRP_1 | 777 | Open in IMG/M |
| 3300005528|Ga0068872_10481357 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 667 | Open in IMG/M |
| 3300005831|Ga0074471_10045240 | Not Available | 535 | Open in IMG/M |
| 3300006045|Ga0082212_11023166 | Not Available | 662 | Open in IMG/M |
| 3300006056|Ga0075163_11005182 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 854 | Open in IMG/M |
| 3300006059|Ga0075017_100903671 | Not Available | 685 | Open in IMG/M |
| 3300006162|Ga0075030_101347965 | Not Available | 559 | Open in IMG/M |
| 3300006930|Ga0079303_10480374 | Not Available | 535 | Open in IMG/M |
| 3300007590|Ga0102917_1112626 | Not Available | 959 | Open in IMG/M |
| 3300007603|Ga0102921_1267649 | Not Available | 610 | Open in IMG/M |
| 3300008111|Ga0114344_1128871 | Not Available | 888 | Open in IMG/M |
| 3300008114|Ga0114347_1243427 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 558 | Open in IMG/M |
| 3300008117|Ga0114351_1421491 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → unclassified Sphingobacteriales → Sphingobacteriales bacterium UPWRP_1 | 554 | Open in IMG/M |
| 3300008996|Ga0102831_1166430 | Not Available | 730 | Open in IMG/M |
| 3300009009|Ga0105105_10747386 | Not Available | 586 | Open in IMG/M |
| 3300009037|Ga0105093_10586294 | Not Available | 630 | Open in IMG/M |
| 3300009087|Ga0105107_10648706 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium | 734 | Open in IMG/M |
| 3300009087|Ga0105107_10648706 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium | 734 | Open in IMG/M |
| 3300009120|Ga0117941_1164101 | Not Available | 612 | Open in IMG/M |
| 3300009120|Ga0117941_1164101 | Not Available | 612 | Open in IMG/M |
| 3300009131|Ga0115027_11207166 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → Flavobacterium psychrotolerans | 605 | Open in IMG/M |
| 3300009131|Ga0115027_11488892 | Not Available | 555 | Open in IMG/M |
| 3300009159|Ga0114978_10081660 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium | 2163 | Open in IMG/M |
| 3300009163|Ga0114970_10527933 | Not Available | 642 | Open in IMG/M |
| 3300009167|Ga0113563_13995004 | Not Available | 500 | Open in IMG/M |
| 3300010160|Ga0114967_10442821 | Not Available | 642 | Open in IMG/M |
| 3300010167|Ga0123353_12269324 | Not Available | 654 | Open in IMG/M |
| 3300010350|Ga0116244_10712178 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 649 | Open in IMG/M |
| 3300010352|Ga0116247_10385202 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1101 | Open in IMG/M |
| 3300011009|Ga0129318_10284753 | Not Available | 557 | Open in IMG/M |
| 3300012772|Ga0138287_1129282 | Not Available | 639 | Open in IMG/M |
| 3300012881|Ga0079063_1369752 | Not Available | 610 | Open in IMG/M |
| 3300013004|Ga0164293_10596524 | Not Available | 718 | Open in IMG/M |
| 3300013104|Ga0157370_11477605 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → unclassified Sphingobacteriales → Sphingobacteriales bacterium UPWRP_1 | 611 | Open in IMG/M |
| 3300013295|Ga0170791_12614375 | Not Available | 513 | Open in IMG/M |
| 3300013306|Ga0163162_12224307 | Not Available | 630 | Open in IMG/M |
| 3300014491|Ga0182014_10282050 | Not Available | 859 | Open in IMG/M |
| 3300014491|Ga0182014_10282050 | Not Available | 859 | Open in IMG/M |
| 3300014839|Ga0182027_11021952 | Not Available | 845 | Open in IMG/M |
| 3300015053|Ga0137405_1384912 | Not Available | 1311 | Open in IMG/M |
| 3300015250|Ga0180072_1069853 | Not Available | 609 | Open in IMG/M |
| 3300015250|Ga0180072_1075953 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → Solitalea → unclassified Solitalea → Solitalea sp. S2-8 | 586 | Open in IMG/M |
| 3300018476|Ga0190274_12865370 | Not Available | 578 | Open in IMG/M |
| 3300018868|Ga0187844_10412962 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cyclobacteriaceae → Algoriphagus | 552 | Open in IMG/M |
| 3300019788|Ga0182028_1383563 | All Organisms → Viruses → Predicted Viral | 1647 | Open in IMG/M |
| 3300020048|Ga0207193_1829901 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 561 | Open in IMG/M |
| 3300020582|Ga0210395_10903802 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 656 | Open in IMG/M |
| 3300021138|Ga0214164_1086134 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → unclassified Sphingobacteriales → Sphingobacteriales bacterium UPWRP_1 | 612 | Open in IMG/M |
| 3300021138|Ga0214164_1097943 | Not Available | 555 | Open in IMG/M |
| 3300022594|Ga0236340_1097185 | Not Available | 564 | Open in IMG/M |
| 3300025154|Ga0209417_1267914 | Not Available | 591 | Open in IMG/M |
| 3300025365|Ga0208621_1013498 | Not Available | 938 | Open in IMG/M |
| 3300025375|Ga0208259_1049166 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 576 | Open in IMG/M |
| 3300025574|Ga0208717_1143016 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Hanamia → Hanamia caeni | 516 | Open in IMG/M |
| 3300025650|Ga0209385_1209048 | Not Available | 535 | Open in IMG/M |
| 3300025739|Ga0209745_1127422 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium | 819 | Open in IMG/M |
| 3300025940|Ga0207691_11145902 | Not Available | 646 | Open in IMG/M |
| 3300026089|Ga0207648_11461776 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium | 642 | Open in IMG/M |
| 3300026089|Ga0207648_11782347 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cyclobacteriaceae → Algoriphagus | 577 | Open in IMG/M |
| 3300027707|Ga0209443_1273735 | Not Available | 568 | Open in IMG/M |
| 3300027719|Ga0209467_1299110 | Not Available | 535 | Open in IMG/M |
| 3300027736|Ga0209190_1385982 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 508 | Open in IMG/M |
| 3300027739|Ga0209575_10212515 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → unclassified Sphingobacteriales → Sphingobacteriales bacterium UPWRP_1 | 683 | Open in IMG/M |
| 3300027754|Ga0209596_1341852 | Not Available | 580 | Open in IMG/M |
| 3300027805|Ga0209229_10135719 | Not Available | 1110 | Open in IMG/M |
| 3300027805|Ga0209229_10229010 | Not Available | 829 | Open in IMG/M |
| 3300027806|Ga0209985_10201385 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → Flavobacterium muglaense | 946 | Open in IMG/M |
| 3300027816|Ga0209990_10262086 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 783 | Open in IMG/M |
| 3300027841|Ga0209262_10318307 | Not Available | 757 | Open in IMG/M |
| 3300027870|Ga0209023_10826330 | Not Available | 519 | Open in IMG/M |
| 3300027871|Ga0209397_10428900 | Not Available | 650 | Open in IMG/M |
| 3300027877|Ga0209293_10196189 | Not Available | 987 | Open in IMG/M |
| 3300027885|Ga0209450_10916675 | Not Available | 626 | Open in IMG/M |
| 3300027885|Ga0209450_11040894 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → Flavobacterium muglaense | 578 | Open in IMG/M |
| 3300027892|Ga0209550_10807496 | Not Available | 525 | Open in IMG/M |
| 3300027974|Ga0209299_1137466 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → Flavobacterium muglaense | 931 | Open in IMG/M |
| (restricted) 3300027977|Ga0247834_1164735 | Not Available | 878 | Open in IMG/M |
| (restricted) 3300028571|Ga0247844_1186367 | Not Available | 800 | Open in IMG/M |
| (restricted) 3300028576|Ga0255340_1316390 | Not Available | 586 | Open in IMG/M |
| (restricted) 3300028581|Ga0247840_10299197 | Not Available | 832 | Open in IMG/M |
| 3300028676|Ga0302167_10159463 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → unclassified Flavobacterium → Flavobacterium sp. 7E | 643 | Open in IMG/M |
| 3300028767|Ga0302288_1192340 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 599 | Open in IMG/M |
| 3300028774|Ga0302208_10135955 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 601 | Open in IMG/M |
| 3300029252|Ga0167179_1011333 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae | 2221 | Open in IMG/M |
| 3300029998|Ga0302271_10348561 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 643 | Open in IMG/M |
| 3300030001|Ga0302272_1191635 | Not Available | 540 | Open in IMG/M |
| 3300030047|Ga0302286_10412537 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium | 681 | Open in IMG/M |
| 3300031057|Ga0170834_104350348 | Not Available | 658 | Open in IMG/M |
| 3300031239|Ga0265328_10317404 | Not Available | 603 | Open in IMG/M |
| 3300031722|Ga0311351_11078601 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 615 | Open in IMG/M |
| 3300031786|Ga0315908_11554492 | Not Available | 514 | Open in IMG/M |
| 3300031787|Ga0315900_10488093 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → Flavobacterium muglaense | 938 | Open in IMG/M |
| 3300031787|Ga0315900_10924146 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 583 | Open in IMG/M |
| 3300031787|Ga0315900_10979217 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → unclassified Sphingobacteriales → Sphingobacteriales bacterium UPWRP_1 | 558 | Open in IMG/M |
| 3300031787|Ga0315900_10983939 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → unclassified Sphingobacteriales → Sphingobacteriales bacterium UPWRP_1 | 556 | Open in IMG/M |
| 3300031787|Ga0315900_11000529 | Not Available | 549 | Open in IMG/M |
| 3300031918|Ga0311367_11577618 | Not Available | 642 | Open in IMG/M |
| 3300031951|Ga0315904_10513612 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium | 1053 | Open in IMG/M |
| 3300032050|Ga0315906_10375849 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → Flavobacterium muglaense | 1248 | Open in IMG/M |
| 3300032177|Ga0315276_11840101 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 622 | Open in IMG/M |
| 3300032177|Ga0315276_11840101 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 622 | Open in IMG/M |
| 3300032177|Ga0315276_11840101 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 622 | Open in IMG/M |
| 3300032401|Ga0315275_10613505 | Not Available | 1215 | Open in IMG/M |
| 3300032401|Ga0315275_10613505 | Not Available | 1215 | Open in IMG/M |
| 3300032516|Ga0315273_12304089 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 628 | Open in IMG/M |
| 3300033406|Ga0316604_10315047 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → unclassified Sphingobacteriales → Sphingobacteriales bacterium UPWRP_1 | 854 | Open in IMG/M |
| 3300033433|Ga0326726_11950726 | Not Available | 572 | Open in IMG/M |
| 3300033483|Ga0316629_11011301 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → unclassified Flavobacterium → Flavobacterium sp. 7E | 654 | Open in IMG/M |
| 3300033483|Ga0316629_11011301 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → unclassified Flavobacterium → Flavobacterium sp. 7E | 654 | Open in IMG/M |
| 3300033487|Ga0316630_11738459 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → unclassified Sphingobacteriales → Sphingobacteriales bacterium UPWRP_1 | 568 | Open in IMG/M |
| 3300033521|Ga0316616_101212193 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 960 | Open in IMG/M |
| 3300033521|Ga0316616_101212193 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 960 | Open in IMG/M |
| 3300033521|Ga0316616_101212193 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 960 | Open in IMG/M |
| 3300033816|Ga0334980_0065913 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium | 1523 | Open in IMG/M |
| 3300033979|Ga0334978_0489439 | Not Available | 573 | Open in IMG/M |
| 3300033981|Ga0334982_0513989 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 528 | Open in IMG/M |
| 3300033995|Ga0335003_0479023 | Not Available | 517 | Open in IMG/M |
| 3300033995|Ga0335003_0491276 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → Flavobacterium fontis | 508 | Open in IMG/M |
| 3300034020|Ga0335002_0629556 | Not Available | 550 | Open in IMG/M |
| 3300034023|Ga0335021_0367840 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae → Chryseobacterium group → Chryseobacterium → Chryseobacterium faecale | 757 | Open in IMG/M |
| 3300034023|Ga0335021_0641747 | Not Available | 523 | Open in IMG/M |
| 3300034062|Ga0334995_0469542 | Not Available | 766 | Open in IMG/M |
| 3300034074|Ga0373894_055166 | Not Available | 602 | Open in IMG/M |
| 3300034101|Ga0335027_0679807 | Not Available | 614 | Open in IMG/M |
| 3300034108|Ga0335050_0450053 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 564 | Open in IMG/M |
| 3300034109|Ga0335051_0536379 | Not Available | 540 | Open in IMG/M |
| 3300034109|Ga0335051_0565787 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium | 522 | Open in IMG/M |
| 3300034117|Ga0335033_0502934 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 579 | Open in IMG/M |
| 3300034120|Ga0335056_0499963 | Not Available | 640 | Open in IMG/M |
| 3300034121|Ga0335058_0193705 | Not Available | 1188 | Open in IMG/M |
| 3300034122|Ga0335060_0458980 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → unclassified Sphingobacteriales → Sphingobacteriales bacterium UPWRP_1 | 663 | Open in IMG/M |
| 3300034128|Ga0370490_0079904 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium | 1068 | Open in IMG/M |
| 3300034128|Ga0370490_0130681 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium | 822 | Open in IMG/M |
| 3300034158|Ga0370507_0028569 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium | 1678 | Open in IMG/M |
| 3300034158|Ga0370507_0028569 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium | 1678 | Open in IMG/M |
| 3300034158|Ga0370507_0028569 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium | 1678 | Open in IMG/M |
| 3300034169|Ga0370480_0336361 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 507 | Open in IMG/M |
| 3300034192|Ga0373896_020895 | Not Available | 643 | Open in IMG/M |
| 3300034280|Ga0334997_0731890 | Not Available | 600 | Open in IMG/M |
| 3300034284|Ga0335013_0455233 | Not Available | 775 | Open in IMG/M |
| 3300034420|Ga0373918_0026536 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 1352 | Open in IMG/M |
| 3300034965|Ga0370497_0126388 | Not Available | 626 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 15.76% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 7.88% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 4.85% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 4.24% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 4.24% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.24% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 4.24% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 3.64% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 3.03% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.42% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 2.42% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.42% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 1.82% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.82% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.82% |
| Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 1.82% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.82% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 1.82% |
| Sediment Slurry | Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry | 1.82% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.21% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.21% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.21% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.21% |
| Lake Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Lake Sediment | 1.21% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.21% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 1.21% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 1.21% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.21% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 1.21% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.21% |
| Wastewater Effluent | Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent | 1.21% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.61% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.61% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.61% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 0.61% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.61% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.61% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.61% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.61% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.61% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.61% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.61% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.61% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.61% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.61% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.61% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.61% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 0.61% |
| Biosolids | Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Biosolids | 0.61% |
| Wastewater | Engineered → Built Environment → Water Treatment Plant → Unclassified → Unclassified → Wastewater | 0.61% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000176 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 epilimnion | Environmental | Open in IMG/M |
| 3300002072 | Barrow Graham LP Ref core NGADG0011-211 (Barrow Graham LP Ref core NGADG0011-211,NGADG0004-312, ASSEMBLY_DATE=20131005) | Environmental | Open in IMG/M |
| 3300002220 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011 | Engineered | Open in IMG/M |
| 3300002549 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-212 | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300002899 | Soil microbial communities from Manhattan, Kansas, USA - Combined assembly of Kansas soil 100-500um Nextera (ASSEMBLY_DATE=20140607) | Environmental | Open in IMG/M |
| 3300004769 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004792 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004810 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005831 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.43_YBM | Environmental | Open in IMG/M |
| 3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
| 3300006045 | Neocapritermes taracua P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P3 | Host-Associated | Open in IMG/M |
| 3300006056 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 10/23/14 1A DNA | Engineered | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006930 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC | Environmental | Open in IMG/M |
| 3300007590 | Estuarine microbial communities from the Columbia River estuary - metaG 1562A-02 | Environmental | Open in IMG/M |
| 3300007603 | Estuarine microbial communities from the Columbia River estuary - metaG 1568-02 | Environmental | Open in IMG/M |
| 3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
| 3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
| 3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
| 3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009037 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009087 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009120 | Lake sediment microbial communities from Tanners Lake, St. Paul, MN | Environmental | Open in IMG/M |
| 3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Host-Associated | Open in IMG/M |
| 3300010350 | AD_HKSTca | Engineered | Open in IMG/M |
| 3300010352 | AD_JPHWca | Engineered | Open in IMG/M |
| 3300011009 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_0.1_0.8_DNA | Environmental | Open in IMG/M |
| 3300012772 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130826_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012881 | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Gel_02_SludgeMetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014491 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG | Environmental | Open in IMG/M |
| 3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
| 3300015250 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT293B_16_10D | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018868 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_50 | Environmental | Open in IMG/M |
| 3300019788 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021138 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 epilimnion | Environmental | Open in IMG/M |
| 3300022594 | Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Summer S1 | Environmental | Open in IMG/M |
| 3300025154 | Soil microbial communities from Rifle, Colorado, USA - Groundwater F2 | Environmental | Open in IMG/M |
| 3300025365 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH26May08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025375 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH22May08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025574 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-3 shallow (SPAdes) | Environmental | Open in IMG/M |
| 3300025650 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B (SPAdes) | Environmental | Open in IMG/M |
| 3300025739 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-312 (SPAdes) | Environmental | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027707 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes) | Environmental | Open in IMG/M |
| 3300027719 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027739 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Medium cellulose week 11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027806 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027841 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027870 | Freshwater and sediment microbial communities from Lake Erie, Canada (SPAdes) | Environmental | Open in IMG/M |
| 3300027871 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027877 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027885 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027974 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027977 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_12m | Environmental | Open in IMG/M |
| 3300028571 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch201714.5m_1 | Environmental | Open in IMG/M |
| 3300028576 (restricted) | Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant10 | Engineered | Open in IMG/M |
| 3300028581 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_17m | Environmental | Open in IMG/M |
| 3300028676 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N1_1 | Environmental | Open in IMG/M |
| 3300028767 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N1_1 | Environmental | Open in IMG/M |
| 3300028774 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E2_3 | Environmental | Open in IMG/M |
| 3300029252 | Biosolids microbial communities from sewage treatment plant in Sweden - SWESTP26 - Henriksdal-digested 138 | Engineered | Open in IMG/M |
| 3300029998 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N1_1 | Environmental | Open in IMG/M |
| 3300030001 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N1_2 | Environmental | Open in IMG/M |
| 3300030047 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E2_3 | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Host-Associated | Open in IMG/M |
| 3300031722 | II_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300031786 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
| 3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
| 3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300033406 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_CT | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033483 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033487 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_A | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
| 3300033979 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME30Aug2017-rr0003 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
| 3300034020 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055 | Environmental | Open in IMG/M |
| 3300034023 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Oct2016-rr0090 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034074 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A4A4.1 | Engineered | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034108 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Jun2014-rr0157 | Environmental | Open in IMG/M |
| 3300034109 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME26Aug2009-rr0158 | Environmental | Open in IMG/M |
| 3300034117 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124 | Environmental | Open in IMG/M |
| 3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
| 3300034121 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174 | Environmental | Open in IMG/M |
| 3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
| 3300034128 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_16 | Environmental | Open in IMG/M |
| 3300034158 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_18 | Environmental | Open in IMG/M |
| 3300034169 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_15 | Environmental | Open in IMG/M |
| 3300034192 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A4A4.3 | Engineered | Open in IMG/M |
| 3300034280 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME10Aug2009-rr0048 | Environmental | Open in IMG/M |
| 3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
| 3300034420 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A1A4.1 | Engineered | Open in IMG/M |
| 3300034965 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_04D_17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| TB03JUN2009E_0292493 | 3300000176 | Freshwater | NVGVLDAALTVLAGVTVIVPVAFTVPQPPDNGML* |
| JGIcombinedJ21914_101771383 | 3300002072 | Arctic Peat Soil | LIHNVGEDDAAPTVLDGVTVIVPVALTVLHPPVNGIV* |
| MLSBCLC_107209111 | 3300002220 | Hydrocarbon Resource Environments | RVVLIQRVGVEDGADTVLLGVTVMVPVALTDPHPPVSGME* |
| JGI24130J36418_100652401 | 3300002549 | Arctic Peat Soil | ATNAVLTHNVGVVDATLTVLAGVTVMVPVALTDPHPPVKSML* |
| B570J40625_1007521074 | 3300002835 | Freshwater | APDVVWVILVSAVLIHKVGVDDAAPAVLTVMTVIEPVAFAVPQPPVRGIV* |
| JGIcombinedJ43975_100886192 | 3300002899 | Soil | AVFKHTVGLDDGVPAVLISFTVIVPVAVTLPQPPVNGML* |
| Ga0007748_113661131 | 3300004769 | Freshwater Lake | MVIFVKAVLIHKVGVVDAAPAVLAAVTVILPVAFPPPQPPVNGIL* |
| Ga0007761_112166121 | 3300004792 | Freshwater Lake | VIFTSNVLIHKVGVVEAALAVLAGVTIIVPVAFTLPQPPVNGIL* |
| Ga0007757_111674333 | 3300004810 | Freshwater Lake | NVLIHKVGVVEAALAVLAGVTIIVPVAFTLPQPPVKGIL* |
| Ga0065707_106655913 | 3300005295 | Switchgrass Rhizosphere | GNAVLIQSAGEDDGALTVLFGLTVMVPVALTFPQPPVKGIV* |
| Ga0070662_1015331942 | 3300005457 | Corn Rhizosphere | AVLIQSVGVDEAAPTVLFGFTVIVPVALTLPQPPVNGML* |
| Ga0068877_107293102 | 3300005525 | Freshwater Lake | DVLIQTVGVVDADVTVFAGVTLIVPEAFTVPQPPVSGML* |
| Ga0068877_107651361 | 3300005525 | Freshwater Lake | VVCVIAVSAVLMQRVGAEEAVPTVLSGVTVIVPVALTVPQPPVSGII* |
| Ga0068876_103901851 | 3300005527 | Freshwater Lake | VVMALLIQMVGVDEATLVVLSGVTVIVPVADTVPQPPVSGIL* |
| Ga0068872_104813572 | 3300005528 | Freshwater Lake | MVANEVLIHKVGVDDAALVVLSGVTVIVPVADTVPQPPVNGIL* |
| Ga0066705_108265123 | 3300005569 | Soil | APVVAIVMLVSAVLIHKIGDEDGVPAVLFGVTIIVPVAFTLPQPPVNGML* |
| Ga0074471_100452403 | 3300005831 | Sediment (Intertidal) | IHNVGVEEAVPTVLAGVTVIVPVALTVPQPPERGTV* |
| Ga0078893_105808224 | 3300005837 | Marine Surface Water | VAIVILVNEVFIHSVGEEDGVPAVLSGVTVIVPVALTVPQPPESGMV* |
| Ga0082212_110231663 | 3300006045 | Termite Gut | VIGVRGVLIHNVGEDDAAPAVISGLTVIVPVAFTVPQPPVNGMV* |
| Ga0075163_107751254 | 3300006056 | Wastewater Effluent | APPVVWVMAVNGVLMHNVGVEDAAPAVLLSVTVMVPVALTVPQPPVSGIA* |
| Ga0075163_110051824 | 3300006056 | Wastewater Effluent | QSVGVDDAAPAVFAGVTVIVPVAFTVPQPPVKGIL* |
| Ga0075017_1009036713 | 3300006059 | Watersheds | VTIVITGDIAVLLHNVGDDEGVPTVLLGVIVIVPVAFTLLQPPVKGIL* |
| Ga0075030_1013479651 | 3300006162 | Watersheds | AVLIHKVGVDDGEPAVLDVVTVIVPVALTLPQPPVNGML* |
| Ga0079303_104803743 | 3300006930 | Deep Subsurface | MAVSGVLIQSVGVDEAALTVLFVMTVIVPVAFAVPHPP |
| Ga0102917_11126262 | 3300007590 | Estuarine | FIHNVGVLDAAPAVFAAVTVTVPLALTLPQPPVKGIL* |
| Ga0102921_12676491 | 3300007603 | Estuarine | LIQSVGVDEAAPAVFAAVTVIVPVAITLPHPPVRGTL* |
| Ga0114344_11288714 | 3300008111 | Freshwater, Plankton | VRALLIQMVGVLDAALVVLSGVTVIVPVAFILPHPPVNGIL* |
| Ga0114347_12434273 | 3300008114 | Freshwater, Plankton | VCVMVANEVLIHKVGVDDAALVVLSGVTVIVPVADTVPQPPVNGIL* |
| Ga0114351_14214911 | 3300008117 | Freshwater, Plankton | VANEVLIHKVGVDDAALVVLSGVTVIVPVADMVPQPPVNGIL* |
| Ga0102831_11664302 | 3300008996 | Estuarine | VIAVKTVLIQSDGVELGAVTVLFGVTVMVPVAIPPHPPVNGML* |
| Ga0105105_107473863 | 3300009009 | Freshwater Sediment | IQSVGVDDAALTVLAAVTVIVPVALTVPQPPVSGIV* |
| Ga0105093_105862943 | 3300009037 | Freshwater Sediment | AVNAVLIQSVGVDDAALTVLAAVTVIVRVALTAPQPPVSGVV* |
| Ga0105107_106487061 | 3300009087 | Freshwater Sediment | QSVGVEEGALAVLLAVTVIVLVAFAVPQPPVKGIL* |
| Ga0105107_106487062 | 3300009087 | Freshwater Sediment | MAVSGVLIQSVGVDEAALTVLLVMTVIVPVAFAAPQPPVNGML* |
| Ga0117941_11641012 | 3300009120 | Lake Sediment | MHNVGVDEAEPTVFAGVTVIVPVAFTVPQPPVKGIE* |
| Ga0117941_11641014 | 3300009120 | Lake Sediment | VLMHNVGVDEAVPTVFAGVTVIVPVAFTVPQPPVNGMV* |
| Ga0115027_112071661 | 3300009131 | Wetland | MAVSGVLIQSVGVDEAAPTVLLAVTVIVPVAFAVPHPPVNGM |
| Ga0115027_114888922 | 3300009131 | Wetland | MAVSGVLIQSVGVDEAALTVLFVMTVIVPVAFAVPHPPVKGML* |
| Ga0114978_100816602 | 3300009159 | Freshwater Lake | VKGLLIHNVGVEDAAPTVFARVTVIDPVAFTVPQPPVNKIL* |
| Ga0114970_105279333 | 3300009163 | Freshwater Lake | WAVLIHIGVNEAAVTVLASVTVIVPVALTVPQPPPVKGML* |
| Ga0113563_139950042 | 3300009167 | Freshwater Wetlands | SVGVDEAALTVLLAVTVIVPVAFAVPHPPVNGIL* |
| Ga0114967_104428213 | 3300010160 | Freshwater Lake | VKAVLLHTVGVEEAAATVLLTVTVIVPVAFTVPQPPPVKGML* |
| Ga0123353_122693243 | 3300010167 | Termite Gut | LIQPVEVVGDCGVTVLAAVTVIVPVALSVPQPPVNGME* |
| Ga0116244_107121781 | 3300010350 | Anaerobic Digestor Sludge | HNVGVDDGILTVLAGVTVIVPAALTDPQPPVKGMV* |
| Ga0116247_103852024 | 3300010352 | Anaerobic Digestor Sludge | VIAVRAVLIQSVGVEDAAVTVLFGITVIVPVAFTAPHPPVSGML* |
| Ga0129318_102847532 | 3300011009 | Freshwater To Marine Saline Gradient | VIAVKAVLIQSDGVVVGDVTVLSGVTVMVPVALTVPQPP |
| Ga0138287_11292823 | 3300012772 | Freshwater Lake | VVLVMLVKAVLIQSVGFEEAVPAVFAGVTVIVPVAFTDPQPPVNGML* |
| Ga0079063_13697521 | 3300012881 | Anaerobic Digestor Sludge | VVWVIAVNGVLIHKVGLEDAALTVIFGVTVIVPVAFTVPQPPAKGML* |
| Ga0164293_105965241 | 3300013004 | Freshwater | IVMLVSAVLIHKVGVLDGVPAVLFGVTVIVPVALTVPQPPVKGIV* |
| Ga0157370_114776053 | 3300013104 | Corn Rhizosphere | VSAVFTQSVGEDDAALTVLAGVTVMVPVAFTDPHPPVSGME* |
| Ga0170791_126143753 | 3300013295 | Freshwater | VRVIAVSAVLIQSVGVEEAVPGVFAGVTVIVPVAFTAPQPPVKGML* |
| Ga0163162_122243073 | 3300013306 | Switchgrass Rhizosphere | HNVGFDEAAPAVLAGFTVIVPVAFPAPQPPVKGMV* |
| Ga0182014_102820502 | 3300014491 | Bog | MAVSAVLIHNVGDEEGLPAVFAGVTVIVPAAFTLPHPPVNGML* |
| Ga0182014_102820504 | 3300014491 | Bog | IVIFVNAVLIHKVGVEDGVPAVFAGVTVIVPVAFTLPHPPVNGIL* |
| Ga0182027_110219522 | 3300014839 | Fen | MDVSAVLIHNVGVEEGLPAVFAGVTVIVPLAVIFPHPPVNVTV* |
| Ga0137405_13849125 | 3300015053 | Vadose Zone Soil | LIHKVGVDDGALAVLAAVTVIVPVAFTAPQPPVKRML* |
| Ga0173478_101351634 | 3300015201 | Soil | VCVMLVISVLIHNAGLDDATVTVLTGLTVMVPIADTEPQPPVNGML* |
| Ga0180072_10698533 | 3300015250 | Soil | AVRAVLIQSVGVDDAALTVLAGVTVMVPVALTAPQPPVSGMV* |
| Ga0180072_10759531 | 3300015250 | Soil | AVRAVLIQSVGVDDAALTVLAGVTVIVPVALTAPQPPVSGMV* |
| Ga0190274_128653702 | 3300018476 | Soil | VSKVLTHKVGVDEATLTVLFGETIIVPVALTALQPPVNGIV |
| Ga0187844_104129623 | 3300018868 | Freshwater | VLIHNVGVEFAAPTVLARVTVIVPVALTLPQPPVNKIE |
| Ga0182028_13835633 | 3300019788 | Fen | MGDIISTVLIHNVGVDDGAPAVLAAVTVIVPVALTAPQPPVSGMV |
| Ga0207193_18299012 | 3300020048 | Freshwater Lake Sediment | MFVRAVLIHKVGVEEAAPTVLAGVTVIVPVAFTVPQPPVN |
| Ga0210395_109038023 | 3300020582 | Soil | IHSVGVDDGLPTVLAGVTVIVPVALTVPQPPVKGML |
| Ga0214164_10861343 | 3300021138 | Freshwater | VCVIAISAVLIHNVGVLDGALTVLAGVTVIVPVAFTVPQPPVTGML |
| Ga0214164_10979431 | 3300021138 | Freshwater | IHTVGELDAALTVLAGVIVIVPVALTVPQPPDNGML |
| Ga0236340_10971851 | 3300022594 | Freshwater | VIAGDKAVLIHNVGEDDAALAVLSGFTVIVPVALTLPQPP |
| Ga0209417_12679143 | 3300025154 | Soil | MAVNAVLIHNVGVDDGAPAVLAGVTVIVPVALTDPQPPVSGMV |
| Ga0208621_10134984 | 3300025365 | Freshwater | AVLIHNVGVLDGALTVLAGVTVIVPVALTVPQPPDNGML |
| Ga0208259_10491663 | 3300025375 | Freshwater | CVIAVKAVLIHTVGALDAVLTVLFGVTVIVPVAFTVPQPPVNGML |
| Ga0208717_11430161 | 3300025574 | Arctic Peat Soil | NGEPIHNIGDEDGVPAVLGAVTDIVPVAFTVPQPPVNGIL |
| Ga0209385_12090483 | 3300025650 | Arctic Peat Soil | AVLIHKVGVEEPTVTVMAGVTVIVPVAFTVPQPPVSGML |
| Ga0209745_11274223 | 3300025739 | Arctic Peat Soil | MQSVGVDEAALTVLLAVTVIVPVALAAPHPPVNGMV |
| Ga0207691_111459021 | 3300025940 | Miscanthus Rhizosphere | LVNAVLIHKVGVDEAALTVLFGLTVIVPVAFTVLQPPVNGMV |
| Ga0207648_114617763 | 3300026089 | Miscanthus Rhizosphere | LIQTVGVDEGPLAVLDVMTVIVPVALTLPQPPVSRML |
| Ga0207648_117823471 | 3300026089 | Miscanthus Rhizosphere | AVLIQTVGVDEGPLAVLDVMTVIVPVAPTLPQPPVSRML |
| Ga0209443_12737353 | 3300027707 | Freshwater Lake | NNAVLIHKVGVLDANVTVFKSVTVIVPTAFTLPHPPVNGIL |
| Ga0209467_12991101 | 3300027719 | Freshwater | VLIQSVGVDEAALTVLLAVTVIVPVAFAVPHPPVNGML |
| Ga0209190_13859821 | 3300027736 | Freshwater Lake | ISVFTHTVGLEEAAAAVLVVVTVIVPVALTVPQPPVNGIE |
| Ga0209575_102125153 | 3300027739 | Freshwater | QSVGVDEAALTVLLAVTVIVPVAFAVPHPPVNGML |
| Ga0209596_13418522 | 3300027754 | Freshwater Lake | HKIGLELAAAAVLAAVTVIVPVAFIIPQPPVKGIL |
| Ga0209246_104194572 | 3300027785 | Freshwater Lake | PVVVCVMLVKTVLTHNVGVDEAAPAVLATVTVIVPVAFTLPQPPVNGIL |
| Ga0209972_101320771 | 3300027793 | Freshwater Lake | IFVSAVLTHSVGDEEAAPAVLLERTVIVPVAFTLPQPPVSGME |
| Ga0209229_101357195 | 3300027805 | Freshwater And Sediment | FGESAALIQTDGLAEGAAAVLVAFTVIEPVAFTVPQPPVRGME |
| Ga0209229_102290104 | 3300027805 | Freshwater And Sediment | IQAVGFEDGAETVLFGVIVIVPVALTVPQPPVNGTV |
| Ga0209985_102013851 | 3300027806 | Freshwater Lake | IQRVGVADAADAVLFGVTVMVPVAFKLAQPPFSGML |
| Ga0209990_102620864 | 3300027816 | Freshwater Lake | LIQIVGVDDAALVVFVCMTVIVPVAFILPQPPVNGIL |
| Ga0209262_103183074 | 3300027841 | Freshwater | VVLTHKVGVDEATPAVLVALTVIVPVAFILPQPPANGIV |
| Ga0209023_108263301 | 3300027870 | Freshwater And Sediment | VLIHLVCGVDAVAVIFAVTVIVPVAFTLPQPPVNGML |
| Ga0209397_104289003 | 3300027871 | Wetland | LTHTVGVADGALTVLFGDTVIVPVALTAPQPPVNGMV |
| Ga0209293_101961893 | 3300027877 | Wetland | VLTQSAGVEEAALTVLLVMTVIVPVAFAVPHPPVNGML |
| Ga0209450_109166751 | 3300027885 | Freshwater Lake Sediment | GVSDVLIHNVGVEEAVPTVLAGVTVIVPVVLTVPQPPERGTV |
| Ga0209450_110408943 | 3300027885 | Freshwater Lake Sediment | PIQSVGVDEAAPAVLAGVTVMVPVAFIVPHPPVKGMV |
| Ga0209550_108074963 | 3300027892 | Freshwater Lake | VILGSTVLIHRVGVAEATLAVLAAVTVIVPVAFTLPQPPVNGIV |
| Ga0209299_11374664 | 3300027974 | Freshwater Lake | VLVMFVNAVLIHSVGFEDGVPAVLAGVTVIVPVAFTLPQPPVNGML |
| (restricted) Ga0247834_11647354 | 3300027977 | Freshwater | HKVGVLDAAPAVLAGVGVTVIVPVALTEEPHPPVNGML |
| (restricted) Ga0247844_11863671 | 3300028571 | Freshwater | AVLIHKVGVLDAAPAVLFGVTVIVPVALTEEPHPPVNGML |
| (restricted) Ga0255340_13163903 | 3300028576 | Wastewater | LIQREGVEEAAPAVLFGVTVIVPEAETLPQPPVRGML |
| (restricted) Ga0247840_102991971 | 3300028581 | Freshwater | ILVNAVLIPSVGVEEAAPAVLFGVTVIVPVALTELQPPVNGML |
| Ga0302167_101594633 | 3300028676 | Fen | LIHSVGVDEAAPTVILAVTVIVPVALTVPQPPVSGIL |
| Ga0302288_11923403 | 3300028767 | Fen | LTHKVGVEEAVPTVFAAVTVIVPVAFTVAQPPANGIV |
| Ga0302208_101359551 | 3300028774 | Fen | LIHKVGVDEAAVTVFAAVTVIVPVALTIAQPPANGIV |
| Ga0167179_10113336 | 3300029252 | Biosolids | MLVIAELIQVVGDDDAAVTVLSGVTVIVPVAEALPQFPTRGMV |
| Ga0302271_103485611 | 3300029998 | Bog | VLIHKVGVDEAAVTVFAAVTVIVPVALITAQPPDNGIE |
| Ga0302272_11916353 | 3300030001 | Bog | TVLIHKVGVDEAAVTVFAAVTVIVPVAFIVAQPPANGIE |
| Ga0302286_104125373 | 3300030047 | Fen | VWVIAVSAVLTHKVGVDEAAVTVFAAVTVIVPVALTIAQPPANGIV |
| Ga0170834_1043503483 | 3300031057 | Forest Soil | VKVIGVNAVLIHNVGVEEAALTVFPAVTVIVPVALTLPPQPVSGML |
| Ga0265328_103174041 | 3300031239 | Rhizosphere | WVILVKGVLIQSVGVAEAALTVLAGVTVIVPVAFTKPQPPVKGME |
| Ga0311351_110786013 | 3300031722 | Fen | AVRGVLIHSVGVAEAAPTVILAVTVIVPVALTVPQPPVSGIL |
| Ga0315908_115544921 | 3300031786 | Freshwater | VAWVMEVNGVFTNNVGVELAVPTVFAGATVIVPVAFTEPQPPINGML |
| Ga0315900_104880934 | 3300031787 | Freshwater | NEVLIHKVGVDDAALVVLSGVTVIVPVADTVPQPPVNGIL |
| Ga0315900_109241461 | 3300031787 | Freshwater | FVKAVLTHNVGVEDAAPAVLAAVTVIVPVAFTLPQPPVNGIV |
| Ga0315900_109792171 | 3300031787 | Freshwater | QIVGVDDAALVVFVCMTVIVPVAFILPQPPVNGIL |
| Ga0315900_109839393 | 3300031787 | Freshwater | VANEVLIHNVGVDDAALVVLSGVTVIVPVADMVPQPPVNGIL |
| Ga0315900_110005292 | 3300031787 | Freshwater | GIDVLIQTVGVVDADVTVFAGVTLIVPEAFTVPQPPVSGML |
| Ga0311367_115776181 | 3300031918 | Fen | VRAVLIHKVGVDEAAVTVFAAVTVIVPVALTIAQPPANGIV |
| Ga0315904_105136121 | 3300031951 | Freshwater | VCVMVANEVLIHNVGVDDAALVVLSGVTVIVPVADMVPQPPVNGIL |
| Ga0315906_103758491 | 3300032050 | Freshwater | IHNVGVDDAALVVLSGVTVIVPVADTVPQPPVNGML |
| Ga0315283_120482213 | 3300032164 | Sediment | VVVCVMFVIRVLIHNVGVDEGAPAVLLAVTVIVPVAFTLPQPPVKGML |
| Ga0315276_118401011 | 3300032177 | Sediment | MFVIRVLIHKVGVDEGAPAELVSITVIVPVAFTDP |
| Ga0315276_118401012 | 3300032177 | Sediment | MFVIRVLIHNVGVDEGAPAVLVSITVIVPVAFTDPQPPVKGML |
| Ga0315276_118401013 | 3300032177 | Sediment | MFVIRVLIHNVGVDEGAPSVLFGVTVIVPVAFTDPQPPVRGML |
| Ga0315275_106135053 | 3300032401 | Sediment | MFVIRVLIHKVGVDEGAPAVLFAVTVIVPVAFTDPQPPVRGML |
| Ga0315275_106135054 | 3300032401 | Sediment | MFVIRVLIHNVGVDEAAPAVLFGVTVIVPVAFTDPQPPVRGML |
| Ga0315273_123040893 | 3300032516 | Sediment | MFVNRVLIHKVGVDEGAPAVLFGVTVIVPVAFTDPQPPVKGML |
| Ga0316604_103150474 | 3300033406 | Soil | VLIQSVGVDEAALTVLLGVTVIVPVALAVPHPPVNGML |
| Ga0326726_119507263 | 3300033433 | Peat Soil | ILVNTVLTHKVGVDDAAPAVLAVLTVIVPVAFTAPHPPVSGML |
| Ga0316629_110113011 | 3300033483 | Soil | IAVSGVLIHNVGVDEAALTVLLAVTVIVPVALAVPHPPVNGML |
| Ga0316629_110113013 | 3300033483 | Soil | MAVRGVLIQSVGVDEAAPTVLLAVTVIVPVAFAVPHPPVNGML |
| Ga0316630_117384591 | 3300033487 | Soil | SVLIHNVGVDDGALTVLSGLTVIVPVALTVPHPPVNGML |
| Ga0316616_1012121932 | 3300033521 | Soil | MAVSGVLIQSVGVDEAALTVLLAVTVIVPVAFAVPHPPVNGIL |
| Ga0316616_1012121934 | 3300033521 | Soil | MAVSGVLIQSVGVDEAALTVLFVMTVIVPVAFAVPHPPVKGML |
| Ga0316616_1012121936 | 3300033521 | Soil | MAVSGVLIQSVGVDEAALTVLFVMTVIVPVAFAVPHPPVNGML |
| Ga0334980_0065913_1299_1430 | 3300033816 | Freshwater | MFVKVVLIQIVGVDEAAPAVLEGVTIMVPVAATLPHPSAIGIL |
| Ga0334978_0489439_3_131 | 3300033979 | Freshwater | LVSAVLIHKVGVLDGVPAVLFGVTVIVPVALIVPQPPVKGIV |
| Ga0334982_0513989_120_230 | 3300033981 | Freshwater | MHNSGADEAAETVFAGVTIIVPVALKLLQPPVNGML |
| Ga0335003_0479023_388_516 | 3300033995 | Freshwater | LVIAVLVHTDGVDDATPNVLAGVTVIVPVAFTEPQPPVNGML |
| Ga0335003_0491276_373_504 | 3300033995 | Freshwater | MLVKAVLIQSVGVDDAVPAVFAAVTVIVPVAFTGAQLPTNGIL |
| Ga0335002_0629556_22_153 | 3300034020 | Freshwater | MLVSAVLIHKVGVLDGAPAVLFGVTVIVPVAFTEPQPPVKGIV |
| Ga0335021_0367840_441_551 | 3300034023 | Freshwater | MHKVGVEDAAVTVFSGVTVIVPVAAVVPHPPVNVTV |
| Ga0335021_0553925_3_125 | 3300034023 | Freshwater | SAVLTHSVGDEEAAPAVLLERTVIVPVAFTLPQPPVSGME |
| Ga0335021_0641747_12_131 | 3300034023 | Freshwater | MLLMIKVGDADAALAVLAGVTVIVPIALMSSQPPVNGIV |
| Ga0334995_0469542_3_125 | 3300034062 | Freshwater | MSVRAVLMQRVGVEVAAPTVLSGVTVMVPEAFTVPQPPVSG |
| Ga0334995_0654331_235_396 | 3300034062 | Freshwater | MPVAPVVACVILVIAALTHSVGDEEAAPAVLTADTVIVPVAFTLPQPPVSGIE |
| Ga0373894_055166_1_126 | 3300034074 | Sediment Slurry | GIAVLIQTFGDVEAAVTVLFALTVIVPVAFTVPQPPVSGIE |
| Ga0335027_0660147_41_202 | 3300034101 | Freshwater | MPVAPEVICVMVPKDVLIHKVGVDDAALVVLSGVTVIVPLADTVPQPPVNGIL |
| Ga0335027_0679807_2_127 | 3300034101 | Freshwater | VIALLMQIVGVDDAALVVLSGVIVIVPLADTVPQPPVNGML |
| Ga0335050_0450053_458_562 | 3300034108 | Freshwater | MHKVGVVEGALAVFSGVTVIVPVAFTSPQPPDSET |
| Ga0335051_0536379_414_539 | 3300034109 | Freshwater | VIALLMQIVGVDDAALVVLSGVTVIVPLADTVPQPPVNGIL |
| Ga0335051_0565787_5_166 | 3300034109 | Freshwater | MPVAPEVICVMVPKDVLIHNVGVDEAALVVFAEITFIVPIADTVPQPPVNGML |
| Ga0335033_0502934_453_578 | 3300034117 | Freshwater | VSAAFKHSVGEEDAALTVLFGVTVMVPKAFTLPQPPVNGIM |
| Ga0335056_0499963_3_110 | 3300034120 | Freshwater | HRVGVLDGAPAVLFGVTVIVPVAFTEPQPPVKGIV |
| Ga0335058_0193705_1067_1186 | 3300034121 | Freshwater | AVLIHSVGVLEAAVAVLAAVTVMVPVAFTLPHPPVNGIL |
| Ga0335060_0458980_1_132 | 3300034122 | Freshwater | MLVSAVLIHRVGVLDGAPAVLFGVTVIVPVALIVPQPPVKGIV |
| Ga0370490_0079904_42_176 | 3300034128 | Untreated Peat Soil | VIAVSGVLIQSVGVEEAALTVLLVITVIVPVAFAAPQPPVNGML |
| Ga0370490_0130681_637_753 | 3300034128 | Untreated Peat Soil | VLIQSVGVDEAALTVLLTVTVIVPVAFAAPQPPVNGML |
| Ga0370507_0028569_476_592 | 3300034158 | Untreated Peat Soil | VLTQSVGVDEAALTVLLLMTVIVPVAFAAPHPPVNGML |
| Ga0370507_0028569_734_850 | 3300034158 | Untreated Peat Soil | VLTQSVGVEEAALTVLLAVTVIVPTALTVPHPPVNGML |
| Ga0370507_0028569_992_1108 | 3300034158 | Untreated Peat Soil | VLIQSVGVEEAALTVLLVMTVIVPVAFAAPQPPVNGML |
| Ga0370480_0336361_275_391 | 3300034169 | Untreated Peat Soil | VLTQSVGVEEAALTVLLAVTVIVPVALNVPHPPVNGML |
| Ga0373896_020895_438_560 | 3300034192 | Sediment Slurry | MAVLIQTVGVEEAAETVLSEVTVIVPVAFTVPQPSVNGIE |
| Ga0334997_0731890_481_600 | 3300034280 | Freshwater | ALLIQIVGVDDAALVVLSGVIVIVPLADTVPQPPVNGML |
| Ga0335013_0455233_658_774 | 3300034284 | Freshwater | VLMQRLGAKEAAPTVLSGVTVMVPEAFTVPQPPVSGML |
| Ga0373918_0026536_65_187 | 3300034420 | Sediment Slurry | MAVLIQTVGVEEAADTVLFGVTLIVPVALKVPHPPVSGIE |
| Ga0370497_0126388_2_139 | 3300034965 | Untreated Peat Soil | MVMFVNRVLMHKVGVEDGAPAVLAGVTVIVPVALTAEQPPVSGIV |
| ⦗Top⦘ |